C2H2-type domain-containing protein

Overview
NameC2H2-type domain-containing protein
Smed IDSMED30012110
Length (bp)766
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of C2H2-type domain-containing protein (SMED30012110) t-SNE clustered cells

Violin plots show distribution of expression levels for C2H2-type domain-containing protein (SMED30012110) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of C2H2-type domain-containing protein (SMED30012110) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for C2H2-type domain-containing protein (SMED30012110) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012110

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30012110SMESG000064731.1 dd_Smed_v4_18947_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30012110SMESG000064731.1 dd_Smed_v4_18947_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30012110SMESG000064731.1 dd_Smed_v4_18947_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30012110SMESG000064731.1 dd_Smed_v4_18947_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
body wall musculatureSMED30012110SMESG000064731.1 dd_Smed_v4_18947_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30012110SMESG000064731.1 dd_Smed_v4_18947_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of C2H2-type domain-containing protein vs. Ensembl Human
Match: BNC2 (basonuclin 2 [Source:HGNC Symbol;Acc:HGNC:30988])

HSP 1 Score: 48.1358 bits (113), Expect = 8.980e-6
Identity = 19/25 (76.00%), Postives = 22/25 (88.00%), Query Frame = 1
Query:  223 LKIHYSAVHLREMHRCTIKGCNMWF 297
            LKIHY+AVHL+  HRCTI+GCNM F
Sbjct:  282 LKIHYNAVHLKIKHRCTIEGCNMVF 306          
BLAST of C2H2-type domain-containing protein vs. Ensembl Celegans
Match: bnc-1 (BasoNuClin-1 zinc finger protein homolog [Source:UniProtKB/TrEMBL;Acc:Q1ZXU0])

HSP 1 Score: 46.2098 bits (108), Expect = 5.850e-6
Identity = 19/26 (73.08%), Postives = 20/26 (76.92%), Query Frame = 1
Query:  220 ALKIHYSAVHLREMHRCTIKGCNMWF 297
            ALKIH SAVHLREMH CT+ GC   F
Sbjct:  121 ALKIHTSAVHLREMHTCTVTGCGKQF 146          
BLAST of C2H2-type domain-containing protein vs. Ensembl Fly
Match: disco (gene:FBgn0000459 transcript:FBtr0074250)

HSP 1 Score: 57.3806 bits (137), Expect = 3.633e-9
Identity = 39/52 (75.00%), Postives = 47/52 (90.38%), Query Frame = 1
Query:  220 ALKIHYSAVHLREMHRCTIKGCNMWFXXXXXXXXXXXXXXXXLHLSHSNKKL 375
            ALKIH+SAVHLREMH+CT++GCNM FSSRRSRNRHS+NPNP+LH  H  +K+
Sbjct:  106 ALKIHFSAVHLREMHKCTVEGCNMVFSSRRSRNRHSANPNPKLHSPHIRRKI 157          
BLAST of C2H2-type domain-containing protein vs. Ensembl Fly
Match: disco (gene:FBgn0000459 transcript:FBtr0100384)

HSP 1 Score: 57.3806 bits (137), Expect = 3.633e-9
Identity = 39/52 (75.00%), Postives = 47/52 (90.38%), Query Frame = 1
Query:  220 ALKIHYSAVHLREMHRCTIKGCNMWFXXXXXXXXXXXXXXXXLHLSHSNKKL 375
            ALKIH+SAVHLREMH+CT++GCNM FSSRRSRNRHS+NPNP+LH  H  +K+
Sbjct:  106 ALKIHFSAVHLREMHKCTVEGCNMVFSSRRSRNRHSANPNPKLHSPHIRRKI 157          
BLAST of C2H2-type domain-containing protein vs. Ensembl Fly
Match: disco-r (gene:FBgn0285879 transcript:FBtr0310302)

HSP 1 Score: 53.5286 bits (127), Expect = 7.679e-8
Identity = 38/52 (73.08%), Postives = 46/52 (88.46%), Query Frame = 1
Query:  220 ALKIHYSAVHLREMHRCTIKGCNMWFXXXXXXXXXXXXXXXXLHLSHSNKKL 375
            ALKIH+SAVHLREMH+CT+ GC+M FSSRRSRNRHS+NPNP+LH  H  +K+
Sbjct:  489 ALKIHFSAVHLREMHKCTVDGCSMMFSSRRSRNRHSANPNPKLHSPHLRRKI 540          
BLAST of C2H2-type domain-containing protein vs. Ensembl Fly
Match: disco-r (gene:FBgn0285879 transcript:FBtr0074251)

HSP 1 Score: 53.5286 bits (127), Expect = 7.679e-8
Identity = 38/52 (73.08%), Postives = 46/52 (88.46%), Query Frame = 1
Query:  220 ALKIHYSAVHLREMHRCTIKGCNMWFXXXXXXXXXXXXXXXXLHLSHSNKKL 375
            ALKIH+SAVHLREMH+CT+ GC+M FSSRRSRNRHS+NPNP+LH  H  +K+
Sbjct:  489 ALKIHFSAVHLREMHKCTVDGCSMMFSSRRSRNRHSANPNPKLHSPHLRRKI 540          
BLAST of C2H2-type domain-containing protein vs. Ensembl Fly
Match: disco-r (gene:FBgn0285879 transcript:FBtr0310303)

HSP 1 Score: 53.5286 bits (127), Expect = 7.679e-8
Identity = 38/52 (73.08%), Postives = 46/52 (88.46%), Query Frame = 1
Query:  220 ALKIHYSAVHLREMHRCTIKGCNMWFXXXXXXXXXXXXXXXXLHLSHSNKKL 375
            ALKIH+SAVHLREMH+CT+ GC+M FSSRRSRNRHS+NPNP+LH  H  +K+
Sbjct:  489 ALKIHFSAVHLREMHKCTVDGCSMMFSSRRSRNRHSANPNPKLHSPHLRRKI 540          
BLAST of C2H2-type domain-containing protein vs. Ensembl Zebrafish
Match: bnc2 (basonuclin 2 [Source:ZFIN;Acc:ZDB-GENE-030131-5784])

HSP 1 Score: 48.521 bits (114), Expect = 4.858e-6
Identity = 17/25 (68.00%), Postives = 20/25 (80.00%), Query Frame = 1
Query:  223 LKIHYSAVHLREMHRCTIKGCNMWF 297
            L++HY  VHLREMH+C I GCNM F
Sbjct: 1091 LRVHYKTVHLREMHKCKIPGCNMMF 1115          

HSP 2 Score: 47.7506 bits (112), Expect = 8.987e-6
Identity = 19/25 (76.00%), Postives = 22/25 (88.00%), Query Frame = 1
Query:  223 LKIHYSAVHLREMHRCTIKGCNMWF 297
            LKIHY+AVHL+  HRCTI+GCNM F
Sbjct:  385 LKIHYNAVHLKIKHRCTIEGCNMVF 409          
BLAST of C2H2-type domain-containing protein vs. Ensembl Zebrafish
Match: bnc2 (basonuclin 2 [Source:ZFIN;Acc:ZDB-GENE-030131-5784])

HSP 1 Score: 48.521 bits (114), Expect = 5.102e-6
Identity = 17/25 (68.00%), Postives = 20/25 (80.00%), Query Frame = 1
Query:  223 LKIHYSAVHLREMHRCTIKGCNMWF 297
            L++HY  VHLREMH+C I GCNM F
Sbjct: 1121 LRVHYKTVHLREMHKCKIPGCNMMF 1145          

HSP 2 Score: 47.3654 bits (111), Expect = 9.522e-6
Identity = 19/25 (76.00%), Postives = 22/25 (88.00%), Query Frame = 1
Query:  223 LKIHYSAVHLREMHRCTIKGCNMWF 297
            LKIHY+AVHL+  HRCTI+GCNM F
Sbjct:  415 LKIHYNAVHLKIKHRCTIEGCNMVF 439          
BLAST of C2H2-type domain-containing protein vs. Ensembl Zebrafish
Match: bnc2 (basonuclin 2 [Source:ZFIN;Acc:ZDB-GENE-030131-5784])

HSP 1 Score: 48.521 bits (114), Expect = 5.102e-6
Identity = 17/25 (68.00%), Postives = 20/25 (80.00%), Query Frame = 1
Query:  223 LKIHYSAVHLREMHRCTIKGCNMWF 297
            L++HY  VHLREMH+C I GCNM F
Sbjct: 1121 LRVHYKTVHLREMHKCKIPGCNMMF 1145          

HSP 2 Score: 47.3654 bits (111), Expect = 9.522e-6
Identity = 19/25 (76.00%), Postives = 22/25 (88.00%), Query Frame = 1
Query:  223 LKIHYSAVHLREMHRCTIKGCNMWF 297
            LKIHY+AVHL+  HRCTI+GCNM F
Sbjct:  415 LKIHYNAVHLKIKHRCTIEGCNMVF 439          
BLAST of C2H2-type domain-containing protein vs. Ensembl Zebrafish
Match: bnc2 (basonuclin 2 [Source:ZFIN;Acc:ZDB-GENE-030131-5784])

HSP 1 Score: 48.1358 bits (113), Expect = 5.417e-6
Identity = 17/25 (68.00%), Postives = 20/25 (80.00%), Query Frame = 1
Query:  223 LKIHYSAVHLREMHRCTIKGCNMWF 297
            L++HY  VHLREMH+C I GCNM F
Sbjct: 1173 LRVHYKTVHLREMHKCKIPGCNMMF 1197          
BLAST of C2H2-type domain-containing protein vs. Ensembl Zebrafish
Match: bnc2 (basonuclin 2 [Source:ZFIN;Acc:ZDB-GENE-030131-5784])

HSP 1 Score: 48.1358 bits (113), Expect = 5.542e-6
Identity = 17/25 (68.00%), Postives = 20/25 (80.00%), Query Frame = 1
Query:  223 LKIHYSAVHLREMHRCTIKGCNMWF 297
            L++HY  VHLREMH+C I GCNM F
Sbjct: 1133 LRVHYKTVHLREMHKCKIPGCNMMF 1157          
BLAST of C2H2-type domain-containing protein vs. Ensembl Xenopus
Match: BNC1 (basonuclin 1 [Source:NCBI gene;Acc:100492394])

HSP 1 Score: 47.7506 bits (112), Expect = 9.970e-6
Identity = 19/25 (76.00%), Postives = 22/25 (88.00%), Query Frame = 1
Query:  223 LKIHYSAVHLREMHRCTIKGCNMWF 297
            LKIHY+AVHL+  HRCTI+GCNM F
Sbjct:  345 LKIHYNAVHLKIKHRCTIEGCNMVF 369          
BLAST of C2H2-type domain-containing protein vs. Ensembl Mouse
Match: Bnc2 (basonuclin 2 [Source:MGI Symbol;Acc:MGI:2443805])

HSP 1 Score: 47.3654 bits (111), Expect = 5.002e-6
Identity = 16/25 (64.00%), Postives = 20/25 (80.00%), Query Frame = 1
Query:  223 LKIHYSAVHLREMHRCTIKGCNMWF 297
            L++HY  VHLREMH+C + GCNM F
Sbjct:  190 LRVHYKTVHLREMHKCKVPGCNMMF 214          
BLAST of C2H2-type domain-containing protein vs. Ensembl Mouse
Match: Bnc2 (basonuclin 2 [Source:MGI Symbol;Acc:MGI:2443805])

HSP 1 Score: 47.7506 bits (112), Expect = 8.348e-6
Identity = 16/25 (64.00%), Postives = 20/25 (80.00%), Query Frame = 1
Query:  223 LKIHYSAVHLREMHRCTIKGCNMWF 297
            L++HY  VHLREMH+C + GCNM F
Sbjct: 1050 LRVHYKTVHLREMHKCKVPGCNMMF 1074          

HSP 2 Score: 47.7506 bits (112), Expect = 9.913e-6
Identity = 19/25 (76.00%), Postives = 22/25 (88.00%), Query Frame = 1
Query:  223 LKIHYSAVHLREMHRCTIKGCNMWF 297
            LKIHY+AVHL+  HRCTI+GCNM F
Sbjct:  456 LKIHYNAVHLKIKHRCTIEGCNMVF 480          
BLAST of C2H2-type domain-containing protein vs. Ensembl Mouse
Match: Bnc2 (basonuclin 2 [Source:MGI Symbol;Acc:MGI:2443805])

HSP 1 Score: 47.7506 bits (112), Expect = 8.497e-6
Identity = 16/25 (64.00%), Postives = 20/25 (80.00%), Query Frame = 1
Query:  223 LKIHYSAVHLREMHRCTIKGCNMWF 297
            L++HY  VHLREMH+C + GCNM F
Sbjct:  983 LRVHYKTVHLREMHKCKVPGCNMMF 1007          

HSP 2 Score: 47.7506 bits (112), Expect = 9.731e-6
Identity = 19/25 (76.00%), Postives = 22/25 (88.00%), Query Frame = 1
Query:  223 LKIHYSAVHLREMHRCTIKGCNMWF 297
            LKIHY+AVHL+  HRCTI+GCNM F
Sbjct:  389 LKIHYNAVHLKIKHRCTIEGCNMVF 413          
BLAST of C2H2-type domain-containing protein vs. Ensembl Mouse
Match: Bnc2 (basonuclin 2 [Source:MGI Symbol;Acc:MGI:2443805])

HSP 1 Score: 47.7506 bits (112), Expect = 8.609e-6
Identity = 16/25 (64.00%), Postives = 20/25 (80.00%), Query Frame = 1
Query:  223 LKIHYSAVHLREMHRCTIKGCNMWF 297
            L++HY  VHLREMH+C + GCNM F
Sbjct: 1078 LRVHYKTVHLREMHKCKVPGCNMMF 1102          

HSP 2 Score: 47.7506 bits (112), Expect = 9.770e-6
Identity = 19/25 (76.00%), Postives = 22/25 (88.00%), Query Frame = 1
Query:  223 LKIHYSAVHLREMHRCTIKGCNMWF 297
            LKIHY+AVHL+  HRCTI+GCNM F
Sbjct:  484 LKIHYNAVHLKIKHRCTIEGCNMVF 508          
BLAST of C2H2-type domain-containing protein vs. Ensembl Mouse
Match: Bnc2 (basonuclin 2 [Source:MGI Symbol;Acc:MGI:2443805])

HSP 1 Score: 47.7506 bits (112), Expect = 9.013e-6
Identity = 19/25 (76.00%), Postives = 22/25 (88.00%), Query Frame = 1
Query:  223 LKIHYSAVHLREMHRCTIKGCNMWF 297
            LKIHY+AVHL+  HRCTI+GCNM F
Sbjct:  414 LKIHYNAVHLKIKHRCTIEGCNMVF 438          
BLAST of C2H2-type domain-containing protein vs. UniProt/SwissProt
Match: sp|P23792|DISC_DROME (Protein disconnected OS=Drosophila melanogaster OX=7227 GN=disco PE=1 SV=2)

HSP 1 Score: 57.3806 bits (137), Expect = 3.641e-8
Identity = 39/52 (75.00%), Postives = 47/52 (90.38%), Query Frame = 1
Query:  220 ALKIHYSAVHLREMHRCTIKGCNMWFXXXXXXXXXXXXXXXXLHLSHSNKKL 375
            ALKIH+SAVHLREMH+CT++GCNM FSSRRSRNRHS+NPNP+LH  H  +K+
Sbjct:  106 ALKIHFSAVHLREMHKCTVEGCNMVFSSRRSRNRHSANPNPKLHSPHIRRKI 157          
BLAST of C2H2-type domain-containing protein vs. TrEMBL
Match: A0A564YVM7 (C2H2-type domain-containing protein (Fragment) OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS9513 PE=4 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 6.284e-21
Identity = 57/70 (81.43%), Postives = 66/70 (94.29%), Query Frame = 1
Query:  220 ALKIHYSAVHLREMHRCTIKGCNMWFXXXXXXXXXXXXXXXXLHLSHSNKKLPDNSVVVDDGTGRSIGKR 429
            ALKIHYSAVHLREMH+CTIKGCNMWFSSRRSRNRHS+NPNPRLH++HS KKLPDN+ +VDDG+G S+ +R
Sbjct:   94 ALKIHYSAVHLREMHKCTIKGCNMWFSSRRSRNRHSANPNPRLHMTHSGKKLPDNATIVDDGSGLSVFQR 163          
BLAST of C2H2-type domain-containing protein vs. TrEMBL
Match: A0A3P7L5P8 (C2H2-type domain-containing protein (Fragment) OS=Dibothriocephalus latus OX=60516 GN=DILT_LOCUS8586 PE=4 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 1.795e-20
Identity = 56/70 (80.00%), Postives = 66/70 (94.29%), Query Frame = 1
Query:  220 ALKIHYSAVHLREMHRCTIKGCNMWFXXXXXXXXXXXXXXXXLHLSHSNKKLPDNSVVVDDGTGRSIGKR 429
            ALKIHYSAVHLREMH+CTIKGCNMWFSSRRSRNRHS+NPNPRLH++H+ KKLPDN+ +VDDG+G +I +R
Sbjct:  103 ALKIHYSAVHLREMHKCTIKGCNMWFSSRRSRNRHSANPNPRLHMAHAGKKLPDNATIVDDGSGYTIVRR 172          
BLAST of C2H2-type domain-containing protein vs. TrEMBL
Match: A0A419Q0K2 (Zinc finger protein basonuclin-2 OS=Clonorchis sinensis OX=79923 GN=BNC2 PE=4 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 9.231e-20
Identity = 55/70 (78.57%), Postives = 68/70 (97.14%), Query Frame = 1
Query:  220 ALKIHYSAVHLREMHRCTIKGCNMWFXXXXXXXXXXXXXXXXLHLSHSNKKLPDNSVVVDDGTGRSIGKR 429
            ALKIHYSAVHL+EMH+CTIKGC+MWFSSRRSRNRHS+NPNPRLH++H++KKLPDN+ +VDDG+G+ IG+R
Sbjct:  721 ALKIHYSAVHLKEMHKCTIKGCSMWFSSRRSRNRHSANPNPRLHMTHASKKLPDNATIVDDGSGKVIGRR 790          
BLAST of C2H2-type domain-containing protein vs. TrEMBL
Match: H2KUU9 (Zinc finger protein basonuclin-2 OS=Clonorchis sinensis OX=79923 GN=CLF_110439 PE=4 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 9.664e-20
Identity = 55/70 (78.57%), Postives = 68/70 (97.14%), Query Frame = 1
Query:  220 ALKIHYSAVHLREMHRCTIKGCNMWFXXXXXXXXXXXXXXXXLHLSHSNKKLPDNSVVVDDGTGRSIGKR 429
            ALKIHYSAVHL+EMH+CTIKGC+MWFSSRRSRNRHS+NPNPRLH++H++KKLPDN+ +VDDG+G+ IG+R
Sbjct:  554 ALKIHYSAVHLKEMHKCTIKGCSMWFSSRRSRNRHSANPNPRLHMTHASKKLPDNATIVDDGSGKVIGRR 623          
BLAST of C2H2-type domain-containing protein vs. TrEMBL
Match: A0A074Z2Y5 (C2H2-type domain-containing protein (Fragment) OS=Opisthorchis viverrini OX=6198 GN=T265_15112 PE=4 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 1.178e-19
Identity = 55/70 (78.57%), Postives = 68/70 (97.14%), Query Frame = 1
Query:  220 ALKIHYSAVHLREMHRCTIKGCNMWFXXXXXXXXXXXXXXXXLHLSHSNKKLPDNSVVVDDGTGRSIGKR 429
            ALKIHYSAVHL+EMH+CTIKGC+MWFSSRRSRNRHS+NPNPRLH++H++KKLPDN+ +VDDG+G+ IG+R
Sbjct:  650 ALKIHYSAVHLKEMHKCTIKGCSMWFSSRRSRNRHSANPNPRLHMTHASKKLPDNATIVDDGSGKVIGRR 719          
BLAST of C2H2-type domain-containing protein vs. Ensembl Cavefish
Match: bnc2 (basonuclin 2 [Source:ZFIN;Acc:ZDB-GENE-030131-5784])

HSP 1 Score: 48.1358 bits (113), Expect = 5.696e-6
Identity = 16/25 (64.00%), Postives = 20/25 (80.00%), Query Frame = 1
Query:  223 LKIHYSAVHLREMHRCTIKGCNMWF 297
            L++HY  VHLREMH+C + GCNM F
Sbjct: 1081 LRVHYKTVHLREMHKCKVPGCNMMF 1105          

HSP 2 Score: 47.7506 bits (112), Expect = 6.764e-6
Identity = 19/25 (76.00%), Postives = 22/25 (88.00%), Query Frame = 1
Query:  223 LKIHYSAVHLREMHRCTIKGCNMWF 297
            LKIHY+AVHL+  HRCTI+GCNM F
Sbjct:  365 LKIHYNAVHLKIKHRCTIEGCNMVF 389          
BLAST of C2H2-type domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002491.1 (pep scaffold:Pmarinus_7.0:GL476354:228525:277874:1 gene:ENSPMAG00000002267.1 transcript:ENSPMAT00000002491.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 46.2098 bits (108), Expect = 3.737e-6
Identity = 18/25 (72.00%), Postives = 22/25 (88.00%), Query Frame = 1
Query:  223 LKIHYSAVHLREMHRCTIKGCNMWF 297
            LKIHY+AVHL+  H+CTI+GCNM F
Sbjct:  354 LKIHYNAVHLKIKHKCTIEGCNMVF 378          
BLAST of C2H2-type domain-containing protein vs. Ensembl Medaka
Match: bnc2 (zinc finger protein basonuclin-2 [Source:NCBI gene;Acc:101155255])

HSP 1 Score: 47.3654 bits (111), Expect = 7.961e-6
Identity = 19/25 (76.00%), Postives = 22/25 (88.00%), Query Frame = 1
Query:  223 LKIHYSAVHLREMHRCTIKGCNMWF 297
            LKIHY+AVHL+  HRCTI+GCNM F
Sbjct:  398 LKIHYNAVHLKIKHRCTIEGCNMVF 422          
BLAST of C2H2-type domain-containing protein vs. Ensembl Medaka
Match: bnc2 (zinc finger protein basonuclin-2 [Source:NCBI gene;Acc:101155255])

HSP 1 Score: 47.3654 bits (111), Expect = 8.611e-6
Identity = 19/25 (76.00%), Postives = 22/25 (88.00%), Query Frame = 1
Query:  223 LKIHYSAVHLREMHRCTIKGCNMWF 297
            LKIHY+AVHL+  HRCTI+GCNM F
Sbjct:  372 LKIHYNAVHLKIKHRCTIEGCNMVF 396          
BLAST of C2H2-type domain-containing protein vs. Planmine SMEST
Match: SMESG000064731.1 (SMESG000064731.1)

HSP 1 Score: 276.174 bits (705), Expect = 2.291e-90
Identity = 167/167 (100.00%), Postives = 167/167 (100.00%), Query Frame = 1
Query:  220 ALKIHYSAVHLREMHRCTIKGCNMWFXXXXXXXXXXXXXXXXLHLSHSNKKLPDNSVVVDDGTGRSIGKRXXXXXXXXXXXXXTTSNSLSTHDYDNYTYNDEANVRVDKTFNFQLFPKSRNRENEFTDKEYKNNIENIPNKSQTITENRDNNIKEPPKLFTINSVID 720
            ALKIHYSAVHLREMHRCTIKGCNMWFSSRRSRNRHSSNPNPRLHLSHSNKKLPDNSVVVDDGTGRSIGKRLPIPNSILNPPIITTSNSLSTHDYDNYTYNDEANVRVDKTFNFQLFPKSRNRENEFTDKEYKNNIENIPNKSQTITENRDNNIKEPPKLFTINSVID
Sbjct:  332 ALKIHYSAVHLREMHRCTIKGCNMWFSSRRSRNRHSSNPNPRLHLSHSNKKLPDNSVVVDDGTGRSIGKRLPIPNSILNPPIITTSNSLSTHDYDNYTYNDEANVRVDKTFNFQLFPKSRNRENEFTDKEYKNNIENIPNKSQTITENRDNNIKEPPKLFTINSVID 498          
BLAST of C2H2-type domain-containing protein vs. Planmine SMEST
Match: SMESG000064731.1 (SMESG000064731.1)

HSP 1 Score: 276.174 bits (705), Expect = 2.512e-90
Identity = 167/167 (100.00%), Postives = 167/167 (100.00%), Query Frame = 1
Query:  220 ALKIHYSAVHLREMHRCTIKGCNMWFXXXXXXXXXXXXXXXXLHLSHSNKKLPDNSVVVDDGTGRSIGKRXXXXXXXXXXXXXTTSNSLSTHDYDNYTYNDEANVRVDKTFNFQLFPKSRNRENEFTDKEYKNNIENIPNKSQTITENRDNNIKEPPKLFTINSVID 720
            ALKIHYSAVHLREMHRCTIKGCNMWFSSRRSRNRHSSNPNPRLHLSHSNKKLPDNSVVVDDGTGRSIGKRLPIPNSILNPPIITTSNSLSTHDYDNYTYNDEANVRVDKTFNFQLFPKSRNRENEFTDKEYKNNIENIPNKSQTITENRDNNIKEPPKLFTINSVID
Sbjct:  335 ALKIHYSAVHLREMHRCTIKGCNMWFSSRRSRNRHSSNPNPRLHLSHSNKKLPDNSVVVDDGTGRSIGKRLPIPNSILNPPIITTSNSLSTHDYDNYTYNDEANVRVDKTFNFQLFPKSRNRENEFTDKEYKNNIENIPNKSQTITENRDNNIKEPPKLFTINSVID 501          
The following BLAST results are available for this feature:
BLAST of C2H2-type domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
BNC28.980e-676.00basonuclin 2 [Source:HGNC Symbol;Acc:HGNC:30988][more]
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
bnc-15.850e-673.08BasoNuClin-1 zinc finger protein homolog [Source:... [more]
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
disco3.633e-975.00gene:FBgn0000459 transcript:FBtr0074250[more]
disco3.633e-975.00gene:FBgn0000459 transcript:FBtr0100384[more]
disco-r7.679e-873.08gene:FBgn0285879 transcript:FBtr0310302[more]
disco-r7.679e-873.08gene:FBgn0285879 transcript:FBtr0074251[more]
disco-r7.679e-873.08gene:FBgn0285879 transcript:FBtr0310303[more]
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
bnc24.858e-668.00basonuclin 2 [Source:ZFIN;Acc:ZDB-GENE-030131-5784... [more]
bnc25.102e-668.00basonuclin 2 [Source:ZFIN;Acc:ZDB-GENE-030131-5784... [more]
bnc25.102e-668.00basonuclin 2 [Source:ZFIN;Acc:ZDB-GENE-030131-5784... [more]
bnc25.417e-668.00basonuclin 2 [Source:ZFIN;Acc:ZDB-GENE-030131-5784... [more]
bnc25.542e-668.00basonuclin 2 [Source:ZFIN;Acc:ZDB-GENE-030131-5784... [more]
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
BNC19.970e-676.00basonuclin 1 [Source:NCBI gene;Acc:100492394][more]
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Bnc25.002e-664.00basonuclin 2 [Source:MGI Symbol;Acc:MGI:2443805][more]
Bnc28.348e-664.00basonuclin 2 [Source:MGI Symbol;Acc:MGI:2443805][more]
Bnc28.497e-664.00basonuclin 2 [Source:MGI Symbol;Acc:MGI:2443805][more]
Bnc28.609e-664.00basonuclin 2 [Source:MGI Symbol;Acc:MGI:2443805][more]
Bnc29.013e-676.00basonuclin 2 [Source:MGI Symbol;Acc:MGI:2443805][more]
back to top
BLAST of C2H2-type domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|P23792|DISC_DROME3.641e-875.00Protein disconnected OS=Drosophila melanogaster OX... [more]
back to top
BLAST of C2H2-type domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A564YVM76.284e-2181.43C2H2-type domain-containing protein (Fragment) OS=... [more]
A0A3P7L5P81.795e-2080.00C2H2-type domain-containing protein (Fragment) OS=... [more]
A0A419Q0K29.231e-2078.57Zinc finger protein basonuclin-2 OS=Clonorchis sin... [more]
H2KUU99.664e-2078.57Zinc finger protein basonuclin-2 OS=Clonorchis sin... [more]
A0A074Z2Y51.178e-1978.57C2H2-type domain-containing protein (Fragment) OS=... [more]
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
bnc25.696e-664.00basonuclin 2 [Source:ZFIN;Acc:ZDB-GENE-030131-5784... [more]
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000002491.13.737e-672.00pep scaffold:Pmarinus_7.0:GL476354:228525:277874:1... [more]
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
bnc27.961e-676.00zinc finger protein basonuclin-2 [Source:NCBI gene... [more]
bnc28.611e-676.00zinc finger protein basonuclin-2 [Source:NCBI gene... [more]
back to top
BLAST of C2H2-type domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000064731.12.291e-90100.00SMESG000064731.1[more]
SMESG000064731.12.512e-90100.00SMESG000064731.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012110 ID=SMED30012110|Name=C2H2-type domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=766bp
TTTCCGCAACAGCAATTATGTCTGATCAGTGGAGTGCTTACAACGAAAGA
ACTGCTGCCGCTGGAATGAGTTACAGTTACGAAACAGTGAATAACAGCCT
ACGTTTCATCGATCATAATATCCTCATATGATAGACTCTTATTTTCGTGA
GTACGTGTGGATAAATCATGTGAAAATGAGACACGATGATCCCTTCGACA
CCATCATGGAAGACATTGAGCCCTAAAAATCCACTATAGTGCCGTACACC
TAAGAGAGATGCACAGATGCACCATAAAAGGATGTAATATGTGGTTTAGT
TCTCGGCGTAGCAGAAACCGTCACAGCTCGAATCCGAATCCGAGATTACA
TTTGAGTCACTCGAACAAGAAACTACCTGACAATTCAGTTGTCGTTGATG
ATGGAACTGGTCGCTCAATCGGTAAACGACTTCCTATTCCAAATTCTATT
CTAAACCCTCCAATTATAACCACATCAAATTCTCTTTCAACCCACGATTA
CGACAATTACACATACAATGATGAGGCTAACGTACGAGTTGATAAAACTT
TCAATTTTCAACTTTTTCCCAAATCTAGAAATCGGGAAAATGAATTTACA
GATAAAGAATACAAGAATAATATAGAAAATATTCCAAATAAATCTCAGAC
AATTACAGAAAATCGTGATAACAACATCAAGGAACCGCCAAAATTGTTCA
CCATAAATTCTGTCATTGACTAAACATGATTTATTCTATCTTGTAATAAA
TTGCTAAAATTCCTCG
back to top

protein sequence of SMED30012110-orf-1

>SMED30012110-orf-1 ID=SMED30012110-orf-1|Name=SMED30012110-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=155bp
MHRCTIKGCNMWFSSRRSRNRHSSNPNPRLHLSHSNKKLPDNSVVVDDGT
GRSIGKRLPIPNSILNPPIITTSNSLSTHDYDNYTYNDEANVRVDKTFNF
QLFPKSRNRENEFTDKEYKNNIENIPNKSQTITENRDNNIKEPPKLFTIN
SVID*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0046872metal ion binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0000240body wall musculature