Vesicle transport protein

Overview
NameVesicle transport protein
Smed IDSMED30012109
Length (bp)747
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Vesicle transport protein (SMED30012109) t-SNE clustered cells

Violin plots show distribution of expression levels for Vesicle transport protein (SMED30012109) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Vesicle transport protein (SMED30012109) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Vesicle transport protein (SMED30012109) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012109

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30012109 Contig3158GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
parenchymal cellSMED30012109 dd_Smed_v4_2281_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Vesicle transport protein vs. Ensembl Human
Match: SFT2D1 (SFT2 domain containing 1 [Source:HGNC Symbol;Acc:HGNC:21102])

HSP 1 Score: 161.77 bits (408), Expect = 1.027e-49
Identity = 81/160 (50.62%), Postives = 111/160 (69.38%), Query Frame = 2
Query:   83 MDKFKNIFSTKEESNDSDDVGLISGLNDQLTLGCGTRVRMFAICLVIGVVFSILGSALIWLPKGMLLFAVFYTLGNIFSLASTCFLMGPFKQIQKMFEKNRWIITIFVFLFMGLTIVSAVVWKKIVLCILFALLQFLALTWYSLSFIPFAHDIIIKTVTS 562
            M+K + + S      D ++ GL + + D  +L   TR++ FAIC V GV FSILG+ L+WLP G+ LFAVFYTLGN+ +LASTCFLMGP KQ++KMFE  R + TI + L    T+ +A+ W K  L +LF +LQFL++TWYSLS+IP+A D +IK  +S
Sbjct:    1 MEKLRRVLS----GQDDEEQGLTAQVLDASSLSFNTRLKWFAICFVCGVFFSILGTGLLWLPGGIKLFAVFYTLGNLAALASTCFLMGPVKQLKKMFEATRLLATIVMLLCFIFTLCAALWWHKKGLAVLFCILQFLSMTWYSLSYIPYARDAVIKCCSS 156          
BLAST of Vesicle transport protein vs. Ensembl Human
Match: SFT2D2 (SFT2 domain containing 2 [Source:HGNC Symbol;Acc:HGNC:25140])

HSP 1 Score: 144.436 bits (363), Expect = 6.709e-43
Identity = 78/162 (48.15%), Postives = 103/162 (63.58%), Query Frame = 2
Query:   83 MDKFKNIFSTKEESNDSDDVGLISGLNDQLTLGCGTRVRMFAICLVIGVVFSILGSALIWLP-KGMLLFAVFYTLGNIFSLASTCFLMGPFKQIQKMFEKNRWIITIFVFLFMGLTIVSAVVWKKIVLCILFALLQFLALTWYSLSFIPFAHDIIIKTVTSC 565
            MDK K + S      D++D   +S + +  +L   TR++ F  C  IG++ S+LG+ L+W+P KG+ LFAVFYT GNI S+ ST FLMGP KQ+++MFE  R I TI V L   LT+ SA  W    L ++F +LQ LALTWYSLSFIPFA D + K    C
Sbjct:    1 MDKLKKVLS----GQDTEDRSGLSEVVEASSLSWSTRIKGFIACFAIGILCSLLGTVLLWVPRKGLHLFAVFYTFGNIASIGSTIFLMGPVKQLKRMFEPTRLIATIMVLLCFALTLCSAFWWHNKGLALIFCILQSLALTWYSLSFIPFARDAVKKCFAVC 158          
BLAST of Vesicle transport protein vs. Ensembl Human
Match: SFT2D2 (SFT2 domain containing 2 [Source:HGNC Symbol;Acc:HGNC:25140])

HSP 1 Score: 65.855 bits (159), Expect = 2.498e-13
Identity = 38/90 (42.22%), Postives = 56/90 (62.22%), Query Frame = 2
Query:   83 MDKFKNIFSTKEESNDSDDVGLISGLNDQLTLGCGTRVRMFAICLVIGVVFSILGSALIWLP-KGMLLFAVFYTLGNIFSLASTCFLMGP 349
            MDK K + S +    D++D   +S + +  +L   TR++ F  C  IG++ S+LG+ L+W+P KG+ LFAVFYT GNI S+ S C L  P
Sbjct:    1 MDKLKKVLSGQ----DTEDRSGLSEVVEASSLSWSTRIKGFIACFAIGILCSLLGTVLLWVPRKGLHLFAVFYTFGNIASIGS-CVLHLP 85          
BLAST of Vesicle transport protein vs. Ensembl Human
Match: SFT2D2 (SFT2 domain containing 2 [Source:HGNC Symbol;Acc:HGNC:25140])

HSP 1 Score: 65.855 bits (159), Expect = 2.498e-13
Identity = 38/90 (42.22%), Postives = 56/90 (62.22%), Query Frame = 2
Query:   83 MDKFKNIFSTKEESNDSDDVGLISGLNDQLTLGCGTRVRMFAICLVIGVVFSILGSALIWLP-KGMLLFAVFYTLGNIFSLASTCFLMGP 349
            MDK K + S +    D++D   +S + +  +L   TR++ F  C  IG++ S+LG+ L+W+P KG+ LFAVFYT GNI S+ S C L  P
Sbjct:    1 MDKLKKVLSGQ----DTEDRSGLSEVVEASSLSWSTRIKGFIACFAIGILCSLLGTVLLWVPRKGLHLFAVFYTFGNIASIGS-CVLHLP 85          
BLAST of Vesicle transport protein vs. Ensembl Celegans
Match: F27D4.7 (Vesicle transport protein [Source:UniProtKB/TrEMBL;Acc:Q7YTP0])

HSP 1 Score: 83.5741 bits (205), Expect = 9.168e-20
Identity = 55/152 (36.18%), Postives = 87/152 (57.24%), Query Frame = 2
Query:  107 STKEESNDSDDVGLISGLNDQLTLGCGT----RVRMFAICLVIGVVFSILGSALIWLPKGMLLFAVFYTLGNIFSLASTCFLMGPFKQIQKMFEKNRWIITIFVFLFMGLTIVSAVVWKKIVLCILFALLQFLALTWYSLSFIPFAHDIIIK 550
            S  E  N+ +   +      Q T+  G     RV+ F    ++ ++ S  GS L+ L K +  F +  ++  I SL+STC LMGP  QI+KMF+K+RWI +    LF+ LT++S +V K  +L I+    Q++A+ WYSLS+IP+A + + K
Sbjct:    9 SDPENPNNLNGPSISQESPSQPTVTTGMSWELRVQSFVGLFILSIIASFCGSYLLLLTK-ITGFCIMTSISAILSLSSTCCLMGPIGQIKKMFDKSRWIASSMYILFIFLTLLSGLVLKNSLLAIICTAGQYIAMAWYSLSYIPYAREAVSK 159          
BLAST of Vesicle transport protein vs. Ensembl Fly
Match: CG5104 (gene:FBgn0037009 transcript:FBtr0078209)

HSP 1 Score: 153.68 bits (387), Expect = 7.894e-47
Identity = 78/160 (48.75%), Postives = 117/160 (73.12%), Query Frame = 2
Query:   83 MDKFKNIFSTKEESNDSDDVGLISGLNDQLTLGCGTRVRMFAICLVIGVVFSILGSALIWLPKGMLLFAVFYTLGNIFSLASTCFLMGPFKQIQKMFEKNRWIITIFVFLFMGLTIVSAVVWKKIVLCILFALLQFLALTWYSLSFIPFAHDIIIKTVTS 562
            MDK + + S  +E    ++  +I+ +ND  TL   TR++ F IC  +G++ S+LGS  ++L +G+++FAVFYTLGN+ S+ASTCFLMGPFKQI+KMF + R I TI V + M LT ++A+VWKK  L ++F ++Q LA+TWYSLS+IP+A D + KT+++
Sbjct:    1 MDKLRRVLS-GDEPTPEEESSIITQINDMSTLSWSTRIKGFVICFALGILLSLLGSVALFLHRGIVVFAVFYTLGNVISMASTCFLMGPFKQIKKMFAETRLIATIIVLVMMVLTFIAAIVWKKAGLTLIFIIIQSLAMTWYSLSYIPYARDAVKKTMSA 159          
BLAST of Vesicle transport protein vs. Ensembl Fly
Match: CG33635 (gene:FBgn0053635 transcript:FBtr0091612)

HSP 1 Score: 46.9802 bits (110), Expect = 3.656e-6
Identity = 37/115 (32.17%), Postives = 62/115 (53.91%), Query Frame = 2
Query:  191 RVRMFAICLVIGVVFSILGSALIWLPKGMLL---FAVFYTLGNIFSLASTCFLMGPFKQIQKMFEKNRWIITIFVFLFMGLTIVSAVVWKKIVLCILFALLQFLALTWYSLSFIP 526
            R+  F  CL +G +   L +   ++P  +L    FA+ YTLG++F + S CFL G    +++MF K R + ++     + LT+  A+V K     +LFA+ Q +AL +  L  +P
Sbjct:   61 RIVGFVACLGMGALCMTLST--FYIPFLILKARKFALLYTLGSLFFILSFCFLSGFGSFLKQMFSKPRLLTSLSYSSCLILTLYCALVAKSTAFTVLFAVAQIIALLFMVLGTVP 173          
BLAST of Vesicle transport protein vs. Ensembl Zebrafish
Match: sft2d1 (SFT2 domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1350])

HSP 1 Score: 152.91 bits (385), Expect = 2.016e-46
Identity = 85/162 (52.47%), Postives = 117/162 (72.22%), Query Frame = 2
Query:   83 MDKFKNIFSTKEESNDSDDVGLISGLNDQLTLGCGTRVRMFAICLVIGVVFSILGSALIWLPK-GMLLFAVFYTLGNIFSLASTCFLMGPFKQIQKMFEKNRWIITIFVFLFMGLTIVSAVVWKKIVLCILFALLQFLALTWYSLSFIPFAHDIIIKTVTSC 565
            MDK + + S +EE+   +++GL + + D  TL   TR++ F IC   G++ SILG+AL++LPK G+ LFAVFYTLGNI +L+STCFLMGP KQ+++MFE  R I TI V LF+ LT+ +   W K  L I+F +LQFLA+TWYS+S+IPFA D +IK  T+C
Sbjct:    1 MDKLRRVLSGREEN---EEMGLTAQVLDGSTLSFSTRLKWFIICFAGGILCSILGTALLFLPKAGIKLFAVFYTLGNIAALSSTCFLMGPVKQLKRMFEPTRLIATILVLLFLVLTLCAVFWWNKKGLAIIFCILQFLAMTWYSISYIPFARDAVIKCCTTC 159          
BLAST of Vesicle transport protein vs. Ensembl Zebrafish
Match: sft2d2b (SFT2 domain containing 2b [Source:ZFIN;Acc:ZDB-GENE-050522-336])

HSP 1 Score: 152.91 bits (385), Expect = 2.296e-46
Identity = 81/162 (50.00%), Postives = 110/162 (67.90%), Query Frame = 2
Query:   83 MDKFKNIFSTKEESNDSDDVGLISGLNDQLTLGCGTRVRMFAICLVIGVVFSILGSALIWLP-KGMLLFAVFYTLGNIFSLASTCFLMGPFKQIQKMFEKNRWIITIFVFLFMGLTIVSAVVWKKIVLCILFALLQFLALTWYSLSFIPFAHDIIIKTVTSC 565
            MDK K + S ++    +DD+ ++   N+  TLG GTRV+ F  C V GV+ SILG+ L+W+P KG+ LFAVFY+LGNI SL ST FLMGP KQ+++M +K R + T  +   + LT  +A  WK   L +LF +LQFLA TWYS+S+IPFA D IIK  ++C
Sbjct:    1 MDKLKKVLSGQD---GNDDLNVLQSANEASTLGWGTRVKGFLACFVSGVLCSILGTCLLWVPGKGLTLFAVFYSLGNIASLLSTMFLMGPLKQLKRMCDKTRALATGIMITCLVLTFCAAFWWKNRALALLFCILQFLAFTWYSISYIPFARDAIIKLFSAC 159          
BLAST of Vesicle transport protein vs. Ensembl Zebrafish
Match: sft2d2a (SFT2 domain containing 2a [Source:ZFIN;Acc:ZDB-GENE-050227-13])

HSP 1 Score: 144.821 bits (364), Expect = 3.427e-43
Identity = 75/157 (47.77%), Postives = 106/157 (67.52%), Query Frame = 2
Query:   83 MDKFKNIFSTKEESNDSDDVGLISGLNDQLTLGCGTRVRMFAICLVIGVVFSILGSALIWLPK-GMLLFAVFYTLGNIFSLASTCFLMGPFKQIQKMFEKNRWIITIFVFLFMGLTIVSAVVWKKIVLCILFALLQFLALTWYSLSFIPFAHDIIIK 550
            MDK + +   ++ +ND+ ++  +   N+  TLG GTRV+ F  CLV+GVVFSILG   +++PK G+LLF VFYTLGN+ SLAST FLMGP KQ+++M +K R   T+ +   + LT+ +   WK   L +LF +LQ LA  WY LS+IPFA D ++K
Sbjct:    1 MDKLRAVLGGRDGNNDNRNI--LQAANEASTLGWGTRVKGFVGCLVVGVVFSILGVGCLFIPKIGILLFVVFYTLGNVCSLASTMFLMGPVKQLKRMCDKTRAFATVVMITCLVLTLCAVFWWKIFALTLLFVILQVLAFAWYGLSYIPFARDAVLK 155          
BLAST of Vesicle transport protein vs. Ensembl Zebrafish
Match: sft2d2a (SFT2 domain containing 2a [Source:ZFIN;Acc:ZDB-GENE-050227-13])

HSP 1 Score: 141.354 bits (355), Expect = 7.692e-42
Identity = 75/156 (48.08%), Postives = 105/156 (67.31%), Query Frame = 2
Query:   83 MDKFKNIFSTKEESNDSDDVGLISGLNDQLTLGCGTRVRMFAICLVIGVVFSILGSALIWLPK-GMLLFAVFYTLGNIFSLASTCFLMGPFKQIQKMFEKNRWIITIFVFLFMGLTIVSAVVWKKIVLCILFALLQFLALTWYSLSFIPFAHDIII 547
            MDK + +   ++ +ND+ ++  +   N+  TLG GTRV+ F  CLV+GVVFSILG   +++PK G+LLF VFYTLGN+ SLAST FLMGP KQ+++M +K R   T+ +   + LT+ +   WK   L +LF +LQ LA  WY LS+IPFA  +II
Sbjct:    1 MDKLRAVLGGRDGNNDNRNI--LQAANEASTLGWGTRVKGFVGCLVVGVVFSILGVGCLFIPKIGILLFVVFYTLGNVCSLASTMFLMGPVKQLKRMCDKTRAFATVVMITCLVLTLCAVFWWKIFALTLLFVILQVLAFAWYGLSYIPFARLVII 154          
BLAST of Vesicle transport protein vs. Ensembl Zebrafish
Match: sft2d2b (SFT2 domain containing 2b [Source:ZFIN;Acc:ZDB-GENE-050522-336])

HSP 1 Score: 82.4185 bits (202), Expect = 1.713e-19
Identity = 58/162 (35.80%), Postives = 85/162 (52.47%), Query Frame = 2
Query:   83 MDKFKNIFSTKEESNDSDDVGLISGLNDQLTLGCGTRVRMFAICLVIGVVFSILGSALIWLPKGMLLFAVFYTLGNIFSLASTCFLMGPFKQIQKMFEKNRWIITIFVFLFMGLTIVSAVVWKKIVLCILFALLQFLALTWYSLSFIPFAHDIIIKTVTSCF 568
            MDK K + S ++    +DD+ ++   N+  TLG GTRV+ F  C V GV+ SIL    + +P       +F   G++     T FLMGP KQ+++M +K R + T  +   + LT  +A  WK   L +LF +LQFLA TW          D IIK  ++C 
Sbjct:    1 MDKLKKVLSGQD---GNDDLNVLQSANEASTLGWGTRVKGFLACFVSGVLCSIL----VRIPH-----TLFCLSGDL-----TMFLMGPLKQLKRMCDKTRALATGIMITCLVLTFCAAFWWKNRALALLFCILQFLAFTW----------DAIIKLFSACL 135          
BLAST of Vesicle transport protein vs. Ensembl Xenopus
Match: sft2d1 (SFT2 domain containing 1 [Source:NCBI gene;Acc:448736])

HSP 1 Score: 152.91 bits (385), Expect = 2.941e-46
Identity = 80/162 (49.38%), Postives = 110/162 (67.90%), Query Frame = 2
Query:   83 MDKFKNIFSTKEESNDSDDVGLISGLNDQLTLGCGTRVRMFAICLVIGVVFSILGSALIWLPK-GMLLFAVFYTLGNIFSLASTCFLMGPFKQIQKMFEKNRWIITIFVFLFMGLTIVSAVVWKKIVLCILFALLQFLALTWYSLSFIPFAHDIIIKTVTSC 565
            MDK + + S  E+    ++ GL + + D  +L  GTRV+ FAIC V G+  SILG+A +++P  G  LFAVFYTLGN+ +LASTCFLMGP KQ++KMF   R I T+ + L +  T+ +   W+K  L I+F +LQF+A+TWYSLS+IPFA D +IK  T C
Sbjct:    1 MDKLRRVLSGHED----EEQGLTTQVLDSSSLSFGTRVKWFAICFVCGIACSILGTAFLFIPAAGKKLFAVFYTLGNVAALASTCFLMGPVKQLKKMFAPTRLIATLVMLLCLICTLCAVFWWQKNGLAIIFCILQFIAMTWYSLSYIPFARDAVIKCFTGC 158          
BLAST of Vesicle transport protein vs. Ensembl Xenopus
Match: sft2d2 (SFT2 domain containing 2 [Source:NCBI gene;Acc:549159])

HSP 1 Score: 145.591 bits (366), Expect = 1.953e-43
Identity = 80/164 (48.78%), Postives = 109/164 (66.46%), Query Frame = 2
Query:   83 MDKFKNIFSTK--EESNDSDDVGLISGLNDQLTLGCGTRVRMFAICLVIGVVFSILGSALIWLP-KGMLLFAVFYTLGNIFSLASTCFLMGPFKQIQKMFEKNRWIITIFVFLFMGLTIVSAVVWKKIVLCILFALLQFLALTWYSLSFIPFAHDIIIKTVTSC 565
            MDK K + S +  EE N  ++V       +  +L  GTR++ F  C VIGV  SILG+ L+W+P KG+ LFA+FYT+GN+ SL ST FLMGP KQ++KMFE  R I TI + L + LT+ +A+ WK   L +LF +LQF A+ WYS+SFIPFA D + K  ++C
Sbjct:    1 MDKLKKVLSGQDNEERNGFEEV------IETSSLSWGTRIKGFIACFVIGVACSILGTCLLWVPGKGLALFAIFYTIGNVSSLGSTFFLMGPLKQLKKMFEMTRLIATIVMLLCLILTLCAALWWKIKGLALLFCILQFFAMAWYSISFIPFARDAVKKCFSTC 158          
BLAST of Vesicle transport protein vs. Ensembl Xenopus
Match: sft2d2 (SFT2 domain containing 2 [Source:NCBI gene;Acc:549159])

HSP 1 Score: 137.887 bits (346), Expect = 1.350e-40
Identity = 77/154 (50.00%), Postives = 103/154 (66.88%), Query Frame = 2
Query:   83 MDKFKNIFSTK--EESNDSDDVGLISGLNDQLTLGCGTRVRMFAICLVIGVVFSILGSALIWLP-KGMLLFAVFYTLGNIFSLASTCFLMGPFKQIQKMFEKNRWIITIFVFLFMGLTIVSAVVWKKIVLCILFALLQFLALTWYSLSFIPFAH 535
            MDK K + S +  EE N  ++V       +  +L  GTR++ F  C VIGV  SILG+ L+W+P KG+ LFA+FYT+GN+ SL ST FLMGP KQ++KMFE  R I TI + L + LT+ +A+ WK   L +LF +LQF A+ WYS+SFIPFA 
Sbjct:    1 MDKLKKVLSGQDNEERNGFEEV------IETSSLSWGTRIKGFIACFVIGVACSILGTCLLWVPGKGLALFAIFYTIGNVSSLGSTFFLMGPLKQLKKMFEMTRLIATIVMLLCLILTLCAALWWKIKGLALLFCILQFFAMAWYSISFIPFAR 148          
BLAST of Vesicle transport protein vs. Ensembl Xenopus
Match: sft2d2 (SFT2 domain containing 2 [Source:NCBI gene;Acc:549159])

HSP 1 Score: 134.42 bits (337), Expect = 3.644e-39
Identity = 76/164 (46.34%), Postives = 102/164 (62.20%), Query Frame = 2
Query:   83 MDKFKNIFSTK--EESNDSDDVGLISGLNDQLTLGCGTRVRMFAICLVIGVVFSILGSALIWLP-KGMLLFAVFYTLGNIFSLASTCFLMGPFKQIQKMFEKNRWIITIFVFLFMGLTIVSAVVWKKIVLCILFALLQFLALTWYSLSFIPFAHDIIIKTVTSC 565
            MDK K + S +  EE N  ++V       +  +L  GTR++ F  C VIGV  SILG+ L+W+P KG+ LFA+FYT+GN+ SL ST FLMGP KQ++KMFE  R I TI             ++WK   L +LF +LQF A+ WYS+SFIPFA D + K  ++C
Sbjct:    1 MDKLKKVLSGQDNEERNGFEEV------IETSSLSWGTRIKGFIACFVIGVACSILGTCLLWVPGKGLALFAIFYTIGNVSSLGSTFFLMGPLKQLKKMFEMTRLIATI------------VMLWKIKGLALLFCILQFFAMAWYSISFIPFARDAVKKCFSTC 146          
BLAST of Vesicle transport protein vs. Ensembl Mouse
Match: Sft2d1 (SFT2 domain containing 1 [Source:MGI Symbol;Acc:MGI:1918689])

HSP 1 Score: 160.999 bits (406), Expect = 1.755e-49
Identity = 78/160 (48.75%), Postives = 111/160 (69.38%), Query Frame = 2
Query:   83 MDKFKNIFSTKEESNDSDDVGLISGLNDQLTLGCGTRVRMFAICLVIGVVFSILGSALIWLPKGMLLFAVFYTLGNIFSLASTCFLMGPFKQIQKMFEKNRWIITIFVFLFMGLTIVSAVVWKKIVLCILFALLQFLALTWYSLSFIPFAHDIIIKTVTS 562
            M+K + + S      D ++ GL + + D  +L   TR++ F IC V G+ FS LG+ L+WLP GM LFAVFYTLGN+ +LASTCFLMGP KQ++KMFE  R + TI + L +  T+ +A+ W+K  L +LF +LQFL++TWYSLS+IP+A D ++K  +S
Sbjct:    1 MEKLRRVLS----GQDDEEQGLTAQVLDASSLSFNTRLKWFVICFVAGIFFSFLGTGLLWLPNGMKLFAVFYTLGNLAALASTCFLMGPVKQLKKMFETTRLLATIIMLLCLVFTLCAALWWRKKGLALLFCILQFLSMTWYSLSYIPYARDAVLKCCSS 156          
BLAST of Vesicle transport protein vs. Ensembl Mouse
Match: Gm12166 (predicted gene 12166 [Source:MGI Symbol;Acc:MGI:3650635])

HSP 1 Score: 160.999 bits (406), Expect = 1.755e-49
Identity = 78/160 (48.75%), Postives = 111/160 (69.38%), Query Frame = 2
Query:   83 MDKFKNIFSTKEESNDSDDVGLISGLNDQLTLGCGTRVRMFAICLVIGVVFSILGSALIWLPKGMLLFAVFYTLGNIFSLASTCFLMGPFKQIQKMFEKNRWIITIFVFLFMGLTIVSAVVWKKIVLCILFALLQFLALTWYSLSFIPFAHDIIIKTVTS 562
            M+K + + S      D ++ GL + + D  +L   TR++ F IC V G+ FS LG+ L+WLP GM LFAVFYTLGN+ +LASTCFLMGP KQ++KMFE  R + TI + L +  T+ +A+ W+K  L +LF +LQFL++TWYSLS+IP+A D ++K  +S
Sbjct:    1 MEKLRRVLS----GQDDEEQGLTAQVLDASSLSFNTRLKWFVICFVAGIFFSFLGTGLLWLPNGMKLFAVFYTLGNLAALASTCFLMGPVKQLKKMFETTRLLATIIMLLCLVFTLCAALWWRKKGLALLFCILQFLSMTWYSLSYIPYARDAVLKCCSS 156          
BLAST of Vesicle transport protein vs. Ensembl Mouse
Match: Sft2d2 (SFT2 domain containing 2 [Source:MGI Symbol;Acc:MGI:1917362])

HSP 1 Score: 147.132 bits (370), Expect = 3.668e-44
Identity = 78/163 (47.85%), Postives = 107/163 (65.64%), Query Frame = 2
Query:   83 MDKFKNIFSTKEESNDSDDVGLISGLNDQLTLGCGTRVRMFAICLVIGVVFSILGSALIWLP-KGMLLFAVFYTLGNIFSLASTCFLMGPFKQIQKMFEKNRWIITIFVFLFMGLTIVSAVVWKKIVLCILFALLQFLALTWYSLSFIPFAHDIIIKTVTSCF 568
            MDK K + S      D++D   +S + +  +L  GTR++ F  C  +G++ S+LG+ L+W+P KG+ LFAVFYTLGNI S+ ST FLMGP KQ+++MFE  R I TI V L   LT+ SA +W K  L ++F +LQ LALTWYSLS+IP+A D + K    C 
Sbjct:    1 MDKLKKVLS----GQDTEDRSGLSEVVEASSLSWGTRIKGFIACFALGILCSVLGTLLLWVPRKGLGLFAVFYTLGNIMSIGSTVFLMGPLKQLKRMFEPTRLIATILVLLCFALTLCSAFLWNK-GLALIFCILQSLALTWYSLSYIPYARDAVKKCFAVCL 158          
BLAST of Vesicle transport protein vs. Ensembl Mouse
Match: Sft2d2 (SFT2 domain containing 2 [Source:MGI Symbol;Acc:MGI:1917362])

HSP 1 Score: 66.2402 bits (160), Expect = 1.329e-13
Identity = 35/82 (42.68%), Postives = 54/82 (65.85%), Query Frame = 2
Query:   83 MDKFKNIFSTKEESNDSDDVGLISGLNDQLTLGCGTRVRMFAICLVIGVVFSILGSALIWLP-KGMLLFAVFYTLGNIFSLA 325
            MDK K + S +    D++D   +S + +  +L  GTR++ F  C  +G++ S+LG+ L+W+P KG+ LFAVFYTLGNI S+ 
Sbjct:    1 MDKLKKVLSGQ----DTEDRSGLSEVVEASSLSWGTRIKGFIACFALGILCSVLGTLLLWVPRKGLGLFAVFYTLGNIMSIG 78          
BLAST of Vesicle transport protein vs. UniProt/SwissProt
Match: sp|Q8WV19|SFT2A_HUMAN (Vesicle transport protein SFT2A OS=Homo sapiens OX=9606 GN=SFT2D1 PE=1 SV=1)

HSP 1 Score: 161.77 bits (408), Expect = 4.934e-49
Identity = 81/160 (50.62%), Postives = 111/160 (69.38%), Query Frame = 2
Query:   83 MDKFKNIFSTKEESNDSDDVGLISGLNDQLTLGCGTRVRMFAICLVIGVVFSILGSALIWLPKGMLLFAVFYTLGNIFSLASTCFLMGPFKQIQKMFEKNRWIITIFVFLFMGLTIVSAVVWKKIVLCILFALLQFLALTWYSLSFIPFAHDIIIKTVTS 562
            M+K + + S      D ++ GL + + D  +L   TR++ FAIC V GV FSILG+ L+WLP G+ LFAVFYTLGN+ +LASTCFLMGP KQ++KMFE  R + TI + L    T+ +A+ W K  L +LF +LQFL++TWYSLS+IP+A D +IK  +S
Sbjct:    1 MEKLRRVLS----GQDDEEQGLTAQVLDASSLSFNTRLKWFAICFVCGVFFSILGTGLLWLPGGIKLFAVFYTLGNLAALASTCFLMGPVKQLKKMFEATRLLATIVMLLCFIFTLCAALWWHKKGLAVLFCILQFLSMTWYSLSYIPYARDAVIKCCSS 156          
BLAST of Vesicle transport protein vs. UniProt/SwissProt
Match: sp|Q5U3Y5|SFT2A_RAT (Vesicle transport protein SFT2A OS=Rattus norvegicus OX=10116 GN=Sft2d1 PE=2 SV=1)

HSP 1 Score: 160.999 bits (406), Expect = 1.215e-48
Identity = 78/160 (48.75%), Postives = 112/160 (70.00%), Query Frame = 2
Query:   83 MDKFKNIFSTKEESNDSDDVGLISGLNDQLTLGCGTRVRMFAICLVIGVVFSILGSALIWLPKGMLLFAVFYTLGNIFSLASTCFLMGPFKQIQKMFEKNRWIITIFVFLFMGLTIVSAVVWKKIVLCILFALLQFLALTWYSLSFIPFAHDIIIKTVTS 562
            M+K + + S      D ++ GL + + D  +L   TR++ F IC V G+ FSILG+ L+WLP G+ LFAVFYTLGN+ +LASTCFLMGP KQ++KMFE  R + TI + L +  T+ +A+ W+K  L +LF +LQFL++TWYSLS+IP+A D ++K  +S
Sbjct:    1 MEKLRRVLS----GQDDEEQGLTAQVLDASSLSFNTRLKWFVICFVAGIFFSILGTGLLWLPNGVKLFAVFYTLGNLAALASTCFLMGPVKQLKKMFETTRLLATIIMLLCLVFTLCAALWWRKKGLALLFCILQFLSMTWYSLSYIPYARDAVLKCCSS 156          
BLAST of Vesicle transport protein vs. UniProt/SwissProt
Match: sp|Q5SSN7|SFT2A_MOUSE (Vesicle transport protein SFT2A OS=Mus musculus OX=10090 GN=Sft2d1 PE=1 SV=1)

HSP 1 Score: 160.999 bits (406), Expect = 1.228e-48
Identity = 78/160 (48.75%), Postives = 111/160 (69.38%), Query Frame = 2
Query:   83 MDKFKNIFSTKEESNDSDDVGLISGLNDQLTLGCGTRVRMFAICLVIGVVFSILGSALIWLPKGMLLFAVFYTLGNIFSLASTCFLMGPFKQIQKMFEKNRWIITIFVFLFMGLTIVSAVVWKKIVLCILFALLQFLALTWYSLSFIPFAHDIIIKTVTS 562
            M+K + + S      D ++ GL + + D  +L   TR++ F IC V G+ FS LG+ L+WLP GM LFAVFYTLGN+ +LASTCFLMGP KQ++KMFE  R + TI + L +  T+ +A+ W+K  L +LF +LQFL++TWYSLS+IP+A D ++K  +S
Sbjct:    1 MEKLRRVLS----GQDDEEQGLTAQVLDASSLSFNTRLKWFVICFVAGIFFSFLGTGLLWLPNGMKLFAVFYTLGNLAALASTCFLMGPVKQLKKMFETTRLLATIIMLLCLVFTLCAALWWRKKGLALLFCILQFLSMTWYSLSYIPYARDAVLKCCSS 156          
BLAST of Vesicle transport protein vs. UniProt/SwissProt
Match: sp|Q8VD57|SFT2B_MOUSE (Vesicle transport protein SFT2B OS=Mus musculus OX=10090 GN=Sft2d2 PE=1 SV=1)

HSP 1 Score: 147.132 bits (370), Expect = 2.566e-43
Identity = 78/163 (47.85%), Postives = 107/163 (65.64%), Query Frame = 2
Query:   83 MDKFKNIFSTKEESNDSDDVGLISGLNDQLTLGCGTRVRMFAICLVIGVVFSILGSALIWLP-KGMLLFAVFYTLGNIFSLASTCFLMGPFKQIQKMFEKNRWIITIFVFLFMGLTIVSAVVWKKIVLCILFALLQFLALTWYSLSFIPFAHDIIIKTVTSCF 568
            MDK K + S      D++D   +S + +  +L  GTR++ F  C  +G++ S+LG+ L+W+P KG+ LFAVFYTLGNI S+ ST FLMGP KQ+++MFE  R I TI V L   LT+ SA +W K  L ++F +LQ LALTWYSLS+IP+A D + K    C 
Sbjct:    1 MDKLKKVLS----GQDTEDRSGLSEVVEASSLSWGTRIKGFIACFALGILCSVLGTLLLWVPRKGLGLFAVFYTLGNIMSIGSTVFLMGPLKQLKRMFEPTRLIATILVLLCFALTLCSAFLWNK-GLALIFCILQSLALTWYSLSYIPYARDAVKKCFAVCL 158          
BLAST of Vesicle transport protein vs. UniProt/SwissProt
Match: sp|O95562|SFT2B_HUMAN (Vesicle transport protein SFT2B OS=Homo sapiens OX=9606 GN=SFT2D2 PE=1 SV=1)

HSP 1 Score: 144.436 bits (363), Expect = 3.222e-42
Identity = 78/162 (48.15%), Postives = 103/162 (63.58%), Query Frame = 2
Query:   83 MDKFKNIFSTKEESNDSDDVGLISGLNDQLTLGCGTRVRMFAICLVIGVVFSILGSALIWLP-KGMLLFAVFYTLGNIFSLASTCFLMGPFKQIQKMFEKNRWIITIFVFLFMGLTIVSAVVWKKIVLCILFALLQFLALTWYSLSFIPFAHDIIIKTVTSC 565
            MDK K + S      D++D   +S + +  +L   TR++ F  C  IG++ S+LG+ L+W+P KG+ LFAVFYT GNI S+ ST FLMGP KQ+++MFE  R I TI V L   LT+ SA  W    L ++F +LQ LALTWYSLSFIPFA D + K    C
Sbjct:    1 MDKLKKVLS----GQDTEDRSGLSEVVEASSLSWSTRIKGFIACFAIGILCSLLGTVLLWVPRKGLHLFAVFYTFGNIASIGSTIFLMGPVKQLKRMFEPTRLIATIMVLLCFALTLCSAFWWHNKGLALIFCILQSLALTWYSLSFIPFARDAVKKCFAVC 158          
BLAST of Vesicle transport protein vs. TrEMBL
Match: F1NPE6 (Vesicle transport protein OS=Gallus gallus OX=9031 GN=SFT2D1 PE=3 SV=3)

HSP 1 Score: 174.481 bits (441), Expect = 1.553e-51
Identity = 87/161 (54.04%), Postives = 114/161 (70.81%), Query Frame = 2
Query:   83 MDKFKNIFSTKEESNDSDDVGLISGLNDQLTLGCGTRVRMFAICLVIGVVFSILGSALIWLPKGMLLFAVFYTLGNIFSLASTCFLMGPFKQIQKMFEKNRWIITIFVFLFMGLTIVSAVVWKKIVLCILFALLQFLALTWYSLSFIPFAHDIIIKTVTSC 565
            M+K + + S      D ++ GL + + D  TL  GTRV+ FAIC + GV  SILG+AL+WLPKG+ LFAVFYTLGNI +LASTCFLMGP KQ++ MFE  R I T+ + LF+ LT+ +   W K  L ++F +LQFLA+TWYSLS+IP+A D +IK  TSC
Sbjct:    1 MEKLRRVLS----GQDDEEQGLTAQVLDASTLSFGTRVKWFAICFIAGVACSILGTALLWLPKGIKLFAVFYTLGNIAALASTCFLMGPLKQLKTMFEPKRLIATVVMLLFLVLTLCAVFWWNKKGLALIFCILQFLAMTWYSLSYIPYARDAVIKCFTSC 157          
BLAST of Vesicle transport protein vs. TrEMBL
Match: A0A2I0MU17 (Vesicle transport protein OS=Columba livia OX=8932 GN=SFT2D1 PE=3 SV=1)

HSP 1 Score: 172.17 bits (435), Expect = 1.540e-50
Identity = 88/161 (54.66%), Postives = 114/161 (70.81%), Query Frame = 2
Query:   83 MDKFKNIFSTKEESNDSDDVGLISGLNDQLTLGCGTRVRMFAICLVIGVVFSILGSALIWLPKGMLLFAVFYTLGNIFSLASTCFLMGPFKQIQKMFEKNRWIITIFVFLFMGLTIVSAVVWKKIVLCILFALLQFLALTWYSLSFIPFAHDIIIKTVTSC 565
            M+K + + S      D ++ GL+  + D  TL  GTRVR FAIC V G+V SILG+AL+WLPKG+ LFAVFYTLGNI +LASTCFLMGP KQ++ MFE  R I T+ + L + LT+ +   W K  L +LF +LQFLA+TWYSLS+IPFA D +IK  ++C
Sbjct:    1 MEKLRRVLS----GQDDEEQGLLIKVLDASTLSFGTRVRWFAICFVAGIVCSILGTALLWLPKGVKLFAVFYTLGNIAALASTCFLMGPVKQLKTMFEPKRLIATVVMLLCLILTLCAVFWWNKKGLAVLFCILQFLAMTWYSLSYIPFARDAVIKCFSAC 157          
BLAST of Vesicle transport protein vs. TrEMBL
Match: A0A1V4JKU9 (Vesicle transport protein OS=Patagioenas fasciata monilis OX=372326 GN=SFT2D1 PE=3 SV=1)

HSP 1 Score: 173.711 bits (439), Expect = 1.648e-50
Identity = 87/162 (53.70%), Postives = 114/162 (70.37%), Query Frame = 2
Query:   83 MDKFKNIFSTKEESNDSDDVGLISGLNDQLTLGCGTRVRMFAICLVIGVVFSILGSALIWLPKGMLLFAVFYTLGNIFSLASTCFLMGPFKQIQKMFEKNRWIITIFVFLFMGLTIVSAVVWKKIVLCILFALLQFLALTWYSLSFIPFAHDIIIKTVTSCF 568
            M+K + + S      D ++ GL + + D  TL  GTRVR FAIC V G+V S+LG+AL+WLPKG+ LFAVFYTLGNI +LASTCFLMGP KQ++ MFE  R I T+ + L + LT+ +   W K  L +LF +LQFLA+TWYSLS+IPFA D +IK  ++C 
Sbjct:    1 MEKLRRVLS----GQDDEEQGLTAQVLDASTLSFGTRVRWFAICFVAGIVCSVLGTALLWLPKGVKLFAVFYTLGNIAALASTCFLMGPVKQLKAMFEPKRLIATVVMLLCLILTLCAVFWWNKKGLAVLFCILQFLAMTWYSLSYIPFARDAVIKCFSACL 158          
BLAST of Vesicle transport protein vs. TrEMBL
Match: A0A3Q2CKW3 (Vesicle transport protein OS=Cyprinodon variegatus OX=28743 PE=3 SV=1)

HSP 1 Score: 171.014 bits (432), Expect = 4.049e-50
Identity = 85/161 (52.80%), Postives = 119/161 (73.91%), Query Frame = 2
Query:   83 MDKFKNIFSTKEESNDSDDVGLISGLNDQLTLGCGTRVRMFAICLVIGVVFSILGSALIWLPKGMLLFAVFYTLGNIFSLASTCFLMGPFKQIQKMFEKNRWIITIFVFLFMGLTIVSAVVWKKIVLCILFALLQFLALTWYSLSFIPFAHDIIIKTVTSC 565
            MDK + + S +E   D++++GL + + D  +L   TRV+ F IC  +G++FSILGSAL++LP G+ LFAVFYTLGNI +L+STCFLMGP KQ++KMFE  R I TI + L + LT+ +A  WKK  L I+F +LQFL++TWYS+S+IPFA D ++K  T+C
Sbjct:    1 MDKLRRVLSGRE---DNEELGLTAQVLDGSSLSFSTRVKWFVICFAVGILFSILGSALLFLPGGLKLFAVFYTLGNIAALSSTCFLMGPLKQLKKMFEPTRLIATIVMMLCLVLTLCAAFWWKKNGLAIIFCILQFLSMTWYSISYIPFARDAVMKCFTTC 158          
BLAST of Vesicle transport protein vs. TrEMBL
Match: A0A267H0Y2 (Vesicle transport protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig007546g1 PE=3 SV=1)

HSP 1 Score: 170.629 bits (431), Expect = 7.240e-50
Identity = 81/162 (50.00%), Postives = 114/162 (70.37%), Query Frame = 2
Query:   80 QMDKFKNIFSTKEESNDSDDVGLISGLNDQLTLGCGTRVRMFAICLVIGVVFSILGSALIWLPKGMLLFAVFYTLGNIFSLASTCFLMGPFKQIQKMFEKNRWIITIFVFLFMGLTIVSAVVWKKIVLCILFALLQFLALTWYSLSFIPFAHDIIIKTVTSC 565
             MDK K + S  ++ N +D  G+I+  +D+ T    +R++ F  C VIG +FS+LGSALI LP G+++FA FYT+GN+ SLASTCFLMGP  Q++KMF   R I T+ + LFM LT+++A+ WKK VL ++F LLQFLAL WYS+S+IP+A   I    ++C
Sbjct:    3 NMDKLKKVLSGNDDDN-TDREGIIAEFSDRTTFSWSSRIKGFIACFVIGWIFSLLGSALIALPHGLVIFATFYTIGNVLSLASTCFLMGPINQLKKMFAPTRLIATLLMLLFMALTLMAAIWWKKSVLAVIFCLLQFLALVWYSISYIPYARTAIKNAFSAC 163          
BLAST of Vesicle transport protein vs. Ensembl Cavefish
Match: sft2d2b (vesicle transport protein SFT2B-like [Source:NCBI gene;Acc:103042672])

HSP 1 Score: 155.606 bits (392), Expect = 1.571e-47
Identity = 79/162 (48.77%), Postives = 110/162 (67.90%), Query Frame = 2
Query:   83 MDKFKNIFSTKEESNDSDDVGLISGLNDQLTLGCGTRVRMFAICLVIGVVFSILGSALIWLPK-GMLLFAVFYTLGNIFSLASTCFLMGPFKQIQKMFEKNRWIITIFVFLFMGLTIVSAVVWKKIVLCILFALLQFLALTWYSLSFIPFAHDIIIKTVTSC 565
            MDK K + S ++  N +DD+ ++   +D  TLG GTRV+ F  C  +GV+ S+LG+ L+W+PK G++LFAVFYT GNI SL ST FLMGP KQ+++M +K R + T  +   + LT+ +A  WK   L +LF +LQFLA TWY LS+IPFA D +IK  + C
Sbjct:    1 MDKLKKVLSGQD--NGTDDLNVLQAASDATTLGWGTRVKAFIACFALGVLCSVLGTCLLWVPKSGLILFAVFYTFGNIASLLSTMFLMGPLKQVKRMCDKTRALATAIMITCLVLTLCAAFWWKNKGLALLFCILQFLAFTWYGLSYIPFARDALIKVFSVC 160          
BLAST of Vesicle transport protein vs. Ensembl Cavefish
Match: sft2d2a (vesicle transport protein SFT2B-like [Source:NCBI gene;Acc:103032030])

HSP 1 Score: 136.732 bits (343), Expect = 4.914e-40
Identity = 74/157 (47.13%), Postives = 104/157 (66.24%), Query Frame = 2
Query:   83 MDKFKNIFSTKEESNDSDDVGLISGLNDQLTLGCGTRVRMFAICLVIGVVFSILGSALIWLPK-GMLLFAVFYTLGNIFSLASTCFLMGPFKQIQKMFEKNRWIITIFVFLFMGLTIVSAVVWKKIVLCILFALLQFLALTWYSLSFIPFAHDIIIK 550
            MDK +   S +E +ND+ ++  ++  N+  TLG GTRV+ F IC+ IG+  S+LG  L+++PK G++LF VFYT GNI SL ST FLMGP KQI+KM +K R   T+ +   + LT+ +   WK   L +LF +LQ LA  WY LS+IPFA D ++K
Sbjct:    1 MDKLRAFLSGREGNNDNRNILQVA--NEASTLGWGTRVKGFVICMAIGLGCSVLGVCLLFIPKIGVILFIVFYTFGNICSLFSTMFLMGPVKQIKKMCDKTRAFATVVMITCLVLTLCAVFWWKIFALTLLFVILQVLAFAWYGLSYIPFARDAVLK 155          
BLAST of Vesicle transport protein vs. Ensembl Cavefish
Match: sft2d1 (SFT2 domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1350])

HSP 1 Score: 122.479 bits (306), Expect = 1.730e-34
Identity = 68/150 (45.33%), Postives = 93/150 (62.00%), Query Frame = 2
Query:   83 MDKFKNIFSTKEESNDSDDVGLISGLNDQLTLGCGTRVRMFAICLVIGVVFSILGSALIWLPKGMLLFAVFYTLGNIFSLASTCFLMGPFKQIQKMFEKNRWIITIFVFLFMGLTIVSAVVWKKIVLCILFALLQFLALTWYSLSFIPFA 532
            MDK + + S +E   D++++GL + + D  TL   TR++ F IC   G++ SILG+AL++LPKG+ LFAVFYTLGN+ +LASTCFLMGP KQ+Q+MFE  R I T              ++W K VL I+F +L    L  YS  F   A
Sbjct:    1 MDKLRRVLSGRE---DNEELGLTAQVLDSSTLSYSTRIKWFVICFASGILCSILGTALLFLPKGLQLFAVFYTLGNLAALASTCFLMGPLKQLQRMFEPTRLIAT------------CVMLWHKKVLAIIFCILHS-KLILYSFCFADVA 134          
BLAST of Vesicle transport protein vs. Ensembl Cavefish
Match: sft2d2a (vesicle transport protein SFT2B-like [Source:NCBI gene;Acc:103032030])

HSP 1 Score: 110.923 bits (276), Expect = 5.628e-30
Identity = 64/139 (46.04%), Postives = 91/139 (65.47%), Query Frame = 2
Query:   83 MDKFKNIFSTKEESNDSDDVGLISGLNDQLTLGCGTRVRMFAICLVIGVVFSILGSALIWLPK-GMLLFAVFYTLGNIFSLASTCFLMGPFKQIQKMFEKNRWIITIFVFLFMGLTIVSAVVWKKIVLCILFALLQFLA 496
            MDK +   S +E +ND+ ++  ++  N+  TLG GTRV+ F IC+ IG+  S+LG  L+++PK G++LF VFYT GNI SL ST FLMGP KQI+KM +K R   T+ +   + LT+ +   WK   L +LF +LQ LA
Sbjct:    1 MDKLRAFLSGREGNNDNRNILQVA--NEASTLGWGTRVKGFVICMAIGLGCSVLGVCLLFIPKIGVILFIVFYTFGNICSLFSTMFLMGPVKQIKKMCDKTRAFATVVMITCLVLTLCAVFWWKIFALTLLFVILQVLA 137          
BLAST of Vesicle transport protein vs. Ensembl Sea Lamprey
Match: sft2d1 (SFT2 domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1350])

HSP 1 Score: 155.221 bits (391), Expect = 5.381e-48
Identity = 75/161 (46.58%), Postives = 109/161 (67.70%), Query Frame = 2
Query:   83 MDKFKNIFSTKEESNDSDDVGLISGLNDQLTLGCGTRVRMFAICLVIGVVFSILGSALIWLPKGMLLFAVFYTLGNIFSLASTCFLMGPFKQIQKMFEKNRWIITIFVFLFMGLTIVSAVVWKKIVLCILFALLQFLALTWYSLSFIPFAHDIIIKTVTSC 565
            MDK + + + +E+ N+S   GL+  + +  T+  GTR++ F  C + G++ SILG+  +WL  G++LFAVFY+LGNI +L STCFLMGP KQ+++MF   R I T  +   +  T+ SA  WK   L +LF +LQFL+LTWYSLS+IP+A D++ K  TSC
Sbjct:    1 MDKLRRVLNGEEDENES---GLVGQIVEGSTMSWGTRLKCFVACFIFGILCSILGTVFLWLKNGLILFAVFYSLGNICALCSTCFLMGPLKQMKRMFNPTRAIATSVMLCCLVCTLCSAFWWKNKPLALLFCVLQFLSLTWYSLSYIPYARDMVKKCFTSC 158          
BLAST of Vesicle transport protein vs. Ensembl Yeast
Match: SFT2 (Tetra-spanning membrane protein found mostly in the late Golgi; non-essential; can suppress some sed5 alleles; may be part of the transport machinery, but precise function is unknown; similar to mammalian syntaxin 5 [Source:SGD;Acc:S000000198])

HSP 1 Score: 44.2838 bits (103), Expect = 4.787e-6
Identity = 25/82 (30.49%), Postives = 46/82 (56.10%), Query Frame = 2
Query:  284 FAVFYTLGNIFSLASTCFLMGPFKQIQKMFEKNRWIITIFVFLFMGLTIVSAVVWKKIVLCILFALLQFLALTWYSLSFIPF 529
            F + +T+G++  + +   LMGP   ++ +  + R   ++F F    +TI  A   K  VL I  ALL+ +A+ +Y++S+ PF
Sbjct:  112 FGLLWTMGSLLFVLAFGVLMGPLAYLKHLTARERLPFSMFFFATCFMTIYFAAFSKNTVLTITCALLELVAVIYYAISYFPF 193          
BLAST of Vesicle transport protein vs. Ensembl Nematostella
Match: EDO38593 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCF2])

HSP 1 Score: 135.961 bits (341), Expect = 2.481e-40
Identity = 72/161 (44.72%), Postives = 106/161 (65.84%), Query Frame = 2
Query:   83 MDKFKNIFSTKEESNDSDDVGLISGLNDQLTLGCGTRVRMFAICLVIGVVFSILGSALIWLPKGMLLFAVFYTLGNIFSLASTCFLMGPFKQIQKMFEKNRWIITIFVFLFMGLTIVSAVVWKKIVLCILFALLQFLALTWYSLSFIPFAHDIIIKTVTSC 565
            + K ++  S  E  +DS    LI+ ++D  +L   TR++ FAIC ++G  FSILG+ L  L + + LFAVFYTLGNI +L STCFLMGP KQ++ MF++ R I TI +   + LT+ +A+ W    L I+F +LQ+L++TWY LS+IPFA D + +  + C
Sbjct:    6 IQKLRSAISGDEPQDDS----LITEISDATSLSWSTRIKGFAICFIVGCSFSILGTFL--LIRDIKLFAVFYTLGNITALLSTCFLMGPCKQLKNMFKEKRLIATILMLTCLVLTLCAALWWHSKGLAIVFCILQYLSMTWYCLSYIPFARDAVKRCFSGC 160          
BLAST of Vesicle transport protein vs. Ensembl Nematostella
Match: EDO46566 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPU0])

HSP 1 Score: 54.6842 bits (130), Expect = 2.236e-9
Identity = 41/141 (29.08%), Postives = 69/141 (48.94%), Query Frame = 2
Query:  113 KEESNDSDDVGLISGLNDQL--TLGCGTRVRMFAICLVIGV-VFSILGSALIWLPKGMLLFAVFYTLGNIFSLASTCFLMGPFKQIQKMFEKNRWIITIFVFLFMGLTIVSAVVWKKIVLCILFALLQFLALTWYSLSFIP 526
             + SN      L  G  D    +L    R+  F +CL++GV  F + G    ++      F + YT+G++F++ S   L GP   ++ +    R   T   F  M  T+  A++ +  +L  LFA++Q +AL WY +S+IP
Sbjct:    4 SQSSNGQWGAWLSKGEEDPYLPSLSRKQRILGFFMCLLMGVFCFVMAGFIAPFIVLKARKFVMLYTMGSLFTIGSFSLLWGPVNHVKHLCSLGRLPFTAAYFGSMIATLYMALIVRSTILTALFAVVQIIALIWYFVSYIP 144          
BLAST of Vesicle transport protein vs. Ensembl Medaka
Match: sft2d1 (SFT2 domain containing 1 [Source:NCBI gene;Acc:101161435])

HSP 1 Score: 162.54 bits (410), Expect = 3.058e-50
Identity = 83/161 (51.55%), Postives = 115/161 (71.43%), Query Frame = 2
Query:   83 MDKFKNIFSTKEESNDSDDVGLISGLNDQLTLGCGTRVRMFAICLVIGVVFSILGSALIWLPKGMLLFAVFYTLGNIFSLASTCFLMGPFKQIQKMFEKNRWIITIFVFLFMGLTIVSAVVWKKIVLCILFALLQFLALTWYSLSFIPFAHDIIIKTVTSC 565
            MDK + + S ++   D++++GL + + D  +L   TRV+ F IC   GV+ SILG+AL++LPKG+ LF VFYTLGNI +LASTCFLMGP KQ+++MFE  R I TI + L + LT+ +   W K  L I+F +LQFLA+TWYS+S+IPFA D +IK  T+C
Sbjct:    1 MDKLRRVLSGQD---DNEELGLTAQVLDSSSLSYTTRVKWFVICFAGGVLCSILGTALLFLPKGLKLFGVFYTLGNISALASTCFLMGPLKQLKRMFEPTRLIATIVMLLCLILTLCAVFWWGKNGLAIIFCILQFLAMTWYSISYIPFARDAVIKCFTTC 158          
BLAST of Vesicle transport protein vs. Ensembl Medaka
Match: ENSORLT00000046729.1 (vesicle transport protein SFT2B [Source:NCBI gene;Acc:101155498])

HSP 1 Score: 141.354 bits (355), Expect = 4.842e-42
Identity = 75/162 (46.30%), Postives = 108/162 (66.67%), Query Frame = 2
Query:   83 MDKFKNIFSTKEESNDSDDVGLISGLNDQLTLGCGTRVRMFAICLVIGVVFSILGSALIWLPK-GMLLFAVFYTLGNIFSLASTCFLMGPFKQIQKMFEKNRWIITIFVFLFMGLTIVSAVVWKKIVLCILFALLQFLALTWYSLSFIPFAHDIIIKTVTSC 565
            MDK K + S ++E   S D G   G+ +  TL  GTR++ F IC V+G + SILG+ L+W+P  G+ +FAV Y++GNI +LAST FLMGP +Q++KM  K R + T+ + + + LT+ +A  WK   L +LF +LQFLA TWY LS+IPFA D ++K  + C
Sbjct:    1 MDKLKRVLSGQDEG--STDGG---GILEASTLAWGTRMKGFIICFVLGTLLSILGTCLLWIPGFGLTVFAVLYSVGNISALASTMFLMGPLRQVKKMCAKERALATVIMLVCLVLTLCAAFWWKNKGLALLFCILQFLAFTWYGLSYIPFARDAVMKLFSLC 157          
BLAST of Vesicle transport protein vs. Ensembl Medaka
Match: sft2d1 (SFT2 domain containing 1 [Source:NCBI gene;Acc:101161435])

HSP 1 Score: 132.494 bits (332), Expect = 1.293e-38
Identity = 76/161 (47.20%), Postives = 105/161 (65.22%), Query Frame = 2
Query:   83 MDKFKNIFSTKEESNDSDDVGLISGLNDQLTLGCGTRVRMFAICLVIGVVFSILGSALIWLPKGMLLFAVFYTLGNIFSLASTCFLMGPFKQIQKMFEKNRWIITIFVFLFMGLTIVSAVVWKKIVLCILFALLQFLALTWYSLSFIPFAHDIIIKTVTSC 565
            MDK + + S ++   D++++GL   + D  +L   TRV+ F IC   GV+ SILG+AL++LPKG+ LF VFYTLGNI +LASTCFLMGP KQ+++MFE  R I TI + L + LT+ +   W K  L I+F +LQFLA+TW          D +IK  T+C
Sbjct:    1 MDKLRRVLSGQD---DNEELGLT--VLDSSSLSYTTRVKWFVICFAGGVLCSILGTALLFLPKGLKLFGVFYTLGNISALASTCFLMGPLKQLKRMFEPTRLIATIVMLLCLILTLCAVFWWGKNGLAIIFCILQFLAMTW----------DAVIKCFTTC 146          
BLAST of Vesicle transport protein vs. Ensembl Medaka
Match: sft2d2a (vesicle transport protein SFT2B-like [Source:NCBI gene;Acc:101171820])

HSP 1 Score: 123.635 bits (309), Expect = 3.975e-35
Identity = 66/160 (41.25%), Postives = 100/160 (62.50%), Query Frame = 2
Query:   83 MDKFKNIFSTKEESNDSDDVGLISGLNDQLTLGCGTRVRMFAICLVIGVVFSILGSALIWLPK-GMLLFAVFYTLGNIFSLASTCFLMGPFKQIQKMFEKNRWIITIFVFLFMGLTIVSAVVWKKIVLCILFALLQFLALTWYSLSFIPFAHDIIIKTVT 559
            MDK K++ S +E  ND     ++  +N+  TL   TR++ F  C V+G   +ILG  +++LPK G+ LF +FYT GNI +L ST FLMGP KQ+++M +K R + T  +   + LT+ +A  WK   L +LF +LQ L+  WYSLS+IP   + ++K V+
Sbjct:    1 MDKLKSVLSGEEARNDRT---VMQTVNEASTLSWATRIKGFIACFVVGGACTILGVCVLFLPKIGITLFIIFYTFGNICALGSTMFLMGPVKQLKRMCDKTRALATTIMITCLVLTLCAAFWWKNFGLALLFCILQVLSFAWYSLSYIPCVREALLKLVS 157          
BLAST of Vesicle transport protein vs. Planmine SMEST
Match: SMESG000068185.1 (SMESG000068185.1)

HSP 1 Score: 171.014 bits (432), Expect = 1.113e-53
Identity = 86/162 (53.09%), Postives = 114/162 (70.37%), Query Frame = 2
Query:   83 MDKFKNIFSTKEESNDSDDVGLISGLNDQLTLGCGTRVRMFAICLVIGVVFSILGSALIWLPK-GMLLFAVFYTLGNIFSLASTCFLMGPFKQIQKMFEKNRWIITIFVFLFMGLTIVSAVVWKKIVLCILFALLQFLALTWYSLSFIPFAHDIIIKTVTSC 565
            M+  K  FS+  E+ +  +    S L D  TL  GTR++ F IC   G VFS+LGSA +WLPK G+++F VFYT+GN+ SLAST FLMGP KQ +KMF + RWI  I +F+FM LT++SA+ W+K +LCI+F +LQFLALTWYS+S+IPFA   I    T+C
Sbjct:    1 MNYVKKSFSSFNENEEEPNA---SNLTDVTTLSFGTRIKWFIICFAAGFVFSLLGSAFLWLPKSGLIIFGVFYTIGNLLSLASTSFLMGPVKQCKKMFAETRWIAAIVMFIFMALTLMSALWWQKKMLCIIFCILQFLALTWYSISYIPFARTAIKNCFTTC 159          
The following BLAST results are available for this feature:
BLAST of Vesicle transport protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
SFT2D11.027e-4950.63SFT2 domain containing 1 [Source:HGNC Symbol;Acc:H... [more]
SFT2D26.709e-4348.15SFT2 domain containing 2 [Source:HGNC Symbol;Acc:H... [more]
SFT2D22.498e-1342.22SFT2 domain containing 2 [Source:HGNC Symbol;Acc:H... [more]
SFT2D22.498e-1342.22SFT2 domain containing 2 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of Vesicle transport protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
F27D4.79.168e-2036.18Vesicle transport protein [Source:UniProtKB/TrEMB... [more]
back to top
BLAST of Vesicle transport protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG51047.894e-4748.75gene:FBgn0037009 transcript:FBtr0078209[more]
CG336353.656e-632.17gene:FBgn0053635 transcript:FBtr0091612[more]
back to top
BLAST of Vesicle transport protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sft2d12.016e-4652.47SFT2 domain containing 1 [Source:ZFIN;Acc:ZDB-GENE... [more]
sft2d2b2.296e-4650.00SFT2 domain containing 2b [Source:ZFIN;Acc:ZDB-GEN... [more]
sft2d2a3.427e-4347.77SFT2 domain containing 2a [Source:ZFIN;Acc:ZDB-GEN... [more]
sft2d2a7.692e-4248.08SFT2 domain containing 2a [Source:ZFIN;Acc:ZDB-GEN... [more]
sft2d2b1.713e-1935.80SFT2 domain containing 2b [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Vesicle transport protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
sft2d12.941e-4649.38SFT2 domain containing 1 [Source:NCBI gene;Acc:448... [more]
sft2d21.953e-4348.78SFT2 domain containing 2 [Source:NCBI gene;Acc:549... [more]
sft2d21.350e-4050.00SFT2 domain containing 2 [Source:NCBI gene;Acc:549... [more]
sft2d23.644e-3946.34SFT2 domain containing 2 [Source:NCBI gene;Acc:549... [more]
back to top
BLAST of Vesicle transport protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Sft2d11.755e-4948.75SFT2 domain containing 1 [Source:MGI Symbol;Acc:MG... [more]
Gm121661.755e-4948.75predicted gene 12166 [Source:MGI Symbol;Acc:MGI:36... [more]
Sft2d23.668e-4447.85SFT2 domain containing 2 [Source:MGI Symbol;Acc:MG... [more]
Sft2d21.329e-1342.68SFT2 domain containing 2 [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of Vesicle transport protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8WV19|SFT2A_HUMAN4.934e-4950.63Vesicle transport protein SFT2A OS=Homo sapiens OX... [more]
sp|Q5U3Y5|SFT2A_RAT1.215e-4848.75Vesicle transport protein SFT2A OS=Rattus norvegic... [more]
sp|Q5SSN7|SFT2A_MOUSE1.228e-4848.75Vesicle transport protein SFT2A OS=Mus musculus OX... [more]
sp|Q8VD57|SFT2B_MOUSE2.566e-4347.85Vesicle transport protein SFT2B OS=Mus musculus OX... [more]
sp|O95562|SFT2B_HUMAN3.222e-4248.15Vesicle transport protein SFT2B OS=Homo sapiens OX... [more]
back to top
BLAST of Vesicle transport protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
F1NPE61.553e-5154.04Vesicle transport protein OS=Gallus gallus OX=9031... [more]
A0A2I0MU171.540e-5054.66Vesicle transport protein OS=Columba livia OX=8932... [more]
A0A1V4JKU91.648e-5053.70Vesicle transport protein OS=Patagioenas fasciata ... [more]
A0A3Q2CKW34.049e-5052.80Vesicle transport protein OS=Cyprinodon variegatus... [more]
A0A267H0Y27.240e-5050.00Vesicle transport protein (Fragment) OS=Macrostomu... [more]
back to top
BLAST of Vesicle transport protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
sft2d2b1.571e-4748.77vesicle transport protein SFT2B-like [Source:NCBI ... [more]
sft2d2a4.914e-4047.13vesicle transport protein SFT2B-like [Source:NCBI ... [more]
sft2d11.730e-3445.33SFT2 domain containing 1 [Source:ZFIN;Acc:ZDB-GENE... [more]
sft2d2a5.628e-3046.04vesicle transport protein SFT2B-like [Source:NCBI ... [more]
back to top
BLAST of Vesicle transport protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
sft2d15.381e-4846.58SFT2 domain containing 1 [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of Vesicle transport protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
SFT24.787e-630.49Tetra-spanning membrane protein found mostly in th... [more]
back to top
BLAST of Vesicle transport protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO385932.481e-4044.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO465662.236e-929.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Vesicle transport protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
sft2d13.058e-5051.55SFT2 domain containing 1 [Source:NCBI gene;Acc:101... [more]
ENSORLT00000046729.14.842e-4246.30vesicle transport protein SFT2B [Source:NCBI gene;... [more]
sft2d11.293e-3847.20SFT2 domain containing 1 [Source:NCBI gene;Acc:101... [more]
sft2d2a3.975e-3541.25vesicle transport protein SFT2B-like [Source:NCBI ... [more]
back to top
BLAST of Vesicle transport protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000068185.11.113e-5353.09SMESG000068185.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012109 ID=SMED30012109|Name=Vesicle transport protein|organism=Schmidtea mediterranea sexual|type=transcript|length=747bp
CCGATCTTGAAAATATTACGAATTACTTTTCTGATCCAAATTTTTCAAAG
AATTTTTTAACCAGGAATCATCTTTTAATCAAATGGATAAATTTAAGAAT
ATTTTTAGTACCAAAGAGGAATCAAATGATTCAGATGATGTCGGATTAAT
ATCGGGATTAAATGATCAGCTAACTCTTGGATGTGGCACAAGAGTACGTA
TGTTCGCTATTTGTTTGGTTATTGGTGTTGTATTCTCTATTCTGGGATCT
GCACTTATATGGTTACCTAAGGGCATGTTGCTCTTTGCAGTATTTTACAC
GTTAGGGAACATATTTTCTTTAGCAAGTACATGTTTTCTAATGGGACCTT
TCAAGCAAATCCAAAAGATGTTTGAAAAGAATAGATGGATTATTACAATT
TTTGTCTTTTTGTTCATGGGATTGACAATAGTGTCAGCAGTTGTGTGGAA
AAAGATTGTTCTCTGTATTTTATTTGCATTGTTACAATTTCTTGCTTTGA
CCTGGTATTCATTGTCATTTATTCCATTTGCACACGACATAATTATTAAG
ACGGTAACATCTTGTTTCTAAAGATCCTTTCCGAAGACAACCAATCAAAG
TATTATATGATGGGGAAACTTGTTGTATGTTAATTTATTTTTGAAGTTGA
ATTAATTGGTTTTCAAATGTTTTTCTATCATTTCCGTGATTTTGTTTTTT
ATGATTACTTTATACTTATATAATACAATTAATCTCGTGAAAAAAAA
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR011691Vesicle_transpt_SFT2
IPR007305Vesicle_transpt_Got1/SFT2
Vocabulary: biological process
TermDefinition
GO:0016192vesicle-mediated transport
GO:0006810transport
GO:0015031protein transport
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR007305Vesicle transport protein, Got1/SFT2-likePFAMPF04178Got1coord: 49..157
e-value: 2.8E-31
score: 108.2
IPR011691Vesicle transport protein SFT2PANTHERPTHR23137UNCHARACTERIZEDcoord: 1..162
NoneNo IPR availablePANTHERPTHR23137:SF28VESICLE TRANSPORT PROTEINcoord: 1..162
NoneNo IPR availableTMHMMTMhelixcoord: 67..89
NoneNo IPR availableTMHMMTMhelixcoord: 40..62
NoneNo IPR availableTMHMMTMhelixcoord: 125..147
NoneNo IPR availableTMHMMTMhelixcoord: 102..121