Zinc finger MYND domain-containing protein 12

Overview
NameZinc finger MYND domain-containing protein 12
Smed IDSMED30012107
Length (bp)1207
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Zinc finger MYND domain-containing protein 12 (SMED30012107) t-SNE clustered cells

Violin plots show distribution of expression levels for Zinc finger MYND domain-containing protein 12 (SMED30012107) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Zinc finger MYND domain-containing protein 12 (SMED30012107) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Zinc finger MYND domain-containing protein 12 (SMED30012107) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012107

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30012107SMESG000023516.1 SmedASXL_006387SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30012107SMESG000023516.1 dd_Smed_v4_10079_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30012107SMESG000023516.1 dd_Smed_v6_10079_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30012107SMESG000023516.1 dd_Smed_v4_10079_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Zinc finger MYND domain-containing protein 12 vs. Ensembl Human
Match: ZMYND12 (zinc finger MYND-type containing 12 [Source:HGNC Symbol;Acc:HGNC:21192])

HSP 1 Score: 299.671 bits (766), Expect = 1.076e-98
Identity = 151/328 (46.04%), Postives = 218/328 (66.46%), Query Frame = 1
Query:   76 ANPKGVDLLCELCQRPAFLQCTLCKVTYYCSVEHQRADWISIHDKICSSVEALKRNIPFIKTEEERRNRKDEVHKKLGKMIEITRTIGKKLLFQGKHEQAVPTALQCLKFSIEVYGLASVELVPAYLILSEASIGLNRLPQAEEYLAQAQWTVLKSPDCPKSIRSQLHRKLGLLYSAKGDANAALENLAHDIFYSSTEYGTDNVLTSGGYYLMAEVFMKQNRMDIADDLLTRVCTIWMEFLKDIVSSLTFKPEIPEG--IGEVVAEITQVEKQTLDEAQEAEAIKVLNSIYSIRRTQLNCKPFAKAISALVLSMLYFILNDKSRAEDF 1053
            A PKG  L CE+C+ PA   C  C VTYYC V HQ+ADW SIH+KIC  +  L+ ++PF  +EEER++   ++ ++   +IE   TI +K LF+GKHE AVP ALQ L+F +++YGL+SVELVPAYL+L+EAS+GL R+ QAEEYL QAQWTVLKS DC  +  S LHR LGLLY AK +   A  +LA+DI+++S  +GT+++ TSGGY+ +A +F    ++D+AD L T+V  IW  +L +    L+ +  I +   +G++    T      LDEAQEAEAI++L SI +IR +  +  P        +L M Y+++ + S+A+++
Sbjct:    8 AVPKGRRLCCEVCEAPAERVCAACTVTYYCGVVHQKADWDSIHEKICQLLIPLRTSMPFYNSEEERQHGLQQLQQRQKYLIEFCYTIAQKYLFEGKHEDAVPAALQSLRFRVKLYGLSSVELVPAYLLLAEASLGLGRIVQAEEYLFQAQWTVLKSTDCSNATHSLLHRNLGLLYIAKKNYEEARYHLANDIYFASCAFGTEDIRTSGGYFHLANIFYDLKKLDLADTLYTKVSEIWHAYLNNHYQVLS-QAHIQQMDLLGKLFENDT-----GLDEAQEAEAIRILTSILNIRESTSDKAPQKTIFVLKILVMFYYLMMNSSKAQEY 329          
BLAST of Zinc finger MYND domain-containing protein 12 vs. Ensembl Human
Match: ZMYND12 (zinc finger MYND-type containing 12 [Source:HGNC Symbol;Acc:HGNC:21192])

HSP 1 Score: 80.8777 bits (198), Expect = 5.591e-18
Identity = 36/76 (47.37%), Postives = 51/76 (67.11%), Query Frame = 1
Query:   76 ANPKGVDLLCELCQRPAFLQCTLCKVTYYCSVEHQRADWISIHDKICSSVEALKRNIPFIKTEEERRNRKDEVHKK 303
            A PKG  L CE+C+ PA   C  C VTYYC V HQ+ADW SIH+KIC  +  L+ ++PF  +EEER++   ++ ++
Sbjct:    8 AVPKGRRLCCEVCEAPAERVCAACTVTYYCGVVHQKADWDSIHEKICQLLIPLRTSMPFYNSEEERQHGLQQLQQR 83          
BLAST of Zinc finger MYND domain-containing protein 12 vs. Ensembl Zebrafish
Match: zmynd12 (zinc finger, MYND-type containing 12 [Source:ZFIN;Acc:ZDB-GENE-041114-133])

HSP 1 Score: 236.498 bits (602), Expect = 3.664e-74
Identity = 121/338 (35.80%), Postives = 203/338 (60.06%), Query Frame = 1
Query:   76 ANPKGVDLLCELCQRPAFLQCTLCKVTYYCSVEHQRADWISIHDKICSSVEALKRNIPFIKTEEERRNRKDEVHKKLGKMIEITRTIGKKLLFQGKHEQAVPTALQCLKFSIEVYGLASVELVPAYLILSEASIGLNRLPQAEEYLAQAQWTVLKSPDCPKSIRSQLHRKLGLLYSAKGDANAALENLAHDIFYSSTEYGTDNVLTSGGYYLMAEVFMKQNRMDIADDLLTRVCTIWMEFLKDIVSSLTFKPEIPEGIGEVVAEITQVEKQTLDEAQEAEAIKVLNSIYSIRRTQLNCKPFAKAISALVLSMLYFILNDKSRAEDFLAESDAATCGIE 1089
            ANPKG   LCE+CQ+PA LQCT C VT+YC+++HQ+ADW SIH+K C  + ++   +P     ++  + K+ + KK   +IE+     +K +   + +  +P AL    + + VYG  +VELVPAYL+L++A+IGL  L QA+EYL++A+W V+K+ DC  ++  QLHR LG L++A G   +AL + A+D++Y+   +G D+++TSGGY+LMA+VF+KQN+ DIA  L T V   W   L  ++  ++     P+              +  +EAQ  EA ++L+ I       +  +P    + A  L+ML+ + ++ ++A ++  +++    G++
Sbjct:    9 ANPKGEKKLCEICQKPAKLQCTKCLVTFYCNLDHQQADWTSIHEKACPLLVSINTPVPSGTLSDQNHHHKETL-KKQKCLIEMAHLEARKWVSMKRFQDVLPAALLFQHWIMRVYGSCTVELVPAYLLLAQANIGLGSLSQAQEYLSKAEWIVMKTADCSHTVLHQLHRTLGRLHAAMGKQASALTHFANDVYYAIEMFGLDSIVTSGGYFLMADVFLKQNKPDIAHSLYTEVAGSWHTHLCKLMDGISQSATQPD--------------ECFNEAQCVEADQMLSCILEFEEQCVKPRPEQLTMLAHSLAMLWLLRDNYTKALEYGKKAEVLIQGVK 331          
BLAST of Zinc finger MYND domain-containing protein 12 vs. Ensembl Zebrafish
Match: zmynd12 (zinc finger, MYND-type containing 12 [Source:ZFIN;Acc:ZDB-GENE-041114-133])

HSP 1 Score: 234.187 bits (596), Expect = 2.820e-73
Identity = 119/338 (35.21%), Postives = 202/338 (59.76%), Query Frame = 1
Query:   76 ANPKGVDLLCELCQRPAFLQCTLCKVTYYCSVEHQRADWISIHDKICSSVEALKRNIPFIKTEEERRNRKDEVHKKLGKMIEITRTIGKKLLFQGKHEQAVPTALQCLKFSIEVYGLASVELVPAYLILSEASIGLNRLPQAEEYLAQAQWTVLKSPDCPKSIRSQLHRKLGLLYSAKGDANAALENLAHDIFYSSTEYGTDNVLTSGGYYLMAEVFMKQNRMDIADDLLTRVCTIWMEFLKDIVSSLTFKPEIPEGIGEVVAEITQVEKQTLDEAQEAEAIKVLNSIYSIRRTQLNCKPFAKAISALVLSMLYFILNDKSRAEDFLAESDAATCGIE 1089
            ANPKG   LCE+CQ+PA LQCT C VT+YC+++HQ+ADW SIH+K C  + ++   +P     ++  + K+ + KK   +IE+     +K +   + +  +P AL    + + VYG  +VELVPAYL+L++A+IG+  L QA+EYL++A+W V+K+ DC  ++  QLHR LG L++A G   +AL + A+D++Y+   +G D+++TSGGY+LMA+VF+KQN+ DIA  L T V   W   L  ++  ++     P+              +  +E Q  EA ++L+ I       +  +P    + A  L+ML+ + ++ ++A ++  +++    G++
Sbjct:    9 ANPKGEKKLCEICQKPAKLQCTKCLVTFYCNLDHQQADWTSIHEKACPLLVSINTPVPSGTLSDQNHHHKETL-KKQKCLIEMAHLEARKWVSMKRFQDVLPAALLFQHWIMRVYGSCTVELVPAYLLLAQANIGIGSLSQAQEYLSKAEWIVMKTADCSHTVLHQLHRTLGRLHAAMGKQASALTHFANDVYYAIEMFGLDSIVTSGGYFLMADVFLKQNKPDIAHSLYTEVAGSWHTHLCKLMDGISQSATQPD--------------ECFNEVQCVEADQMLSCILEFEEQCVKPRPEQLTMLAHSLAMLWLLRDNYTKALEYGKKAEVLIQGVK 331          
BLAST of Zinc finger MYND domain-containing protein 12 vs. Ensembl Zebrafish
Match: egln1b (egl-9 family hypoxia-inducible factor 1b [Source:ZFIN;Acc:ZDB-GENE-040718-338])

HSP 1 Score: 49.2914 bits (116), Expect = 2.744e-6
Identity = 24/59 (40.68%), Postives = 35/59 (59.32%), Query Frame = 1
Query:  100 LCELCQR-PAFLQCTLCKVTYYCSVEHQRADWISIHDKICSSVEALKRNIPFIKTEEER 273
             CELC +    ++C  C+ ++YCS EHQR DW   H ++C   EA K+  P  + EEE+
Sbjct:   17 FCELCGKMENLMKCGRCRSSFYCSKEHQRQDW-KKHKRVCK--EADKQQQPVGEEEEEQ 72          
BLAST of Zinc finger MYND domain-containing protein 12 vs. Ensembl Zebrafish
Match: egln1b (egl-9 family hypoxia-inducible factor 1b [Source:ZFIN;Acc:ZDB-GENE-040718-338])

HSP 1 Score: 48.9062 bits (115), Expect = 5.934e-6
Identity = 24/59 (40.68%), Postives = 35/59 (59.32%), Query Frame = 1
Query:  100 LCELCQR-PAFLQCTLCKVTYYCSVEHQRADWISIHDKICSSVEALKRNIPFIKTEEER 273
             CELC +    ++C  C+ ++YCS EHQR DW   H ++C   EA K+  P  + EEE+
Sbjct:   17 FCELCGKMENLMKCGRCRSSFYCSKEHQRQDW-KKHKRVCK--EADKQQQPVGEEEEEQ 72          
BLAST of Zinc finger MYND domain-containing protein 12 vs. Ensembl Xenopus
Match: pygl (phosphorylase, glycogen, liver [Source:Xenbase;Acc:XB-GENE-478383])

HSP 1 Score: 306.605 bits (784), Expect = 5.900e-101
Identity = 153/329 (46.50%), Postives = 220/329 (66.87%), Query Frame = 1
Query:   76 ANPKGVDLLCELCQRPAFLQCTLCKVTYYCSVEHQRADWISIHDKICSSVEALKRNIPFIKTEEERRNRKDEVHKKLGKMIEITRTIGKKLLFQGKHEQAVPTALQCLKFSIEVYGLASVELVPAYLILSEASIGLNRLPQAEEYLAQAQWTVLKSPDCPKSIRSQLHRKLGLLYSAKGDANAALENLAHDIFYSSTEYGTDNVLTSGGYYLMAEVFMKQNRMDIADDLLTRVCTIWMEFLKDIVSSLTFKPEIPEGIGEVVAEITQVEK--QTLDEAQEAEAIKVLNSIYSIRRTQLNCKPFAKAISAL-VLSMLYFILNDKSRAEDF 1053
            +NPKGV L CELC  PA LQC+ CKVTYYC  +HQ+ADW+SIH+KIC  +  L+   PF  + EER +  +++  +   +I++T    +K L+ G+H   +P A+  L F+I+V+GLA+VELVPAYLIL+EA+IGL  LPQAEEYL+QA WTVLK+ DC  +IRS+LHR LGLLYSAKG+   +L + ++D++++S   GT+++  +GGY+ MA +F +QN+MDIAD L T V  IW   L  +++           + E    ++ +EK  + LDE QEAEA+++L++I  IR       P AK +  L  L+ML+FI  D  +AE+F
Sbjct:   39 SNPKGVKLECELCNSPAHLQCSACKVTYYCDSDHQQADWVSIHEKICQLLIPLRIAQPFSSSAEERSHSLEQLLLRKKHLIDLTLKEAQKHLYGGRHADVIPAAMHSLSFTIDVFGLATVELVPAYLILAEANIGLGHLPQAEEYLSQAYWTVLKTTDCSNAIRSKLHRNLGLLYSAKGEFEESLRHFSNDVYFASETAGTNHMSVTGGYFHMANIFFRQNKMDIADSLYTEVTDIWHAHLSKLLNV---------HVNESSRSMSSLEKDQENLDENQEAEALQILSAICDIREQAPKKDP-AKIMHILHTLTMLHFIAMDWPKAEEF 357          
BLAST of Zinc finger MYND domain-containing protein 12 vs. Ensembl Mouse
Match: Zmynd12 (zinc finger, MYND domain containing 12 [Source:MGI Symbol;Acc:MGI:2140259])

HSP 1 Score: 291.197 bits (744), Expect = 1.950e-95
Identity = 147/327 (44.95%), Postives = 213/327 (65.14%), Query Frame = 1
Query:   76 ANPKGVDLLCELCQRPAFLQCTLCKVTYYCSVEHQRADWISIHDKICSSVEALKRNIPFIKTEEERRNRKDEVHKKLGKMIEITRTIGKKLLFQGKHEQAVPTALQCLKFSIEVYGLASVELVPAYLILSEASIGLNRLPQAEEYLAQAQWTVLKSPDCPKSIRSQLHRKLGLLYSAKGDANAALENLAHDIFYSSTEYGTDNVLTSGGYYLMAEVFMKQNRMDIADDLLTRVCTIWMEFLKDIVSS-LTFKPEIPEGIGEVVAEITQVEKQTLDEAQEAEAIKVLNSIYSIRRTQLNCKPFAKAISALVLSMLYFILNDKSRAEDF 1053
            A PKG  L CE+C+ PA   CT C VTYYC   HQ+ADW SIH KIC  +  L+  +PF  +EEER++   ++ ++   +IE   T+ +K LF+G+HE AVP AL  L+F + V+GL+SVELVPAYL+L+EAS+GL R+ QAEEYL+QAQWTVLKS DC  +  S LHR LGLLY AK + + A  +LA+DI+++S  YGT+++ TSGGY+ +A +F    +M++AD L T+V  IW  +L     + L  + +  + +G+       V    LDEAQEAEAI++L S   I+ +     P    +    LS+LY+++ + S+A+++
Sbjct:    8 AVPKGRRLSCEVCEAPAERMCTACTVTYYCGPVHQKADWDSIHAKICQLLIPLRTTMPFYNSEEERQHGLQQLQRRQKHLIEFCYTVAQKYLFEGRHEDAVPAALHSLRFRMNVHGLSSVELVPAYLLLAEASLGLGRIVQAEEYLSQAQWTVLKSTDCSNATHSLLHRNLGLLYIAKKNLDEARYHLANDIYFASCAYGTEDIRTSGGYFHLANIFYGLKKMELADTLYTKVSEIWYTYLNSHYQALLEARSQQTDLLGKQF-----VNDTGLDEAQEAEAIRILTSTLIIQESTSTKAPQKSILILKTLSILYYLMLECSKAKEY 329          
BLAST of Zinc finger MYND domain-containing protein 12 vs. UniProt/SwissProt
Match: sp|Q9H0C1|ZMY12_HUMAN (Zinc finger MYND domain-containing protein 12 OS=Homo sapiens OX=9606 GN=ZMYND12 PE=1 SV=3)

HSP 1 Score: 299.671 bits (766), Expect = 5.168e-98
Identity = 151/328 (46.04%), Postives = 218/328 (66.46%), Query Frame = 1
Query:   76 ANPKGVDLLCELCQRPAFLQCTLCKVTYYCSVEHQRADWISIHDKICSSVEALKRNIPFIKTEEERRNRKDEVHKKLGKMIEITRTIGKKLLFQGKHEQAVPTALQCLKFSIEVYGLASVELVPAYLILSEASIGLNRLPQAEEYLAQAQWTVLKSPDCPKSIRSQLHRKLGLLYSAKGDANAALENLAHDIFYSSTEYGTDNVLTSGGYYLMAEVFMKQNRMDIADDLLTRVCTIWMEFLKDIVSSLTFKPEIPEG--IGEVVAEITQVEKQTLDEAQEAEAIKVLNSIYSIRRTQLNCKPFAKAISALVLSMLYFILNDKSRAEDF 1053
            A PKG  L CE+C+ PA   C  C VTYYC V HQ+ADW SIH+KIC  +  L+ ++PF  +EEER++   ++ ++   +IE   TI +K LF+GKHE AVP ALQ L+F +++YGL+SVELVPAYL+L+EAS+GL R+ QAEEYL QAQWTVLKS DC  +  S LHR LGLLY AK +   A  +LA+DI+++S  +GT+++ TSGGY+ +A +F    ++D+AD L T+V  IW  +L +    L+ +  I +   +G++    T      LDEAQEAEAI++L SI +IR +  +  P        +L M Y+++ + S+A+++
Sbjct:    8 AVPKGRRLCCEVCEAPAERVCAACTVTYYCGVVHQKADWDSIHEKICQLLIPLRTSMPFYNSEEERQHGLQQLQQRQKYLIEFCYTIAQKYLFEGKHEDAVPAALQSLRFRVKLYGLSSVELVPAYLLLAEASLGLGRIVQAEEYLFQAQWTVLKSTDCSNATHSLLHRNLGLLYIAKKNYEEARYHLANDIYFASCAFGTEDIRTSGGYFHLANIFYDLKKLDLADTLYTKVSEIWHAYLNNHYQVLS-QAHIQQMDLLGKLFENDT-----GLDEAQEAEAIRILTSILNIRESTSDKAPQKTIFVLKILVMFYYLMMNSSKAQEY 329          
BLAST of Zinc finger MYND domain-containing protein 12 vs. TrEMBL
Match: A0A1S3J1M0 (zinc finger MYND domain-containing protein 12 OS=Lingula unguis OX=7574 GN=LOC106169409 PE=4 SV=1)

HSP 1 Score: 401.364 bits (1030), Expect = 2.713e-135
Identity = 187/326 (57.36%), Postives = 250/326 (76.69%), Query Frame = 1
Query:   76 ANPKGVDLLCELCQRPAFLQCTLCKVTYYCSVEHQRADWISIHDKICSSVEALKRNIPFIKTEEERRNRKDEVHKKLGKMIEITRTIGKKLLFQGKHEQAVPTALQCLKFSIEVYGLASVELVPAYLILSEASIGLNRLPQAEEYLAQAQWTVLKSPDCPKSIRSQLHRKLGLLYSAKGDANAALENLAHDIFYSSTEYGTDNVLTSGGYYLMAEVFMKQNRMDIADDLLTRVCTIWMEFLKDIVSSLTFKPEIPEGIGEVVAEITQVEKQTLDEAQEAEAIKVLNSIYSIRRTQLNCKPFAKAISALVLSMLYFILNDKSRAEDF 1053
            ANPKGV L+CELCQ+PAF+QCT C+VTYYC VEHQ+ADW+ IH+KIC  +  L+  IPF+ ++EER++RKD++ ++   MI++TRT G+KLLF+G+HEQAVP A+Q L+F+IEV+GLAS+ELVP+YLIL EASIGL RL QAEEYL QAQWTV+K+P+C  +I+S+L+R LGLLY+AKG+   +L  LA DIF++S E+  D++ TSGGY+ MA VF +QNRM++AD L  RV   W ++L+ IVS  T  P    GIG +  EI Q E++ LDEAQEAEA +VLN+IY IR  Q N KP   A     L+MLYFIL++  +A+++
Sbjct:    7 ANPKGVKLVCELCQKPAFIQCTKCRVTYYCGVEHQKADWLGIHEKICQLLIPLRTPIPFLASDEERQHRKDQLLQRQRHMIDLTRTTGQKLLFEGRHEQAVPAAMQSLRFAIEVHGLASIELVPSYLILGEASIGLGRLSQAEEYLMQAQWTVVKTPECSDAIKSKLYRNLGLLYAAKGEYEESLRQLADDIFHASMEFSPDDIRTSGGYFHMANVFFRQNRMEVADSLYARVTDSWYDYLQKIVSVRTATPIDTTGIGAIAMEINQEEEEGLDEAQEAEAKQVLNAIYDIRDQQSNKKPEIVAKICHALAMLYFILHEVEKAKEY 332          
BLAST of Zinc finger MYND domain-containing protein 12 vs. TrEMBL
Match: A0A1S3J4B7 (zinc finger MYND domain-containing protein 12-like OS=Lingula unguis OX=7574 GN=LOC106170089 PE=4 SV=1)

HSP 1 Score: 400.593 bits (1028), Expect = 4.197e-135
Identity = 187/326 (57.36%), Postives = 250/326 (76.69%), Query Frame = 1
Query:   76 ANPKGVDLLCELCQRPAFLQCTLCKVTYYCSVEHQRADWISIHDKICSSVEALKRNIPFIKTEEERRNRKDEVHKKLGKMIEITRTIGKKLLFQGKHEQAVPTALQCLKFSIEVYGLASVELVPAYLILSEASIGLNRLPQAEEYLAQAQWTVLKSPDCPKSIRSQLHRKLGLLYSAKGDANAALENLAHDIFYSSTEYGTDNVLTSGGYYLMAEVFMKQNRMDIADDLLTRVCTIWMEFLKDIVSSLTFKPEIPEGIGEVVAEITQVEKQTLDEAQEAEAIKVLNSIYSIRRTQLNCKPFAKAISALVLSMLYFILNDKSRAEDF 1053
            ANPKGV L+CELCQ+PAF+QCT C+VTYYC VEHQ+ADW+ IH+KIC  +  L+  IPF+ ++EER++RKD++ ++   MI++TRT G+KLLF+G+HEQAVP A+Q L+F+IEV+GLAS+ELVP+YLIL EASIGL RL QAEEYL QAQWTV+K+P+C  +I+S+L+R LGLLY+AKG+   +L  LA DIF++S E+  D++ TSGGY+ MA VF +QNRM++AD L  RV   W ++L+ IVS  T  P    GIG +  EI Q E++ LDEAQEAEA +VLN+IY IR  Q N KP   A     L+MLYFIL++  +A+++
Sbjct:    7 ANPKGVKLVCELCQKPAFIQCTKCRVTYYCGVEHQKADWLGIHEKICQLLIPLRTPIPFLASDEERQHRKDQLLQRQRHMIDLTRTTGQKLLFEGRHEQAVPAAMQSLRFAIEVHGLASIELVPSYLILGEASIGLGRLSQAEEYLMQAQWTVVKTPECSDAIKSKLYRNLGLLYAAKGEYEESLRQLADDIFHASMEFSPDDIRTSGGYFHMANVFFRQNRMEVADSLYARVTDSWYDYLQKIVSVRTATPIDTTGIGAIAMEINQEEEEGLDEAQEAEAKQVLNAIYDIRDQQSNKKPEIVAKICHALAMLYFILHEVEKAKEY 332          
BLAST of Zinc finger MYND domain-containing protein 12 vs. TrEMBL
Match: K1PK64 (Zinc finger MYND domain-containing protein 12 OS=Crassostrea gigas OX=29159 GN=CGI_10014058 PE=4 SV=1)

HSP 1 Score: 397.512 bits (1020), Expect = 6.605e-134
Identity = 193/353 (54.67%), Postives = 261/353 (73.94%), Query Frame = 1
Query:   76 ANPKGVDLLCELCQRPAFLQCTLCKVTYYCSVEHQRADWISIHDKICSSVEALKRNIPFIKTEEERRNRKDEVHKKLGKMIEITRTIGKKLLFQGKHEQAVPTALQCLKFSIEVYGLASVELVPAYLILSEASIGLNRLPQAEEYLAQAQWTVLKSPDCPKSIRSQLHRKLGLLYSAKGDANAALENLAHDIFYSSTEYGTDNVLTSGGYYLMAEVFMKQNRMDIADDLLTRVCTIWMEFLKDIVSSLTFKPEIPEGIGEVVAEITQVEKQTLDEAQEAEAIKVLNSIYSIRRTQLNCKPFAKAISALVLSMLYFILNDKSRAEDFLAESDAATCGIELNSLLHVVDQMKSVL 1134
            ANPKG+ L+CELCQ+PA++QCT C+VTYYC VEHQ+ADW+ IH+KIC S+ AL++  PF+ +EEER+ R+ ++  K   MI +TRT G+KLLF+G+HEQAVP A+Q L+F+I+V+GLAS+ELVP+YLIL EASIGL RL QAEEYLAQAQWTVLK+P+C  +I+S+L+R LGLLY+AKG+ + AL  LA DI++SS E+GT ++ TSGGY+ MA VF +Q RMD+AD L + V  IW   L  IV   T  P   +GIG ++ E  + E+ +LDEAQEAEAI+VLN+IY +R  Q N KP   A+    L+MLYFIL D  +A++F  ++  A+ G   ++L   V +   +L
Sbjct:    7 ANPKGLKLVCELCQKPAYIQCTKCRVTYYCGVEHQKADWMGIHEKICQSLIALRQAAPFLPSEEERQKREKQLLSKKEHMIVLTRTTGQKLLFEGRHEQAVPAAMQSLRFAIDVHGLASIELVPSYLILGEASIGLGRLNQAEEYLAQAQWTVLKTPECSNAIKSKLYRNLGLLYAAKGEYDEALRQLADDIYHSSEEFGTGDIRTSGGYFHMANVFFRQGRMDVADSLYSEVSNIWYNHLLRIVQLRTKTPATQQGIGPLIPEQLE-EEDSLDEAQEAEAIQVLNAIYDMREHQSNRKPQDLALVCHALAMLYFILYDIQKAKEFGRKAVVASEGDPNDNLSRSVVEFMKIL 358          
BLAST of Zinc finger MYND domain-containing protein 12 vs. TrEMBL
Match: A0A267EH26 (MYND-type domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig008343g1 PE=4 SV=1)

HSP 1 Score: 392.504 bits (1007), Expect = 1.699e-131
Identity = 189/339 (55.75%), Postives = 251/339 (74.04%), Query Frame = 1
Query:   76 ANPKGVDLLCELCQRPAFLQCTLCKVTYYCSVEHQRADWISIHDKICSSVEALKRNIPFIKTEEERRNRKDEVHKKLGKMIEITRTIGKKLLFQGKHEQAVPTALQCLKFSIEVYGLASVELVPAYLILSEASIGLNRLPQAEEYLAQAQWTVLKSPDCPKSIRSQLHRKLGLLYSAKGDANAALENLAHDIFYSSTEYGTDNVLTSGGYYLMAEVFMKQNRMDIADDLLTRVCTIWMEFLKDIVSSLTFKPEIPEGIGEVVAEITQVEKQTLDEAQEAEAIKVLNSIYSI-------------RRTQLNCKPFAKAISALVLSMLYFILNDKSRAEDF 1053
            AN KG DLLCELCQ+PAF+QC+ C+VTYYC  EHQRADWI IH KIC  +  L++ +PF+ +E++RR +++E+ ++  +MI ITRT G+KLLF+   E+AVP ALQ LKF+I+V+G +SVELVP+YLIL EASIGL RL QAEEYL+QAQWTVLK+ +   +I+SQLHR LGLL+SAKGD   ALENLA DIF++S EYGT+++  SGGY+ MA +FM +N+ +IA DL  RV  IW + L  IV ++T  P+IP+G+GEVVAEITQ EK+ LDEAQ+AEA+K+L+SIYS+               +    +    A +AL L MLYF+L D+ +  +F
Sbjct:   16 ANAKGTDLLCELCQKPAFIQCSKCRVTYYCGPEHQRADWIGIHAKICDELAVLRKPVPFLTSEKDRREKREELIQQQLRMIVITRTTGQKLLFENHFEEAVPAALQSLKFAIDVHGSSSVELVPSYLILGEASIGLQRLSQAEEYLSQAQWTVLKTDNPSNAIKSQLHRNLGLLFSAKGDYGRALENLAIDIFHASDEYGTEDIRVSGGYFSMANIFMYKNKQEIAYDLFGRVIDIWYDHLWRIVQAMTAPPDIPDGLGEVVAEITQEEKEHLDEAQQAEALKILHSIYSLLVETSEAVDSGSEAESVWESRRMYTAKTALCLLMLYFVLGDREKIGEF 354          
BLAST of Zinc finger MYND domain-containing protein 12 vs. TrEMBL
Match: A0A210PX77 (Zinc finger MYND domain-containing protein 12 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT21023 PE=4 SV=1)

HSP 1 Score: 389.808 bits (1000), Expect = 8.600e-131
Identity = 188/336 (55.95%), Postives = 257/336 (76.49%), Query Frame = 1
Query:   76 ANPKGVDLLCELCQRPAFLQCTLCKVTYYCSVEHQRADWISIHDKICSSVEALKRNIPFIKTEEERRNRKDEVHKKLGKMIEITRTIGKKLLFQGKHEQAVPTALQCLKFSIEVYGLASVELVPAYLILSEASIGLNRLPQAEEYLAQAQWTVLKSPDCPKSIRSQLHRKLGLLYSAKGDANAALENLAHDIFYSSTEYGTDNVLTSGGYYLMAEVFMKQNRMDIADDLLTRVCTIWMEFLKDIVSSLTFKPEIPEGIGEVVAEITQVEKQTLDEAQEAEAIKVLNSIYSIRRTQLNCKPFAKAISALVLSMLYFILNDKSRAEDFLAESDAATCG 1083
            ANPKGV L CELCQ+PAF+QCT C+VTYYC VEHQ+ADW+ IH+KIC S+  L++  PF+ +EEER+ R + ++ K  +MI++TRT G+KLLF+G+HEQAVP A+Q L+F+I+V+GLAS+ELVP+YLIL EASIGL RL QAEEYLAQAQWT LK+P+C  +I+S+L+R LGLLY+AKG  + +L   A DI+++S ++GTD++ TSGGYY MA VF +Q RMDIAD L  +V  IW + L  IV   T  P++P+GIG V++E +  E+ +LDEAQEAEA++VLN+IY +R  Q N +    A  +  L+MLYFIL D ++A++F  ++  A+ G
Sbjct:    7 ANPKGVKLACELCQKPAFIQCTKCRVTYYCGVEHQKADWMGIHEKICQSLIQLRQASPFLPSEEERQKRINHLNVKKRQMIDLTRTTGQKLLFEGRHEQAVPAAMQSLRFAIDVHGLASIELVPSYLILGEASIGLGRLSQAEEYLAQAQWTALKTPECSNAIKSKLYRNLGLLYAAKGQYDDSLRQHADDIYHASEDFGTDDIRTSGGYYHMANVFFRQGRMDIADTLYRQVAEIWYKHLLQIVKVRTATPDVPKGIGPVISEESLEEEDSLDEAQEAEAVQVLNAIYDMREHQSNRRAQDLAKVSHALAMLYFILMDITKAKEFGRKAVVASEG 342          
BLAST of Zinc finger MYND domain-containing protein 12 vs. Ensembl Cavefish
Match: zmynd12 (zinc finger, MYND-type containing 12 [Source:ZFIN;Acc:ZDB-GENE-041114-133])

HSP 1 Score: 219.55 bits (558), Expect = 1.051e-67
Identity = 115/328 (35.06%), Postives = 202/328 (61.59%), Query Frame = 1
Query:   76 ANPKGVDLLCELCQRPAFLQCTLCKVTYYCSVEHQRADWISIHDKICSSVEALKRNIPFIKTEEERRNRKDEVHKKLGKMIEITRTIGKKLLFQGKHEQAVPTALQCLKFSIEVYGLASVELVPAYLILSEASIGLNRLPQAEEYLAQAQWTVLKSPDCPKSIRSQLHRKLGLLYSAKGDANAALENLAHDIFYSSTEYGTDNVLTSGGYYLMAEVFMKQNRMDIADDLLTRVCTIWMEFLKDIVSSLTFKPE--IPEGIGEVVAEITQVEKQTLDEAQEAEAIKVLNSIYSIRRTQLNCKPFAKAISALVLSMLYFILNDKSRAEDF 1053
            A+PKGV  LCELCQ+PA L+C+ C+VT+YC   HQ+ADW SIH K C  +  ++  +P++  + +R +++    K+L +++E++R   +  + +G++ +++P A   L  +I++YG  +VELVPAYL+L+EA++G   L +A+ YL+QA+WTVLK+PDC +++  +LHR LG L++  G   +AL + A+ ++Y+S E+G ++  T+ GY++MA+VF KQ + DIA  L ++         +     LT+K    + +      AE+ Q+ +  L EA E +  +  +        + +  P A  +S    +ML+F+ ++ S+A +F
Sbjct:    9 ASPKGVKRLCELCQKPAHLRCSHCRVTFYCDAAHQQADWNSIHKKACELLIHIRAPVPYLPLKADRDHQQTLAQKRLEQLMEVSRAEARVQVVEGRYTESLPAAQLSLHCAIDLYGHDAVELVPAYLLLAEANMGSGSLSKAQSYLSQAEWTVLKTPDCSRTVLLELHRNLGRLHTFTGSYQSALLHFANYVYYASEEFGLNSTETARGYFMMADVFGKQEKPDIASSLYSQA--------RHPHRHLTYKCRSVLKDKDKAQCAEVDQMLRVML-EAHEQQQQQQQHQDARAHPARSDSLPQAAVLSH-SRAMLWFLCSNSSKALEF 326          
BLAST of Zinc finger MYND domain-containing protein 12 vs. Ensembl Nematostella
Match: EDO42363 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1R4])

HSP 1 Score: 353.984 bits (907), Expect = 1.324e-120
Identity = 172/326 (52.76%), Postives = 233/326 (71.47%), Query Frame = 1
Query:   76 ANPKGVDLLCELCQRPAFLQCTLCKVTYYCSVEHQRADWISIHDKICSSVEALKRNIPFIKTEEERRNRKDEVHKKLGKMIEITRTIGKKLLFQGKHEQAVPTALQCLKFSIEVYGLASVELVPAYLILSEASIGLNRLPQAEEYLAQAQWTVLKSPDCPKSIRSQLHRKLGLLYSAKGDANAALENLAHDIFYSSTEYGTDNVLTSGGYYLMAEVFMKQNRMDIADDLLTRVCTIWMEFLKDIVSSLTFKPEIPEGIGEVVAEITQVEKQTLDEAQEAEAIKVLNSIYSIRRTQLNCKPFAKAISALVLSMLYFILNDKSRAEDF 1053
            ANPKGV L+CELCQ+PAF+QCT C+VTYYC  EHQRADW+ IH+KIC  + AL+  IPF+ +E+ER++RK +   +  +MI++ RT G+KLLF+GK+++AVP ALQ LKFSI++YGL+S+ELVP+YLIL EASIGL +L QAEEYLAQA+WT LK+P C  +I+S+L+R LGLL +AKG+ + AL  LA DI++SS ++GTD++ TSGGY+ MA VF +QN++D+A  L  +V  IW E L  +V   T  P  P GIG             LDEAQEAEAI+V+++I  +R  Q    P         ++ML F+L +  +A DF
Sbjct:    8 ANPKGVKLVCELCQKPAFVQCTDCRVTYYCGPEHQRADWLGIHEKICQLLMALRSPIPFLGSEDERQHRKQQQIIRQKQMIDLCRTEGQKLLFEGKYDRAVPAALQSLKFSIDIYGLSSIELVPSYLILGEASIGLGKLSQAEEYLAQAEWTALKTPGCDNAIKSRLYRNLGLLNAAKGNFSDALTLLADDIYHSSLQHGTDDIHTSGGYFHMANVFNRQNKLDVAFSLYNQVTDIWYEHLSKLVGQRTQTPAKPSGIGPAFNSGIPTGFDVLDEAQEAEAIQVIHAILELREQQSVQTPSVMCKIYFTVAMLQFVLGNMQKARDF 333          
BLAST of Zinc finger MYND domain-containing protein 12 vs. Ensembl Medaka
Match: ENSORLT00000005859.2 (pep primary_assembly:ASM223467v1:7:8763134:8770695:-1 gene:ENSORLG00000004657.2 transcript:ENSORLT00000005859.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 171.014 bits (432), Expect = 2.065e-49
Identity = 92/258 (35.66%), Postives = 150/258 (58.14%), Query Frame = 1
Query:   76 ANPKGV----DLLCELCQRPAFLQCTLCKVTYYCSV-------EHQRADWISIHDKICSSVEALKRNIPFIKTEEERRNRKDEVHKKLGKMIEITRTIGKKLLFQGKHEQAVPTALQCLKFSIEVYGLASVELVPAYLILSEASIGLNRLPQAEEYLAQAQWTVLKSPDCPKSIRSQLHRKLGLLYSAKGDANAALENLAHD--IFYSSTEYGTDNVLTSGGYYLMAEVFMKQNRMDIADDLLTRVCTIWMEFLKDIV 810
            +N  G+    + +CELCQ PA LQC + +VT+YC+V       EHQRADW+ IH++I      L   IP +    E    +         +IEI   + +  LF+GKH++A+P AL CL+++ +V+G  SV    A+L+L+EA+IGL  L  A E L+QA+W +L++P+C  S+  +L+R  G L++A G+   A    A+D  IF+++ E+G ++ +T+G  +L+ +VF K  +  +   L   V  IW + L  ++
Sbjct:    5 SNSSGISQRNEKVCELCQSPACLQCAMWQVTFYCTVFCHCTHAEHQRADWVGIHERI----SKLFVPIPIVVYFHELFRLE---------LIEICTLVVQSKLFEGKHQEALPAALLCLRYTEDVHGPQSVHQAHAFLLLAEANIGLGNLALAAELLSQAEWVLLETPECRNSLLQRLNRNFGCLHAATGNLEDARFYFANDVNIFFATVEFGVNSTVTAGSLFLVVDVFAKMKKTVMTRSLYQEVARIWYDHLTKLL 249          
BLAST of Zinc finger MYND domain-containing protein 12 vs. Planmine SMEST
Match: SMESG000023516.1 (SMESG000023516.1)

HSP 1 Score: 729.169 bits (1881), Expect = 0.000e+0
Identity = 353/354 (99.72%), Postives = 353/354 (99.72%), Query Frame = 1
Query:   76 ANPKGVDLLCELCQRPAFLQCTLCKVTYYCSVEHQRADWISIHDKICSSVEALKRNIPFIKTEEERRNRKDEVHKKLGKMIEITRTIGKKLLFQGKHEQAVPTALQCLKFSIEVYGLASVELVPAYLILSEASIGLNRLPQAEEYLAQAQWTVLKSPDCPKSIRSQLHRKLGLLYSAKGDANAALENLAHDIFYSSTEYGTDNVLTSGGYYLMAEVFMKQNRMDIADDLLTRVCTIWMEFLKDIVSSLTFKPEIPEGIGEVVAEITQVEKQTLDEAQEAEAIKVLNSIYSIRRTQLNCKPFAKAISALVLSMLYFILNDKSRAEDFLAESDAATCGIELNSLLHVVDQMKSVLS 1137
            ANPKGVDLLCELCQRPAFLQCTLCKVTYYCSVEHQRADWISIHDKICSSVEALKRNIPFIKTEEERRNRKDEVHKKLGKMIEITRTIGKKLLFQGKHEQAVPTALQCLKFSIEVYGLASVELVPAYLILSEASIGLNRLPQAEEYLAQAQWTVLKSPDCPKSIRSQLHRKLGLLYSAKGDANAALENLAHDIFYSSTEYGTDNVLTSGGYYLMAEVFMKQNRMDIADDLLTRVCTIWMEFLKDIVSSLTFKPEIPEGIGEVVAEITQVEKQTLDEAQEAEAIKVLNSIYSIRRTQLNCKPFAKAISALVLSMLYFILNDKSRAEDFLAESDAA CGIELNSLLHVVDQMKSVLS
Sbjct:   14 ANPKGVDLLCELCQRPAFLQCTLCKVTYYCSVEHQRADWISIHDKICSSVEALKRNIPFIKTEEERRNRKDEVHKKLGKMIEITRTIGKKLLFQGKHEQAVPTALQCLKFSIEVYGLASVELVPAYLILSEASIGLNRLPQAEEYLAQAQWTVLKSPDCPKSIRSQLHRKLGLLYSAKGDANAALENLAHDIFYSSTEYGTDNVLTSGGYYLMAEVFMKQNRMDIADDLLTRVCTIWMEFLKDIVSSLTFKPEIPEGIGEVVAEITQVEKQTLDEAQEAEAIKVLNSIYSIRRTQLNCKPFAKAISALVLSMLYFILNDKSRAEDFLAESDAAACGIELNSLLHVVDQMKSVLS 367          
The following BLAST results are available for this feature:
BLAST of Zinc finger MYND domain-containing protein 12 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ZMYND121.076e-9846.04zinc finger MYND-type containing 12 [Source:HGNC S... [more]
ZMYND125.591e-1847.37zinc finger MYND-type containing 12 [Source:HGNC S... [more]
back to top
BLAST of Zinc finger MYND domain-containing protein 12 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger MYND domain-containing protein 12 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger MYND domain-containing protein 12 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
zmynd123.664e-7435.80zinc finger, MYND-type containing 12 [Source:ZFIN;... [more]
zmynd122.820e-7335.21zinc finger, MYND-type containing 12 [Source:ZFIN;... [more]
egln1b2.744e-640.68egl-9 family hypoxia-inducible factor 1b [Source:Z... [more]
egln1b5.934e-640.68egl-9 family hypoxia-inducible factor 1b [Source:Z... [more]
back to top
BLAST of Zinc finger MYND domain-containing protein 12 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
pygl5.900e-10146.50phosphorylase, glycogen, liver [Source:Xenbase;Acc... [more]
back to top
BLAST of Zinc finger MYND domain-containing protein 12 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Zmynd121.950e-9544.95zinc finger, MYND domain containing 12 [Source:MGI... [more]
back to top
BLAST of Zinc finger MYND domain-containing protein 12 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|Q9H0C1|ZMY12_HUMAN5.168e-9846.04Zinc finger MYND domain-containing protein 12 OS=H... [more]
back to top
BLAST of Zinc finger MYND domain-containing protein 12 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3J1M02.713e-13557.36zinc finger MYND domain-containing protein 12 OS=L... [more]
A0A1S3J4B74.197e-13557.36zinc finger MYND domain-containing protein 12-like... [more]
K1PK646.605e-13454.67Zinc finger MYND domain-containing protein 12 OS=C... [more]
A0A267EH261.699e-13155.75MYND-type domain-containing protein OS=Macrostomum... [more]
A0A210PX778.600e-13155.95Zinc finger MYND domain-containing protein 12 OS=M... [more]
back to top
BLAST of Zinc finger MYND domain-containing protein 12 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
zmynd121.051e-6735.06zinc finger, MYND-type containing 12 [Source:ZFIN;... [more]
back to top
BLAST of Zinc finger MYND domain-containing protein 12 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger MYND domain-containing protein 12 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger MYND domain-containing protein 12 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO423631.324e-12052.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Zinc finger MYND domain-containing protein 12 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSORLT00000005859.22.065e-4935.66pep primary_assembly:ASM223467v1:7:8763134:8770695... [more]
back to top
BLAST of Zinc finger MYND domain-containing protein 12 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000023516.10.000e+099.72SMESG000023516.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012107 ID=SMED30012107|Name=Zinc finger MYND domain-containing protein 12|organism=Schmidtea mediterranea sexual|type=transcript|length=1207bp
CCATAGCAATAATTAAGCGAAATATTAAATTTCACAATGAGTTTACCTCC
TCCTGGTTATCCTTTATATCCATTGGCTAATCCTAAAGGAGTAGATTTGT
TATGTGAATTATGTCAAAGACCTGCATTTTTGCAATGCACTCTATGCAAA
GTTACTTATTACTGTAGTGTAGAACATCAGAGGGCTGACTGGATAAGTAT
TCACGATAAAATCTGTTCATCAGTTGAAGCCCTAAAAAGAAATATTCCGT
TTATTAAAACCGAAGAAGAAAGACGTAATAGAAAAGATGAAGTTCATAAA
AAATTAGGGAAAATGATTGAAATCACCAGAACAATAGGAAAGAAATTATT
GTTTCAAGGAAAACATGAACAAGCAGTTCCAACAGCCCTTCAGTGTCTAA
AATTTAGTATTGAAGTCTATGGACTTGCGAGTGTTGAATTAGTACCTGCC
TATCTGATTCTTAGTGAAGCAAGCATTGGATTAAACAGACTTCCACAAGC
CGAAGAATACCTTGCTCAAGCACAATGGACTGTGCTAAAGAGTCCTGATT
GTCCGAAATCTATTAGATCACAGCTCCATAGAAAACTTGGTTTGTTATAT
TCAGCAAAAGGAGATGCGAATGCCGCTTTAGAAAATTTAGCTCACGATAT
ATTTTACTCTTCCACCGAATACGGAACTGACAACGTTCTGACATCTGGTG
GTTACTACTTAATGGCAGAAGTATTTATGAAGCAAAACAGAATGGACATT
GCCGATGATTTACTGACAAGAGTTTGCACTATTTGGATGGAATTTCTAAA
GGATATAGTTTCCAGCTTAACTTTTAAACCCGAAATTCCCGAAGGAATCG
GAGAGGTTGTGGCAGAAATCACTCAGGTTGAGAAGCAAACTTTAGATGAA
GCTCAAGAAGCTGAAGCCATCAAAGTTCTCAACTCAATTTATTCTATACG
ACGAACCCAGCTCAATTGCAAGCCATTTGCAAAAGCAATCTCTGCTCTGG
TTTTATCAATGTTATATTTTATTTTGAATGATAAAAGCCGGGCTGAAGAT
TTTTTGGCGGAATCCGATGCGGCGACGTGTGGAATTGAATTGAACTCTTT
ATTACATGTAGTAGATCAAATGAAATCTGTTTTATCTTGATTTTAATTTT
ATTTCTTCTTTGAAATTAAGCAAGGACACCATTTATTCTTTATTTCTCTA
ATTGAAA
back to top

protein sequence of SMED30012107-orf-1

>SMED30012107-orf-1 ID=SMED30012107-orf-1|Name=SMED30012107-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=368bp
MSLPPPGYPLYPLANPKGVDLLCELCQRPAFLQCTLCKVTYYCSVEHQRA
DWISIHDKICSSVEALKRNIPFIKTEEERRNRKDEVHKKLGKMIEITRTI
GKKLLFQGKHEQAVPTALQCLKFSIEVYGLASVELVPAYLILSEASIGLN
RLPQAEEYLAQAQWTVLKSPDCPKSIRSQLHRKLGLLYSAKGDANAALEN
LAHDIFYSSTEYGTDNVLTSGGYYLMAEVFMKQNRMDIADDLLTRVCTIW
MEFLKDIVSSLTFKPEIPEGIGEVVAEITQVEKQTLDEAQEAEAIKVLNS
IYSIRRTQLNCKPFAKAISALVLSMLYFILNDKSRAEDFLAESDAATCGI
ELNSLLHVVDQMKSVLS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
GO:0005515protein binding
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction
GO:0007186G-protein coupled receptor signaling pathway
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
GO:0005622intracellular
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR011990TPR-like_helical_dom_sf
IPR002893Znf_MYND
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002893Zinc finger, MYND-typePFAMPF01753zf-MYNDcoord: 23..60
e-value: 1.1E-9
score: 38.2
IPR002893Zinc finger, MYND-typePROSITEPS01360ZF_MYND_1coord: 23..60
IPR002893Zinc finger, MYND-typePROSITEPS50865ZF_MYND_2coord: 23..60
score: 10.332
NoneNo IPR availableGENE3DG3DSA:3.30.60.180coord: 18..62
e-value: 1.1E-12
score: 49.5
NoneNo IPR availablePANTHERPTHR46533FAMILY NOT NAMEDcoord: 9..347
NoneNo IPR availableSUPERFAMILYSSF144232HIT/MYND zinc finger-likecoord: 20..64
IPR011990Tetratricopeptide-like helical domain superfamilySUPERFAMILYSSF48452TPR-likecoord: 91..201