SMED30012106

Overview
NameSMED30012106
Smed IDSMED30012106
Length (bp)1184
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30012106 (SMED30012106) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30012106 (SMED30012106) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30012106 (SMED30012106) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30012106 (SMED30012106) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012106

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30012106SMESG000066072.1 SmedASXL_001511SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30012106SMESG000066072.1 dd_Smed_v6_54079_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30012106 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.014127:12216..13384 +5647
Homology
BLAST of SMED30012106 vs. Ensembl Human
Match: NPY2R (neuropeptide Y receptor Y2 [Source:HGNC Symbol;Acc:HGNC:7957])

HSP 1 Score: 100.138 bits (248), Expect = 9.256e-43
Identity = 56/163 (34.36%), Postives = 98/163 (60.12%), Query Frame = -2
Query:  647 FMAENQTQGIILLNTSKVLNSNTDLI-LKTFIISSYSMIFVLGLSGNALVIFVILRNKAMYTVTNFFITNLAASDILMCIVAVPFTPIALYLENWTLPELVCKLLPMTMAISVYVSTLTSLVISIDRYFVIVYPFKVRMKLSFCRFLLVLIWGLAILASFPLA 1132
            +  +   +G ++ +    L  +T LI ++  +I +Y  I +LG+ GN+LVI V+++ K+M TVTNFFI NLA +D+L+  + +PFT     +  W +  ++C L+P    ++V VST+T  VI++DR+  IVY  + ++       ++ L WG++ L + PLA
Sbjct:   22 YGPQTTPRGELVPDPEPELIDSTKLIEVQVVLILAYCSIILLGVIGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGEWKMGPVLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKRISFLIIGLAWGISALLASPLA 184          

HSP 2 Score: 93.9745 bits (232), Expect = 9.256e-43
Identity = 64/175 (36.57%), Postives = 95/175 (54.29%), Query Frame = -3
Query:  103 NISTCHEKWPDNR---WKGIYTVSSFIVQFVLPTIAISFCYFQISRTLQSRCNRXXXXXXXXXSRVLNDI--KRKRKTNKMLIAMVVIFIVCWIPLNVLWIITDLIYSDEQSKLNTNLYFTTIFFICHLIAMCSALYNPFLYGWMNENFRQEFCSVFSCWRSRRALLIEQNSTFR 612
             I  C EKWP      +  +Y++SS ++ +VLP   ISF Y +I   L++  +   +          ND   +R++KT KML+ +VV+F V W+PL+   +  D+   D Q  L+   Y   IF + H+IAMCS   NP LYGWMN N+R+ F S F C +   A+  E + TF+
Sbjct:  199 EIVACTEKWPGEEKSIYGTVYSLSSLLILYVLPLGIISFSYTRIWSKLKNHVSPGAA----------NDHYHQRRQKTTKMLVCVVVVFAVSWLPLHAFQLAVDI---DSQV-LDLKEY-KLIFTVFHIIAMCSTFANPLLYGWMNSNYRKAFLSAFRCEQRLDAIHSEVSVTFK 358          
BLAST of SMED30012106 vs. Ensembl Human
Match: NPY2R (neuropeptide Y receptor Y2 [Source:HGNC Symbol;Acc:HGNC:7957])

HSP 1 Score: 100.138 bits (248), Expect = 9.256e-43
Identity = 56/163 (34.36%), Postives = 98/163 (60.12%), Query Frame = -2
Query:  647 FMAENQTQGIILLNTSKVLNSNTDLI-LKTFIISSYSMIFVLGLSGNALVIFVILRNKAMYTVTNFFITNLAASDILMCIVAVPFTPIALYLENWTLPELVCKLLPMTMAISVYVSTLTSLVISIDRYFVIVYPFKVRMKLSFCRFLLVLIWGLAILASFPLA 1132
            +  +   +G ++ +    L  +T LI ++  +I +Y  I +LG+ GN+LVI V+++ K+M TVTNFFI NLA +D+L+  + +PFT     +  W +  ++C L+P    ++V VST+T  VI++DR+  IVY  + ++       ++ L WG++ L + PLA
Sbjct:   22 YGPQTTPRGELVPDPEPELIDSTKLIEVQVVLILAYCSIILLGVIGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGEWKMGPVLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKRISFLIIGLAWGISALLASPLA 184          

HSP 2 Score: 93.9745 bits (232), Expect = 9.256e-43
Identity = 64/175 (36.57%), Postives = 95/175 (54.29%), Query Frame = -3
Query:  103 NISTCHEKWPDNR---WKGIYTVSSFIVQFVLPTIAISFCYFQISRTLQSRCNRXXXXXXXXXSRVLNDI--KRKRKTNKMLIAMVVIFIVCWIPLNVLWIITDLIYSDEQSKLNTNLYFTTIFFICHLIAMCSALYNPFLYGWMNENFRQEFCSVFSCWRSRRALLIEQNSTFR 612
             I  C EKWP      +  +Y++SS ++ +VLP   ISF Y +I   L++  +   +          ND   +R++KT KML+ +VV+F V W+PL+   +  D+   D Q  L+   Y   IF + H+IAMCS   NP LYGWMN N+R+ F S F C +   A+  E + TF+
Sbjct:  199 EIVACTEKWPGEEKSIYGTVYSLSSLLILYVLPLGIISFSYTRIWSKLKNHVSPGAA----------NDHYHQRRQKTTKMLVCVVVVFAVSWLPLHAFQLAVDI---DSQV-LDLKEY-KLIFTVFHIIAMCSTFANPLLYGWMNSNYRKAFLSAFRCEQRLDAIHSEVSVTFK 358          
BLAST of SMED30012106 vs. Ensembl Human
Match: NPFFR2 (neuropeptide FF receptor 2 [Source:HGNC Symbol;Acc:HGNC:4525])

HSP 1 Score: 95.1301 bits (235), Expect = 5.931e-33
Identity = 57/147 (38.78%), Postives = 86/147 (58.50%), Query Frame = -2
Query:  629 FIISSYSMIFVLGLSGNALVIFVILRNKAMYTVTNFFITNLAASDILMCIVAVPFTPIALYLENWTLPELVCKLLPMTMAISVYVSTLTSLVISIDRYFVIVYPFKVRMKLSFCRFLLVLIWGLAILASFPLA--------KYHKKR 1045
            FIIS Y +IF L + GN +V F+++RNK M+TVTN FI NLA SD+L+ I  +P T +   +  W     +CK+  +   ISV  S  T + I++DR+  +VYPFK ++ +     ++++IW LAI    P A        KY++ R
Sbjct:   48 FIIS-YFLIFFLCMMGNTVVCFIVMRNKHMHTVTNLFILNLAISDLLVGIFCMPITLLDNIIAGWPFGNTMCKISGLVQGISVAASVFTLVAIAVDRFQCVVYPFKPKLTIKTAFVIIMIIWVLAITIMSPSAVMLHVQEEKYYRVR 193          

HSP 2 Score: 66.2402 bits (160), Expect = 5.931e-33
Identity = 55/198 (27.78%), Postives = 99/198 (50.00%), Query Frame = -3
Query:   22 CHEKWPDNRWKGIYTVSSFIVQFVLPTIAISFCYFQISRTLQSRCNRXXXXXXXXXSRVLNDIKRKRKTNKMLIAMVVIFIVCWIPLNVLWIITDLIYSD-EQSKLNT-NLYFTTIFFICHLIAMCSALYNPFLYGWMNENFRQEFCSVFSCWR-SRRALLIEQNSTFRKNSKKHPISDYHLSLIEAN--KKPHNKLL 600
            C E WP+   + IYT   F   ++ P   I   Y +I  +L         +K +    V++  ++K+K  KML+ + ++FI+ W+PL  L +++D  Y+D   ++L   N+Y   I+   H +A  ++  NP +YG+ NENFR+ F   F      +RA  +E    +   +K H + +    L++ +  + PH + L
Sbjct:  206 CREDWPNQEMRKIYTTVLFANIYLAPLSLIVIMYGRIGISLFRAAVPHTGRKNQEQWHVVS--RKKQKIIKMLLIVALLFILSWLPLWTLMMLSD--YADLSPNELQIINIY---IYPFAHWLAFGNSSVNPIIYGFFNENFRRGFQEAFQLQLCQKRAKPME---AYALKAKSHVLINTSNQLVQESTFQNPHGETL 393          
BLAST of SMED30012106 vs. Ensembl Human
Match: NPFFR2 (neuropeptide FF receptor 2 [Source:HGNC Symbol;Acc:HGNC:4525])

HSP 1 Score: 95.1301 bits (235), Expect = 6.493e-33
Identity = 57/147 (38.78%), Postives = 86/147 (58.50%), Query Frame = -2
Query:  629 FIISSYSMIFVLGLSGNALVIFVILRNKAMYTVTNFFITNLAASDILMCIVAVPFTPIALYLENWTLPELVCKLLPMTMAISVYVSTLTSLVISIDRYFVIVYPFKVRMKLSFCRFLLVLIWGLAILASFPLA--------KYHKKR 1045
            FIIS Y +IF L + GN +V F+++RNK M+TVTN FI NLA SD+L+ I  +P T +   +  W     +CK+  +   ISV  S  T + I++DR+  +VYPFK ++ +     ++++IW LAI    P A        KY++ R
Sbjct:   51 FIIS-YFLIFFLCMMGNTVVCFIVMRNKHMHTVTNLFILNLAISDLLVGIFCMPITLLDNIIAGWPFGNTMCKISGLVQGISVAASVFTLVAIAVDRFQCVVYPFKPKLTIKTAFVIIMIIWVLAITIMSPSAVMLHVQEEKYYRVR 196          

HSP 2 Score: 65.855 bits (159), Expect = 6.493e-33
Identity = 52/196 (26.53%), Postives = 93/196 (47.45%), Query Frame = -3
Query:   22 CHEKWPDNRWKGIYTVSSFIVQFVLPTIAISFCYFQISRTLQSRCNRXXXXXXXXXSRVLNDIKRKRKTNKMLIAMVVIFIVCWIPLNVLWIITDLIYSDEQSKLNTNLYFTTIFFICHLIAMCSALYNPFLYGWMNENFRQEFCSVFSCWR-SRRALLIEQNSTFRKNSKKHPISDYHLSLIEAN--KKPHNKLL 600
            C E WP+   + IYT   F   ++ P   I   Y +I  +L         +K +    V++  ++K+K  KML+ + ++FI+ W+PL  L +++D            N+Y   I+   H +A  ++  NP +YG+ NENFR+ F   F      +RA  +E    +   +K H + +    L++ +  + PH + L
Sbjct:  209 CREDWPNQEMRKIYTTVLFANIYLAPLSLIVIMYGRIGISLFRAAVPHTGRKNQEQWHVVS--RKKQKIIKMLLIVALLFILSWLPLWTLMMLSDYADLSPNELQIINIY---IYPFAHWLAFGNSSVNPIIYGFFNENFRRGFQEAFQLQLCQKRAKPME---AYALKAKSHVLINTSNQLVQESTFQNPHGETL 396          
BLAST of SMED30012106 vs. Ensembl Human
Match: NPFFR2 (neuropeptide FF receptor 2 [Source:HGNC Symbol;Acc:HGNC:4525])

HSP 1 Score: 93.9745 bits (232), Expect = 1.540e-32
Identity = 54/133 (40.60%), Postives = 81/133 (60.90%), Query Frame = -2
Query:  647 FIISSYSMIFVLGLSGNALVIFVILRNKAMYTVTNFFITNLAASDILMCIVAVPFTPIALYLENWTLPELVCKLLPMTMAISVYVSTLTSLVISIDRYFVIVYPFKVRMKLSFCRFLLVLIWGLAILASFPLA 1045
            FIIS Y +IF L + GN +V F+++RNK M+TVTN FI NLA SD+L+ I  +P T +   +  W     +CK+  +   ISV  S  T + I++DR+  +VYPFK ++ +     ++++IW LAI    P A
Sbjct:  150 FIIS-YFLIFFLCMMGNTVVCFIVMRNKHMHTVTNLFILNLAISDLLVGIFCMPITLLDNIIAGWPFGNTMCKISGLVQGISVAASVFTLVAIAVDRFQCVVYPFKPKLTIKTAFVIIMIIWVLAITIMSPSA 281          

HSP 2 Score: 65.855 bits (159), Expect = 1.540e-32
Identity = 52/196 (26.53%), Postives = 93/196 (47.45%), Query Frame = -3
Query:   22 CHEKWPDNRWKGIYTVSSFIVQFVLPTIAISFCYFQISRTLQSRCNRXXXXXXXXXSRVLNDIKRKRKTNKMLIAMVVIFIVCWIPLNVLWIITDLIYSDEQSKLNTNLYFTTIFFICHLIAMCSALYNPFLYGWMNENFRQEFCSVFSCWR-SRRALLIEQNSTFRKNSKKHPISDYHLSLIEAN--KKPHNKLL 600
            C E WP+   + IYT   F   ++ P   I   Y +I  +L         +K +    V++  ++K+K  KML+ + ++FI+ W+PL  L +++D            N+Y   I+   H +A  ++  NP +YG+ NENFR+ F   F      +RA  +E    +   +K H + +    L++ +  + PH + L
Sbjct:  308 CREDWPNQEMRKIYTTVLFANIYLAPLSLIVIMYGRIGISLFRAAVPHTGRKNQEQWHVVS--RKKQKIIKMLLIVALLFILSWLPLWTLMMLSDYADLSPNELQIINIY---IYPFAHWLAFGNSSVNPIIYGFFNENFRRGFQEAFQLQLCQKRAKPME---AYALKAKSHVLINTSNQLVQESTFQNPHGETL 495          
BLAST of SMED30012106 vs. Ensembl Celegans
Match: npr-6 (NeuroPeptide Receptor family [Source:UniProtKB/TrEMBL;Acc:Q20275])

HSP 1 Score: 104.76 bits (260), Expect = 1.117e-44
Identity = 64/195 (32.82%), Postives = 105/195 (53.85%), Query Frame = -3
Query:   52 CHEKWPDNRWKGIYTVSSFIVQFVLPTIAISFCYFQISRTLQSRCNRXXXXXXXXXSRVLNDIKRKRKTNKMLIAMVVIFIVCWIPLNVLWIITDLIYSDEQSKLNTNL--YFTTIFFICHLIAMCSALYNPFLYGWMNENFRQEFCSVFSCWRSRRA------LLIEQNST----FRKNSKKHPISDYHLSLIE 600
            C E W +  ++ I+ +   I+QF+LP + I+  Y +I   L SR +    K         +DIKRK++  +MLI MVVIF +CW P N+L  + DL       KL+  +  YF+ +F   HL++M +  +NP LY +MNE FR+EF  V  C  +RR       ++ E+ +     FR+ ++K  + +  +++I 
Sbjct:  193 CSEDWSNAEFRSIFGIVVMILQFILPFVLIAISYIKIWLFLNSRQSMTERK---------SDIKRKKRLLRMLIVMVVIFAICWFPFNLLNCLRDL-------KLDNFMRGYFSFVFLSVHLMSMTATAWNPILYAFMNETFREEFAKVVPCLFARRPGTGPIRVITERTAMITNPFRRANRKKKVEEQPVTVIS 371          

HSP 2 Score: 94.7449 bits (234), Expect = 1.117e-44
Identity = 57/155 (36.77%), Postives = 88/155 (56.77%), Query Frame = -2
Query:  647 NTSKVLNSNTDL-ILKTFIISSYSMIFVLGLSGNALVIFVILRNKAMYTVTNFFITNLAASDILMCIVAVPFTPIALYLENWTLPELVCKLLPMTMAISVYVSTLTSLVISIDRYFVIVY-----PFKVRMKLSFCRFLLVLIWGLAILASFPLA 1093
            +T K+ N+  ++   + F IS Y  +F++  SGN LV++V++ NK M T+TN FITNLA SDI++   ++  TP    + +W     +C  LP+    S+++ST T   I+IDRY VIV+         RM +  C   +VLIW  ++L   P A
Sbjct:   22 STCKIKNNPMEMEYFRPFFISMYCAVFLVASSGNFLVVYVVMTNKRMQTITNIFITNLAVSDIMVNFTSLWLTPTYTSIGHWIFGGGLCHGLPLFQGTSIFISTWTLTAIAIDRYIVIVHNSSNININDRMSMRSCLSFIVLIWLCSLLLVTPYA 176          
BLAST of SMED30012106 vs. Ensembl Celegans
Match: npr-3 (NeuroPeptide Receptor family [Source:UniProtKB/TrEMBL;Acc:P90745])

HSP 1 Score: 95.5153 bits (236), Expect = 9.319e-36
Identity = 56/171 (32.75%), Postives = 88/171 (51.46%), Query Frame = -3
Query:  109 CHEKWPD----NRWKGI---YTVSSFIVQFVLPTIAISFCYFQISRTLQSRCNRXXXXXXXXXSRVLNDIKRKRKTNKMLIAMVVIFIVCWIPLNVLWIITDLIYSDEQSKLNTNLYFTTIFFICHLIAMCSALYNPFLYGWMNENFRQEFCSVFSCWRSRRALLIEQNST 600
            C E WPD        GI   Y +S  ++QF +P +  S CY+ ISR +  +  R+    I+  S     + RK + N+M+I MVV F++ W+P N + +  DL           + +++T+F +CH+ AMCSA+ NP +Y W N  FRQ   ++F      R +  +  ST
Sbjct:  175 CEENWPDFNPDTGRSGIRRAYGLSVLVLQFGIPALISSICYWMISRVMSDQLARRRGHNIRPESET-KLVNRKTRANRMMIVMVVGFVLAWMPFNAVNLYRDL--------FGISKWYSTVFALCHVCAMCSAVLNPIIYSWFNPQFRQSITTLFKGTDEARLIKKKPQST 336          

HSP 2 Score: 73.9442 bits (180), Expect = 9.319e-36
Identity = 40/132 (30.30%), Postives = 74/132 (56.06%), Query Frame = -2
Query:  635 YSMIFVLGLSGNALVIFVILRNKAMYTVTNFFITNLAASDILMCIVAVPFTPIALYLENWTLPELVCKLLPMTMAISVYVSTLTSLVISIDRYFVIVYPFKVRMKLSFCRFLLVLIWGLAILASFPLAKYHK 1030
            Y +++V  + GN LV++V+  N+   +V   F+  LA SD+LMC+ ++P T I+++   W  P + CKL+ +    +++VS+ T  VI++DR  +I+ P +  +      F++  IW L    + P+  Y  
Sbjct:   32 YLLVWVGAIVGNTLVLYVLTFNQVSLSVRTVFVGCLAGSDLLMCLFSLPITAISIFSRVWVFPAIFCKLIGVFQGGTIFVSSFTLTVIALDRCVLILRPNQEIVNFPRAVFIVFCIWLLGYSLALPVGIYSD 163          
BLAST of SMED30012106 vs. Ensembl Celegans
Match: npr-2 (NeuroPeptide Receptor family [Source:UniProtKB/TrEMBL;Acc:A0A061AKJ8])

HSP 1 Score: 94.7449 bits (234), Expect = 3.881e-35
Identity = 51/178 (28.65%), Postives = 101/178 (56.74%), Query Frame = -2
Query:  641 MAENQTQGIILLNTSKVLNS-----------NTDLILKTFIISSYSM----IFVLGLSGNALVIFVILRNKAMYTVTNFFITNLAASDILMCIVAVPFTPIALYLENWTLPELVCKLLPMTMAISVYVSTLTSLVISIDRYFVIVYPFKVRMKLSFCRFLLVLIWGLAILASFPLAKY 1129
            M +   + +I L++S+++N            + D+  +  ++ ++S+    IF+LG+ GN+ V+++ ++++ + TV N FI NL AS++LMC+ ++P T I    + W     VCKL+P+    S++VST +   I++DRY ++V P K ++       + +LIW ++++   P   Y
Sbjct:   28 MLQEMRRKLIQLHSSQMINETEETCDRYIDKHPDMTNEPTVLVTFSLLYLHIFLLGILGNSAVLYLTMKHRQLQTVQNIFILNLCASNVLMCLTSLPITFITNVYKQWFFSSPVCKLIPLVQGASIFVSTFSLSAIALDRYNLVVRPHKQKLSSRSAMMIALLIWVISVVVCMPYGWY 205          

HSP 2 Score: 72.4034 bits (176), Expect = 3.881e-35
Identity = 54/213 (25.35%), Postives = 88/213 (41.31%), Query Frame = -3
Query:   64 CHEKWPDNRWKGIYTVSSFIVQFVLPTIAISFCYFQISRTLQSR--------------------CNRXXXXXXXXXSRVLNDIKRK---------RKTNKMLIAMVVIFIVCWIPLNVLWIITD----LIYSDEQSKLNTNLYFTTIFFICHLIAMCSALYNPFLYGWMNENFRQEFCSVF-SCWRSRRALLIEQNSTFRKNSKKHPISDYHL 600
            C E WP    +  YT    I QF+ P   ++FCY+ I   L+ R                    C         +   V N ++ K         R+T  +L  MV++F   W+P NV+ ++ +      +SDE S  +T+  +  +    HLI+M + + NPFLY W+N  F++          +S +   I+Q S  R  +   P    +L
Sbjct:  219 CSEHWPLAEVRKGYTFLVLITQFLFPFATMAFCYYNIFSRLRQRVETKLKKLSERSQLLENSTTCGTTNHIVSINAEAVQNGLENKQRLAVLAQQRRTTTILSCMVLLFAFTWLPHNVVTLMIEYDGFFFHSDETSATSTDHTY-IVSMTAHLISMLTNVTNPFLYAWLNPMFKEMLIKTLRGGSKSPKPADIKQTSFIRMPNSGAPSQSSYL 430          
BLAST of SMED30012106 vs. Ensembl Celegans
Match: npr-2 (NeuroPeptide Receptor family [Source:UniProtKB/TrEMBL;Acc:A0A061AKJ8])

HSP 1 Score: 94.7449 bits (234), Expect = 3.916e-35
Identity = 51/178 (28.65%), Postives = 101/178 (56.74%), Query Frame = -2
Query:  641 MAENQTQGIILLNTSKVLNS-----------NTDLILKTFIISSYSM----IFVLGLSGNALVIFVILRNKAMYTVTNFFITNLAASDILMCIVAVPFTPIALYLENWTLPELVCKLLPMTMAISVYVSTLTSLVISIDRYFVIVYPFKVRMKLSFCRFLLVLIWGLAILASFPLAKY 1129
            M +   + +I L++S+++N            + D+  +  ++ ++S+    IF+LG+ GN+ V+++ ++++ + TV N FI NL AS++LMC+ ++P T I    + W     VCKL+P+    S++VST +   I++DRY ++V P K ++       + +LIW ++++   P   Y
Sbjct:   10 MLQEMRRKLIQLHSSQMINETEETCDRYIDKHPDMTNEPTVLVTFSLLYLHIFLLGILGNSAVLYLTMKHRQLQTVQNIFILNLCASNVLMCLTSLPITFITNVYKQWFFSSPVCKLIPLVQGASIFVSTFSLSAIALDRYNLVVRPHKQKLSSRSAMMIALLIWVISVVVCMPYGWY 187          

HSP 2 Score: 72.4034 bits (176), Expect = 3.916e-35
Identity = 54/213 (25.35%), Postives = 88/213 (41.31%), Query Frame = -3
Query:   64 CHEKWPDNRWKGIYTVSSFIVQFVLPTIAISFCYFQISRTLQSR--------------------CNRXXXXXXXXXSRVLNDIKRK---------RKTNKMLIAMVVIFIVCWIPLNVLWIITD----LIYSDEQSKLNTNLYFTTIFFICHLIAMCSALYNPFLYGWMNENFRQEFCSVF-SCWRSRRALLIEQNSTFRKNSKKHPISDYHL 600
            C E WP    +  YT    I QF+ P   ++FCY+ I   L+ R                    C         +   V N ++ K         R+T  +L  MV++F   W+P NV+ ++ +      +SDE S  +T+  +  +    HLI+M + + NPFLY W+N  F++          +S +   I+Q S  R  +   P    +L
Sbjct:  201 CSEHWPLAEVRKGYTFLVLITQFLFPFATMAFCYYNIFSRLRQRVETKLKKLSERSQLLENSTTCGTTNHIVSINAEAVQNGLENKQRLAVLAQQRRTTTILSCMVLLFAFTWLPHNVVTLMIEYDGFFFHSDETSATSTDHTY-IVSMTAHLISMLTNVTNPFLYAWLNPMFKEMLIKTLRGGSKSPKPADIKQTSFIRMPNSGAPSQSSYL 412          
BLAST of SMED30012106 vs. Ensembl Celegans
Match: npr-2 (NeuroPeptide Receptor family [Source:UniProtKB/TrEMBL;Acc:A0A061AKJ8])

HSP 1 Score: 94.7449 bits (234), Expect = 4.858e-35
Identity = 46/153 (30.07%), Postives = 91/153 (59.48%), Query Frame = -2
Query:  641 SKVLNSNTDLILKTFIISSYSM----IFVLGLSGNALVIFVILRNKAMYTVTNFFITNLAASDILMCIVAVPFTPIALYLENWTLPELVCKLLPMTMAISVYVSTLTSLVISIDRYFVIVYPFKVRMKLSFCRFLLVLIWGLAILASFPLAKY 1087
             + ++ + D+  +  ++ ++S+    IF+LG+ GN+ V+++ ++++ + TV N FI NL AS++LMC+ ++P T I    + W     VCKL+P+    S++VST +   I++DRY ++V P K ++       + +LIW ++++   P   Y
Sbjct:   10 DRYIDKHPDMTNEPTVLVTFSLLYLHIFLLGILGNSAVLYLTMKHRQLQTVQNIFILNLCASNVLMCLTSLPITFITNVYKQWFFSSPVCKLIPLVQGASIFVSTFSLSAIALDRYNLVVRPHKQKLSSRSAMMIALLIWVISVVVCMPYGWY 162          

HSP 2 Score: 72.4034 bits (176), Expect = 4.858e-35
Identity = 54/213 (25.35%), Postives = 88/213 (41.31%), Query Frame = -3
Query:   64 CHEKWPDNRWKGIYTVSSFIVQFVLPTIAISFCYFQISRTLQSR--------------------CNRXXXXXXXXXSRVLNDIKRK---------RKTNKMLIAMVVIFIVCWIPLNVLWIITD----LIYSDEQSKLNTNLYFTTIFFICHLIAMCSALYNPFLYGWMNENFRQEFCSVF-SCWRSRRALLIEQNSTFRKNSKKHPISDYHL 600
            C E WP    +  YT    I QF+ P   ++FCY+ I   L+ R                    C         +   V N ++ K         R+T  +L  MV++F   W+P NV+ ++ +      +SDE S  +T+  +  +    HLI+M + + NPFLY W+N  F++          +S +   I+Q S  R  +   P    +L
Sbjct:  176 CSEHWPLAEVRKGYTFLVLITQFLFPFATMAFCYYNIFSRLRQRVETKLKKLSERSQLLENSTTCGTTNHIVSINAEAVQNGLENKQRLAVLAQQRRTTTILSCMVLLFAFTWLPHNVVTLMIEYDGFFFHSDETSATSTDHTY-IVSMTAHLISMLTNVTNPFLYAWLNPMFKEMLIKTLRGGSKSPKPADIKQTSFIRMPNSGAPSQSSYL 387          
BLAST of SMED30012106 vs. Ensembl Fly
Match: sNPF-R (gene:FBgn0036934 transcript:FBtr0332667)

HSP 1 Score: 147.902 bits (372), Expect = 4.625e-39
Identity = 71/132 (53.79%), Postives = 94/132 (71.21%), Query Frame = -2
Query:  635 YSMIFVLGLSGNALVIFVILRNKAMYTVTNFFITNLAASDILMCIVAVPFTPIALYLENWTLPELVCKLLPMTMAISVYVSTLTSLVISIDRYFVIVYPFKVRMKLSFCRFLLVLIWGLAILASFPLAKYHK 1030
            Y+ +FVLG+ GN LV +V+LRN+AM TVTN FITNLA SDIL+C++AVPFTP+  ++  W     +C L+      S+Y+STLT   I+IDRYFVI+YPF  RMKLS C  ++V IW +A+LA+ P   Y K
Sbjct:   70 YATVFVLGVFGNVLVCYVVLRNRAMQTVTNIFITNLALSDILLCVLAVPFTPLYTFMGRWAFGRSLCHLVSFAQGCSIYISTLTLTSIAIDRYFVIIYPFHPRMKLSTCIGIIVSIWVIALLATVPYGMYMK 201          

HSP 2 Score: 117.087 bits (292), Expect = 3.023e-28
Identity = 63/151 (41.72%), Postives = 85/151 (56.29%), Query Frame = -3
Query:  148 CHEKWPDNRWKGIYTVSSFIVQFVLPTIAISFCYFQISRTLQSRCNRXXXXXXXXXSRVLNDIKRKRKTNKMLIAMVVIFIVCWIPLNVLWIITDLIYSDEQSKLNTNLYFTTIFFICHLIAMCSALYNPFLYGWMNENFRQEFCSVFSCW 600
            C E WP  +++ ++   +  +QFVLP   IS CY  IS  L  R         KS  R   D  RK++TN+MLIAMV +F + W+P+NV+ I     + D   K N   ++   FF+ H IAM S  YNPFLY W+NENFR+EF  V  C+
Sbjct:  268 CEENWPSEQYRKVFGAITTTLQFVLPFFIISICYVWISVKLNQRAR--AKPGSKSSRREEADRDRKKRTNRMLIAMVAVFGLSWLPINVVNI-----FDDFDDKSNEWRFYILFFFVAHSIAMSSTCYNPFLYAWLNENFRKEFKHVLPCF 411          
BLAST of SMED30012106 vs. Ensembl Fly
Match: sNPF-R (gene:FBgn0036934 transcript:FBtr0074871)

HSP 1 Score: 147.902 bits (372), Expect = 4.625e-39
Identity = 71/132 (53.79%), Postives = 94/132 (71.21%), Query Frame = -2
Query:  635 YSMIFVLGLSGNALVIFVILRNKAMYTVTNFFITNLAASDILMCIVAVPFTPIALYLENWTLPELVCKLLPMTMAISVYVSTLTSLVISIDRYFVIVYPFKVRMKLSFCRFLLVLIWGLAILASFPLAKYHK 1030
            Y+ +FVLG+ GN LV +V+LRN+AM TVTN FITNLA SDIL+C++AVPFTP+  ++  W     +C L+      S+Y+STLT   I+IDRYFVI+YPF  RMKLS C  ++V IW +A+LA+ P   Y K
Sbjct:   70 YATVFVLGVFGNVLVCYVVLRNRAMQTVTNIFITNLALSDILLCVLAVPFTPLYTFMGRWAFGRSLCHLVSFAQGCSIYISTLTLTSIAIDRYFVIIYPFHPRMKLSTCIGIIVSIWVIALLATVPYGMYMK 201          

HSP 2 Score: 117.087 bits (292), Expect = 3.023e-28
Identity = 63/151 (41.72%), Postives = 85/151 (56.29%), Query Frame = -3
Query:  148 CHEKWPDNRWKGIYTVSSFIVQFVLPTIAISFCYFQISRTLQSRCNRXXXXXXXXXSRVLNDIKRKRKTNKMLIAMVVIFIVCWIPLNVLWIITDLIYSDEQSKLNTNLYFTTIFFICHLIAMCSALYNPFLYGWMNENFRQEFCSVFSCW 600
            C E WP  +++ ++   +  +QFVLP   IS CY  IS  L  R         KS  R   D  RK++TN+MLIAMV +F + W+P+NV+ I     + D   K N   ++   FF+ H IAM S  YNPFLY W+NENFR+EF  V  C+
Sbjct:  268 CEENWPSEQYRKVFGAITTTLQFVLPFFIISICYVWISVKLNQRAR--AKPGSKSSRREEADRDRKKRTNRMLIAMVAVFGLSWLPINVVNI-----FDDFDDKSNEWRFYILFFFVAHSIAMSSTCYNPFLYAWLNENFRKEFKHVLPCF 411          
BLAST of SMED30012106 vs. Ensembl Fly
Match: RYa-R (gene:FBgn0004842 transcript:FBtr0345267)

HSP 1 Score: 84.3445 bits (207), Expect = 6.519e-32
Identity = 47/128 (36.72%), Postives = 73/128 (57.03%), Query Frame = -2
Query:  650 YSMIFVLGLSGNALVIFVILRNKAMYTVTNFFITNLAASDILMCIVAVPFTPIALYLEN-WTLPELVCKLLPMTMAISVYVSTLTSLVISIDRYFVIVYPFKVRMKLSFCRFLLVLIWGLAILASFPL 1030
            Y  IF+  L GN  V +++     M TVTN+FI +LA  DILM    VP + I+L++ N W     +C  +  + A+SV VS  T + ISIDRY  I++P K R+   +  F++  +W +A+  + P+
Sbjct:  112 YIPIFIFALIGNGTVCYIVYSTPRMRTVTNYFIASLAIGDILMSFFCVPSSFISLFILNYWPFGLALCHFVNYSQAVSVLVSAYTLVAISIDRYIAIMWPLKPRITKRYATFIIAGVWFIALATALPI 239          

HSP 2 Score: 72.4034 bits (176), Expect = 6.519e-32
Identity = 46/144 (31.94%), Postives = 75/144 (52.08%), Query Frame = -3
Query:  169 CHEKWPDNRWKGIYTVSSFIVQFVLPTIAISFCYFQISRTLQSRCNRXXXXXXXXXSRVLNDIKRKRKTNKMLIAMVVIFIVCWIPLNVLWIITDLIYSDEQSKLNTNLYFTTIFFICHLIAMCSALYNPFLYGWMNENFRQEF 600
            C E WP    +  YT+S F +QFV+P   + F Y +I  T++    R   +   +  + +   + KRK  KM++ +V++F  CW+P N+L     L+ +DE+      L +  ++F  H +AM    YNP +Y +MN  FR  F
Sbjct:  261 CREMWPSRTQEYYYTLSLFALQFVVPLGVLIFTYARI--TIRVWAKRPPGEAETNRDQRMA--RSKRKMVKMMLTVVIVFTCCWLPFNIL----QLLLNDEEFAHWDPLPY--VWFAFHWLAMSHCCYNPIIYCYMNARFRSGF 394          
BLAST of SMED30012106 vs. Ensembl Fly
Match: RYa-R (gene:FBgn0004842 transcript:FBtr0085100)

HSP 1 Score: 83.9593 bits (206), Expect = 1.028e-31
Identity = 47/128 (36.72%), Postives = 73/128 (57.03%), Query Frame = -2
Query:  650 YSMIFVLGLSGNALVIFVILRNKAMYTVTNFFITNLAASDILMCIVAVPFTPIALYLEN-WTLPELVCKLLPMTMAISVYVSTLTSLVISIDRYFVIVYPFKVRMKLSFCRFLLVLIWGLAILASFPL 1030
            Y  IF+  L GN  V +++     M TVTN+FI +LA  DILM    VP + I+L++ N W     +C  +  + A+SV VS  T + ISIDRY  I++P K R+   +  F++  +W +A+  + P+
Sbjct:  112 YIPIFIFALIGNGTVCYIVYSTPRMRTVTNYFIASLAIGDILMSFFCVPSSFISLFILNYWPFGLALCHFVNYSQAVSVLVSAYTLVAISIDRYIAIMWPLKPRITKRYATFIIAGVWFIALATALPI 239          

HSP 2 Score: 72.4034 bits (176), Expect = 1.028e-31
Identity = 45/144 (31.25%), Postives = 73/144 (50.69%), Query Frame = -3
Query:  169 CHEKWPDNRWKGIYTVSSFIVQFVLPTIAISFCYFQISRTLQSRCNRXXXXXXXXXSRVLNDIKRKRKTNKMLIAMVVIFIVCWIPLNVLWIITDLIYSDEQSKLNTNLYFTTIFFICHLIAMCSALYNPFLYGWMNENFRQEF 600
            C E WP    +  YT+S F +QFV+P   + F Y +I+  + ++            +R     + KRK  KM++ +V++F  CW+P N+L     L+ +DE+      L +  ++F  H +AM    YNP +Y +MN  FR  F
Sbjct:  261 CREMWPSRTQEYYYTLSLFALQFVVPLGVLIFTYARITIRVWAK----RPPGEAETNRDQRMARSKRKMVKMMLTVVIVFTCCWLPFNIL----QLLLNDEEFAHWDPLPY--VWFAFHWLAMSHCCYNPIIYCYMNARFRSGF 394          
BLAST of SMED30012106 vs. Ensembl Fly
Match: RYa-R (gene:FBgn0004842 transcript:FBtr0345268)

HSP 1 Score: 83.9593 bits (206), Expect = 1.274e-31
Identity = 47/128 (36.72%), Postives = 73/128 (57.03%), Query Frame = -2
Query:  650 YSMIFVLGLSGNALVIFVILRNKAMYTVTNFFITNLAASDILMCIVAVPFTPIALYLEN-WTLPELVCKLLPMTMAISVYVSTLTSLVISIDRYFVIVYPFKVRMKLSFCRFLLVLIWGLAILASFPL 1030
            Y  IF+  L GN  V +++     M TVTN+FI +LA  DILM    VP + I+L++ N W     +C  +  + A+SV VS  T + ISIDRY  I++P K R+   +  F++  +W +A+  + P+
Sbjct:  112 YIPIFIFALIGNGTVCYIVYSTPRMRTVTNYFIASLAIGDILMSFFCVPSSFISLFILNYWPFGLALCHFVNYSQAVSVLVSAYTLVAISIDRYIAIMWPLKPRITKRYATFIIAGVWFIALATALPI 239          

HSP 2 Score: 72.0182 bits (175), Expect = 1.274e-31
Identity = 45/144 (31.25%), Postives = 73/144 (50.69%), Query Frame = -3
Query:  169 CHEKWPDNRWKGIYTVSSFIVQFVLPTIAISFCYFQISRTLQSRCNRXXXXXXXXXSRVLNDIKRKRKTNKMLIAMVVIFIVCWIPLNVLWIITDLIYSDEQSKLNTNLYFTTIFFICHLIAMCSALYNPFLYGWMNENFRQEF 600
            C E WP    +  YT+S F +QFV+P   + F Y +I+  + ++            +R     + KRK  KM++ +V++F  CW+P N+L     L+ +DE+      L +  ++F  H +AM    YNP +Y +MN  FR  F
Sbjct:  261 CREMWPSRTQEYYYTLSLFALQFVVPLGVLIFTYARITIRVWAK----RPPGEAETNRDQRMARSKRKMVKMMLTVVIVFTCCWLPFNIL----QLLLNDEEFAHWDPLPY--VWFAFHWLAMSHCCYNPIIYCYMNARFRSGF 394          
BLAST of SMED30012106 vs. Ensembl Zebrafish
Match: npy2rl (neuropeptide Y receptor Y2, like [Source:ZFIN;Acc:ZDB-GENE-111115-4])

HSP 1 Score: 111.694 bits (278), Expect = 1.958e-48
Identity = 64/179 (35.75%), Postives = 94/179 (52.51%), Query Frame = -3
Query:   88 NISTCHEKWPDNRWKG-IYTVSSFIVQFVLPTIAISFCYFQISRTLQSRCNRXXXXXXXXXSRVLNDIK-RKRKTNKMLIAMVVIFIVCWIPLNVLWIITDLIYSDEQSKLNTNLYFTTIFFICHLIAMCSALYNPFLYGWMNENFRQEFCSVFSCWRSRRALLIEQN--STFRKNSKK 612
            +I  C EKWPD+     +Y++S+ ++Q+VLP   ISF Y +I   L++  +              ND   R+RKT KML+ MVV+F V W+P +   +  D+ +S    K      F  ++ + H++AMCS   NP LYGWMN N+R  F +VF C     +L  E    +T R   KK
Sbjct:  193 SIEVCGEKWPDSSTDSTLYSISTLLLQYVLPLAIISFAYIRIWSKLRNHVSPVGR----------NDRHHRRRKTTKMLVTMVVVFAVSWLPFHAFQLAIDIDHSVLDMK-----DFRLLYTVFHIVAMCSTFANPLLYGWMNRNYRSAFVAVFRCKERLDSLHTEGQPAATVRSKPKK 356          

HSP 2 Score: 100.908 bits (250), Expect = 1.958e-48
Identity = 55/149 (36.91%), Postives = 92/149 (61.74%), Query Frame = -2
Query:  635 LNSNTDLI-LKTFIISSYSMIFVLGLSGNALVIFVILRNKAMYTVTNFFITNLAASDILMCIVAVPFTPIALYLENWTLPELVCKLLPMTMAISVYVSTLTSLVISIDRYFVIVYPFKVRMKLSFCRFLLVLIWGLAILASFPLAKYHK 1078
            L  +T L+ ++  +I +YS I +LG+ GN+LVI+V+ + K + TVTNFFI NLA +D+L+  + +PFT     L  W   +++C  LP    ++V+VST+T  VI++DR+  IVY    RM    C  ++ + W ++ + + PLA + +
Sbjct:   34 LGDSTKLLGVQVVLILAYSTIILLGVVGNSLVIYVVYKFKTLRTVTNFFIANLAVADLLVNTLCLPFTLAYTLLREWKFGQVLCFTLPYAQGLAVHVSTITLNVIALDRHRCIVYHLDTRMSKDTCFLVIAITWVVSAVLASPLAIFRE 182          
BLAST of SMED30012106 vs. Ensembl Zebrafish
Match: npy7r (neuropeptide Y receptor Y7 [Source:ZFIN;Acc:ZDB-GENE-040924-9])

HSP 1 Score: 99.3673 bits (246), Expect = 2.613e-41
Identity = 52/138 (37.68%), Postives = 87/138 (63.04%), Query Frame = -2
Query:  629 IISSYSMIFVLGLSGNALVIFVILRNKAMYTVTNFFITNLAASDILMCIVAVPFTPIALYLENWTLPELVCKLLPMTMAISVYVSTLTSLVISIDRYFVIVYPFKVRMKLSFCRFLLVLIWGLAILASFPLAKYHKKR 1042
            +I +YS+I +LGL GN LVI++I+  + M TVTN+FI NLA +D+++  V +PFT +   L+ W    ++C ++P + A+SV+VS LT  +I+++RY  IV+    R+       ++ L W  A + + PLA + + R
Sbjct:   50 LILAYSLIILLGLVGNTLVIYMIILYRNMRTVTNYFIANLALADLMVDTVCLPFTLVYTLLDEWKFGAVMCHMVPYSQALSVHVSILTLTIIALERYRCIVFHLGQRLNRCTSFIIIGLTWAFAAILAGPLAIFREYR 187          

HSP 2 Score: 89.3521 bits (220), Expect = 2.613e-41
Identity = 65/184 (35.33%), Postives = 97/184 (52.72%), Query Frame = -3
Query:   79 ISTCHEKWPD--NRWKGIYTVSSFIVQFVLPTIAISFCYFQISRTLQ---SRCNRXXXXXXXXXSRVLNDIKRKRKTNKMLIAMVVIFIVCWIPLNVLWIITDL--IYSDEQSKLNTNLYFTTIFFICHLIAMCSALYNPFLYGWMNENFRQEFCSVFSCWRSRRALLIEQNSTFRKNSKKHPI 609
            I+ C EKWP+  NR   IY++S  ++Q+V+P   IS+ Y  I   L+   S  NR             + I R++KT KML  +VV+F VCW+P ++  + +DL  I   ++ KL        I+ + H++AMCS   NP LYGWMN+N+R  F   F C     +  I  + +FR  S +  I
Sbjct:  198 IAVCSEKWPNGTNRDAVIYSLSMLLLQYVVPLAIISYAYVCIWIKLKNHVSPSNRN------------DGIVRRKKTTKMLALVVVVFAVCWLPFHMFQLASDLDLILKFKEYKL--------IYTLFHIVAMCSTFVNPLLYGWMNQNYRNGFLMFFRCEHKPDS--IYPDGSFRTRSLRGMI 359          
BLAST of SMED30012106 vs. Ensembl Zebrafish
Match: npffr1l3 (neuropeptide FF receptor 1 like 3 [Source:ZFIN;Acc:ZDB-GENE-070424-44])

HSP 1 Score: 95.9005 bits (237), Expect = 1.365e-37
Identity = 54/127 (42.52%), Postives = 75/127 (59.06%), Query Frame = -2
Query:  653 SYSMIFVLGLSGNALVIFVILRNKAMYTVTNFFITNLAASDILMCIVAVPFTPIALYLENWTLPELVCKLLPMTMAISVYVSTLTSLVISIDRYFVIVYPFKVRMKLSFCRFLLVLIWGLAILASFP 1033
            +Y  IF+L L GNALV  ++LRN+ M TVTN FI NLA SD+L+ I  +P T +   +  W     VCKL  +   +SV  S  T + I++DR+  IVYPFK ++ L   +  +  IW LA+   FP
Sbjct:   57 AYLFIFLLCLMGNALVCVIVLRNRHMRTVTNIFILNLAVSDLLVGIFCIPTTLVDNLITGWPFSNTVCKLSGLVQGMSVSASVFTLVAIAVDRFRCIVYPFKPKLTLFIAKVSIGTIWLLALTIMFP 183          

HSP 2 Score: 80.4925 bits (197), Expect = 1.365e-37
Identity = 48/149 (32.21%), Postives = 77/149 (51.68%), Query Frame = -3
Query:  157 TCHEKWPDNRWKGIYTVSSFIVQFVLPTIAISFCYFQISRTLQSRCNRXXXXXXXXXSRVLNDIKRKRKTNKMLIAMVVIFIVCWIPLNVLWIITDLIYSDEQSKLNTNLYFTTIFFICHLIAMCSALYNPFLYGWMNENFRQEFCSVF 603
            +C+E WPD   + IYT   FI  +V+P   I   Y +I   L S    + +             KRK +  KMLI + ++F++ W+PL  L ++TD  + D  S     +  + IF + H +A  ++  NP +YG+ NENF++ F +VF
Sbjct:  212 SCYETWPDPEMRKIYTTVLFIHIYVIPLALIMLMYGRIGAKLYSAAVSEHANAQG---------KRKIRVVKMLIMVALLFMLSWLPLWTLMMLTDYGHPDNDS---LEILTSYIFPLSHWLAFSNSSVNPIIYGYFNENFKRGFQAVF 348          
BLAST of SMED30012106 vs. Ensembl Zebrafish
Match: npy1r (neuropeptide Y receptor Y1 [Source:ZFIN;Acc:ZDB-GENE-080221-1])

HSP 1 Score: 90.1225 bits (222), Expect = 2.718e-37
Identity = 46/127 (36.22%), Postives = 78/127 (61.42%), Query Frame = -2
Query:  653 SYSMIFVLGLSGNALVIFVILRNKAMYTVTNFFITNLAASDILMCIVAVPFTPIALYLENWTLPELVCKLLPMTMAISVYVSTLTSLVISIDRYFVIVYPFKVRMKLSFCRFLLVLIWGLAILASFP 1033
            +YS + +LG+ GN  +I VI R + ++ VTN  I NL+ SD+LM +V +PFT I  ++++W    ++CKL  +    SV VS  + ++I+I+R+ +I++P   R  L+     + L W LA+L + P
Sbjct:   25 AYSAVVLLGVIGNLALILVIARQRELHNVTNVLIANLSVSDLLMAVVCLPFTFIYTFMDHWVFGAVMCKLNSLVQCCSVSVSIFSLVLIAIERHQLILHPRGWRPSLNHACLGISLTWALAVLTATP 151          

HSP 2 Score: 85.1149 bits (209), Expect = 2.718e-37
Identity = 50/152 (32.89%), Postives = 74/152 (48.68%), Query Frame = -3
Query:  169 RNISTCHEKWPDNRWKGIYTVSSFIVQFVLPTIAISFCYFQISRTLQSRCNRXXXXXXXXXSRVLNDIKRK---RKTNKMLIAMVVIFIVCWIPLNVLWIITDLIYSDEQSKLNTNLYFTTIFFICHLIAMCSALYNPFLYGWMNENFRQEF 615
            R    C E+WP    K  YT    ++Q++ P   I  CY +I   LQ R N         + R+  +  R    ++ N ML ++VV F VCW+PLNV   + D        ++  N     +F +CHL AMCS   NP  YG++N NF+++ 
Sbjct:  175 RGKVVCVEEWPSREIKLTYTTGMLVLQYITPLTFIFICYLKIYTRLQRRNN--------MMERIRENKYRSSESKRINIMLFSIVVAFAVCWLPLNVFNAVIDW-----NHEVAMNCTHNLLFSLCHLTAMCSVCINPVFYGFLNRNFQRDL 313          
BLAST of SMED30012106 vs. Ensembl Zebrafish
Match: npy1r (neuropeptide Y receptor Y1 [Source:ZFIN;Acc:ZDB-GENE-080221-1])

HSP 1 Score: 90.1225 bits (222), Expect = 2.763e-37
Identity = 46/127 (36.22%), Postives = 78/127 (61.42%), Query Frame = -2
Query:  653 SYSMIFVLGLSGNALVIFVILRNKAMYTVTNFFITNLAASDILMCIVAVPFTPIALYLENWTLPELVCKLLPMTMAISVYVSTLTSLVISIDRYFVIVYPFKVRMKLSFCRFLLVLIWGLAILASFP 1033
            +YS + +LG+ GN  +I VI R + ++ VTN  I NL+ SD+LM +V +PFT I  ++++W    ++CKL  +    SV VS  + ++I+I+R+ +I++P   R  L+     + L W LA+L + P
Sbjct:   27 AYSAVVLLGVIGNLALILVIARQRELHNVTNVLIANLSVSDLLMAVVCLPFTFIYTFMDHWVFGAVMCKLNSLVQCCSVSVSIFSLVLIAIERHQLILHPRGWRPSLNHACLGISLTWALAVLTATP 153          

HSP 2 Score: 85.1149 bits (209), Expect = 2.763e-37
Identity = 50/152 (32.89%), Postives = 74/152 (48.68%), Query Frame = -3
Query:  169 RNISTCHEKWPDNRWKGIYTVSSFIVQFVLPTIAISFCYFQISRTLQSRCNRXXXXXXXXXSRVLNDIKRK---RKTNKMLIAMVVIFIVCWIPLNVLWIITDLIYSDEQSKLNTNLYFTTIFFICHLIAMCSALYNPFLYGWMNENFRQEF 615
            R    C E+WP    K  YT    ++Q++ P   I  CY +I   LQ R N         + R+  +  R    ++ N ML ++VV F VCW+PLNV   + D        ++  N     +F +CHL AMCS   NP  YG++N NF+++ 
Sbjct:  177 RGKVVCVEEWPSREIKLTYTTGMLVLQYITPLTFIFICYLKIYTRLQRRNN--------MMERIRENKYRSSESKRINIMLFSIVVAFAVCWLPLNVFNAVIDW-----NHEVAMNCTHNLLFSLCHLTAMCSVCINPVFYGFLNRNFQRDL 315          
BLAST of SMED30012106 vs. Ensembl Xenopus
Match: taf1b (TATA-box binding protein associated factor, RNA polymerase I, B [Source:Xenbase;Acc:XB-GENE-992275])

HSP 1 Score: 106.301 bits (264), Expect = 1.227e-46
Identity = 59/169 (34.91%), Postives = 102/169 (60.36%), Query Frame = -2
Query:  629 PFMAENQTQGIILLNTSKVLNSNTDLILKTFIISSYSMIFVLGLSGNALVIFVILRNKAMYTVTNFFITNLAASDILMCIVAVPFTPIALYLENWTLPELVCKLLPMTMAISVYVSTLTSLVISIDRYFVIVYPFKVRMKLSFCRFLLVLIWGLAILASFPLAKYHKKR 1135
            P M        I+++ +K++       ++  +I++YS+I +LGL GN+LVI++I++ K M TVTNFFI NLA +D+++    +PFT +   ++ W    ++C L P   A+SV VSTLT +VI++DRY+ IV+    R+  +    ++ + W  A + + PLA + + R
Sbjct:   17 PDMHTFHGAHTIMMDYTKLVG------VQVILIAAYSLIILLGLVGNSLVIYMIVKYKNMRTVTNFFIANLAIADLMVDSFCLPFTLVYTLMDEWKFGSVLCHLFPYAQAMSVNVSTLTLIVIALDRYWCIVFHLNSRISKNLSFLIISITWITAAILAIPLAVFREFR 179          

HSP 2 Score: 100.908 bits (250), Expect = 1.227e-46
Identity = 62/193 (32.12%), Postives = 101/193 (52.33%), Query Frame = -3
Query:   37 ISTCHEKWPDNRWKGIYTVSSFIVQFVLPTIAISFCYFQISRTLQSRCNRXXXXXXXXXSRVLNDIKRKRKTNKMLIAMVVIFIVCWIPLNVLWIITDLIYSDEQSKLNTNLYFTTIFFICHLIAMCSALYNPFLYGWMNENFRQEFCSVFSCWRSRRALLIEQNSTFRKNSKKHPISDYHLSLIEA--NKKP 609
            I+ C E W  NR   IY++S  I+Q+ LP   I + Y +I   L++  +     + +         +R++ T KML+ MVV+F VCW+P ++  +  DL ++     ++ N    TIF   H++AMCS   NPFLYGWMN+N+R  F + F C  + +    + + + R +S     + +H S+  A  N  P
Sbjct:  190 IAVCAENW-TNRDSTIYSLSMLILQYALPLAVICYAYLRIWFKLKNHISPTTRSESQ---------QRRKNTTKMLVMMVVVFAVCWLPFHIFQLAIDLEWT---VAIHENKLLYTIF---HVVAMCSTFVNPFLYGWMNKNYRHGFLTFFGCKDTLQN--SQPDGSLRGHSYTFRPTTFHGSIKHACENGNP 364          
BLAST of SMED30012106 vs. Ensembl Xenopus
Match: NPY2R (neuropeptide Y receptor Y2 [Source:NCBI gene;Acc:100498351])

HSP 1 Score: 100.908 bits (250), Expect = 7.032e-43
Identity = 52/138 (37.68%), Postives = 90/138 (65.22%), Query Frame = -2
Query:  647 LILKTFIISSYSMIFVLGLSGNALVIFVILRNKAMYTVTNFFITNLAASDILMCIVAVPFTPIALYLENWTLPELVCKLLPMTMAISVYVSTLTSLVISIDRYFVIVYPFKVRMKLSFCRFLLVLIWGLAILASFPLA 1060
            L ++  +I +YS I +LG+ GN+LVI+V+++ K M TVTNFFI NLA SD+++  + +PFT +   L++W    ++C L+  +  ++V VST+T +VI++DR+  IVY  + ++    C  ++ + W  + L + PLA
Sbjct:   70 LSVQVVLILAYSSIILLGVLGNSLVIYVVIKFKTMRTVTNFFIVNLAVSDLMVNTLCLPFTLVYTLLDDWKFGTVLCHLVTYSQGLAVQVSTVTLMVIALDRHRCIVYHLESKISTKICFMIIGITWVCSALLASPLA 207          

HSP 2 Score: 93.5893 bits (231), Expect = 7.032e-43
Identity = 60/183 (32.79%), Postives = 98/183 (53.55%), Query Frame = -3
Query:   73 ISTCHEKWP--DNRWKGIYTVSSFIVQFVLPTIAISFCYFQISRTLQSRCNRXXXXXXXXXSRVLNDI--KRKRKTNKMLIAMVVIFIVCWIPLNVLWIITDLIYSDEQSKLNTNLYFTTIFFICHLIAMCSALYNPFLYGWMNENFRQEFCSVFSCWRSRRALLIEQNSTFRKNSKKHPISD 609
            I  C E+WP  D  +  IY++S  ++Q+++P   IS+ Y +I   L++  +              ND   +R+RKT KML+A+VV+F VCW+P +   + +D+    +   L+ N Y   I+ I H+IAMCS   NP LYGWMN N+R  F + F C +   ++  E +   +   K+  + +
Sbjct:  223 IQACSERWPVGDLNYGTIYSISMLLIQYIVPLAIISYAYIRIWTKLKNHVSPGGG----------NDHYHQRRRKTTKMLVAVVVVFAVCWLPFHAFQLASDI----DGKVLDLNEY-KLIYTIFHVIAMCSTFANPLLYGWMNNNYRTAFLTAFKCEQRMDSIHPEVSVAIQLKKKQLEVKE 390          
BLAST of SMED30012106 vs. Ensembl Xenopus
Match: errfi1 (ERBB receptor feedback inhibitor 1 [Source:Xenbase;Acc:XB-GENE-1005334])

HSP 1 Score: 105.531 bits (262), Expect = 1.949e-38
Identity = 63/166 (37.95%), Postives = 91/166 (54.82%), Query Frame = -2
Query:  653 PFMAENQTQ---GIILLNTSKVLNSNTDLILKTFIISSYSMIFVLGLSGNALVIFVILRNKAMYTVTNFFITNLAASDILMCIVAVPFTPIALYLE--NWTLPELVCKLLPMTMAISVYVSTLTSLVISIDRYFVIVYPFKVRMKLSFCRFLLVLIWGLAILASFP 1135
            P MA N +Q   G+ L+++ K L           II  YS++   G+ GN L+I+VI R K M+ VTNF + NLA SD+LMC   VP T +A   E   W     +C  + +   ++VYVS  T  VI++DRY   VYP + R+ +  C ++L  IW L+ L + P
Sbjct:   14 PAMASNSSQQFMGLQLIHSYKAL-----------IIPCYSLVVFTGIFGNYLLIYVICRTKKMHNVTNFLVGNLAFSDMLMCATCVPLT-LAYVFEPRGWVFGHFLCYFVFLMQPVTVYVSVFTLTVIAVDRYHATVYPLRRRLTIPTCAYILAGIWLLSCLMAAP 167          

HSP 2 Score: 74.3294 bits (181), Expect = 1.949e-38
Identity = 49/160 (30.63%), Postives = 83/160 (51.88%), Query Frame = -3
Query:  136 NISTCHEKWPDNRWKGI-YTVSSFIVQFVLPTIAISFCYFQISRTLQSRCNRXXXXXXXXXSRVLNDIKRKRKTNKMLIAMVVIFIVCWIPLNVLWIITDLIYSDEQSKLNTNLYFTTIFFICHLIAMCSALYNPFLYGWMNENFRQEFCSVFSCWRSRR 612
            + S C E W     K + Y  S+ I+ + LP I I+  Y +IS  L++R    +     +  +   D  R++KT ++L+ +V  F +CW+PL++  I+ D+        L    YF  +  +CH +AM SA  N  LY W++++FR E   +F  W+ +R
Sbjct:  181 DFSICEEFWFGMEKKRLAYAYSTLILTYALPFIIIALSYLRISVKLKNR----VVPGNITNVQAEWDRARRKKTFRLLVLVVGAFGMCWLPLHIFNIMKDI-----DIHLIDKQYFNLVQLLCHWLAMMSACTNSLLYAWLHDSFRGELKKMF-LWKRKR 330          
BLAST of SMED30012106 vs. Ensembl Xenopus
Match: ENSXETT00000044281.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:3:115219157:115249407:-1 gene:ENSXETG00000019365.1 transcript:ENSXETT00000044281.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 101.293 bits (251), Expect = 5.913e-37
Identity = 50/128 (39.06%), Postives = 80/128 (62.50%), Query Frame = -2
Query:  671 KTFIISSYSMIFVLGLSGNALVIFVILRNKAMYTVTNFFITNLAASDILMCIVAVPFT-PIALYLENWTLPELVCKLLPMTMAISVYVSTLTSLVISIDRYFVIVYPFKVRMKLSFCRFLLVLIWGLA 1051
            K   I  Y+++ ++G+ GN L+++VI R + M+ VTNFFI NLA SD+LMC   VPFT   A   + W   + +C  + +   ++VYVS  T   I++DRY+  V+P K R+ ++ C ++L+ IW L+
Sbjct:   34 KPLFIPCYTLVVLIGIFGNYLLLYVICRTRKMHNVTNFFIGNLAFSDMLMCATCVPFTLAYAFNPQGWVFGKFMCYFVFLMQPVTVYVSVFTLTAIAVDRYYATVHPLKKRISVTTCIYVLMGIWLLS 161          

HSP 2 Score: 73.559 bits (179), Expect = 5.913e-37
Identity = 48/155 (30.97%), Postives = 78/155 (50.32%), Query Frame = -3
Query:  154 RNISTCHEKWPDNRWKGI-YTVSSFIVQFVLPTIAISFCYFQISRTLQSRCNRXXXXXXXXXSRVLNDIKRKRKTNKMLIAMVVIFIVCWIPLNVLWIITDLIYSDEQSKLNTNLYFTTIFFICHLIAMCSALYNPFLYGWMNENFRQEFCSVFS 615
               + C E W     + + Y  S+ I+ ++LP  A+S  Y  I+  L++R    +     + S+   D  RKRK  ++++ +V  F +CW+P++V  II D+        L    YF  I   CH  AM S+  NPFLY W+++ FR E   +F+
Sbjct:  180 EGFTICEEFWMGKETERLAYAYSTLIITYILPLSAVSLSYICITVKLKNR----VVPGHPTQSQAEFDRLRKRKIFRLIVLVVTAFGICWLPIHVFNIIRDI-----DINLINKHYFLHIQLFCHWFAMSSSCCNPFLYAWLHDRFRSELRKMFT 325          
BLAST of SMED30012106 vs. Ensembl Xenopus
Match: gamt (guanidinoacetate N-methyltransferase [Source:Xenbase;Acc:XB-GENE-947462])

HSP 1 Score: 93.9745 bits (232), Expect = 2.681e-34
Identity = 55/163 (33.74%), Postives = 90/163 (55.21%), Query Frame = -2
Query:  605 NTSKVLNSNTDLILKTFIISSYSMIFVLGLSGNALVIFVILRNKAMYTVTNFFITNLAASDILMCIVAVPFTPIALYLENWTLPELVCKLLPMTMAISVYVSTLTSLVISIDRYFVIVYPFKVRMKLSFCRFLLVLIWGLAILASFPLAKYHKKRKRCIEEYF 1093
            N +K    +    +K  +I +YS+I V+ L GN LV  V+++N  M + T+ FI NLA +DI++ ++  PFT +      W   +L+C +       SV+VS LT + I++DR+ VI++P K RM        +++IW +A   S P A Y K     +E++F
Sbjct:   55 NDTKYEAESQSSTVKALLIVAYSVIIVISLFGNILVCHVVIKNSRMQSATSLFIVNLAVADIMITLLNTPFTLVRFVSSTWVFGKLMCHVSRFVQYCSVHVSVLTLMAIALDRHQVIMHPLKPRMSTVKGIICIIVIWFMASGFSLPHAVYQK-----LEQFF 212          

HSP 2 Score: 71.633 bits (174), Expect = 2.681e-34
Identity = 52/157 (33.12%), Postives = 81/157 (51.59%), Query Frame = -3
Query:  139 CHEKWP---DNRWKGIYTVSSFIVQFVLPTIAISFCYFQISRTLQSRCNRXXXXXXXXXSRVLNDIKRKRKTNKMLIAMVVIFIVCWIPLNVLWIITDLIYSDEQSKLNTNLYFTTIFFICHLIAMCSALYNPFLYGWMNENFRQEFCSVFSCWRSR 600
            C   +P   D  WK +  +++F++ +VLP I IS  Y  +++ L  R     +    ++ +     ++K+ T KML+ +VV+F VCW PLN   +   L+ S   S  N       I+F  H  AM S  YNPF+Y W+NE+FR E  ++    R R
Sbjct:  221 CLPSFPYPADLFWKYL-DLATFVLLYVLPLIVISITYTTVAKKLWLR----NAIGDITMEQYYAHRRKKKMTLKMLMLVVVVFAVCWFPLNCYLV---LMSSKVISSNNA------IYFAFHWFAMSSTCYNPFIYCWLNESFRSELKALLCVCRRR 363          
BLAST of SMED30012106 vs. Ensembl Mouse
Match: Npy2r (neuropeptide Y receptor Y2 [Source:MGI Symbol;Acc:MGI:108418])

HSP 1 Score: 98.9821 bits (245), Expect = 1.849e-41
Identity = 52/146 (35.62%), Postives = 92/146 (63.01%), Query Frame = -2
Query:  647 KVLNSNTDLILKTFIISSYSMIFVLGLSGNALVIFVILRNKAMYTVTNFFITNLAASDILMCIVAVPFTPIALYLENWTLPELVCKLLPMTMAISVYVSTLTSLVISIDRYFVIVYPFKVRMKLSFCRFLLVLIWGLAILASFPLA 1084
            ++++S   + ++  +I +Y  I +LG+ GN+LVI V+++ K+M TVTNFFI NLA +D+L+  + +PFT     +  W +  ++C L+P    ++V VST+T  VI++DR+  IVY  + ++       ++ L WG++ L + PLA
Sbjct:   39 ELIDSTKLVEVQVILILAYCSIILLGVVGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGEWKMGPVLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKRISFLIIGLAWGISALLASPLA 184          

HSP 2 Score: 90.5077 bits (223), Expect = 1.849e-41
Identity = 58/173 (33.53%), Postives = 90/173 (52.02%), Query Frame = -3
Query:  103 NISTCHEKWPDNR---WKGIYTVSSFIVQFVLPTIAISFCYFQISRTLQSRCNRXXXXXXXXXSRVLNDIKRKRKTNKMLIAMVVIFIVCWIPLNVLWIITDLIYSDEQSKLNTNLYFTTIFFICHLIAMCSALYNPFLYGWMNENFRQEFCSVFSCWRSRRALLIEQNSTFR 612
             I  C EKWP      +  +Y++S+ ++ +VLP   ISF Y +I   L++  +   +             +R+ K  KML+ +VV+F V W+PL+   +  D+    +   L+   Y   IF + H+IAMCS   NP LYGWMN N+R+ F S F C +   A+  E + TF+
Sbjct:  199 EIVACTEKWPGEEKSVYGTVYSLSTLLILYVLPLGIISFSYTRIWSKLRNHVSPGAASDHYH--------QRRHKMTKMLVCVVVVFAVSWLPLHAFQLAVDI----DSHVLDLKEY-KLIFTVFHIIAMCSTFANPLLYGWMNSNYRKAFLSAFRCEQRLDAIHSEVSMTFK 358          
BLAST of SMED30012106 vs. Ensembl Mouse
Match: Npy2r (neuropeptide Y receptor Y2 [Source:MGI Symbol;Acc:MGI:108418])

HSP 1 Score: 98.9821 bits (245), Expect = 1.849e-41
Identity = 52/146 (35.62%), Postives = 92/146 (63.01%), Query Frame = -2
Query:  647 KVLNSNTDLILKTFIISSYSMIFVLGLSGNALVIFVILRNKAMYTVTNFFITNLAASDILMCIVAVPFTPIALYLENWTLPELVCKLLPMTMAISVYVSTLTSLVISIDRYFVIVYPFKVRMKLSFCRFLLVLIWGLAILASFPLA 1084
            ++++S   + ++  +I +Y  I +LG+ GN+LVI V+++ K+M TVTNFFI NLA +D+L+  + +PFT     +  W +  ++C L+P    ++V VST+T  VI++DR+  IVY  + ++       ++ L WG++ L + PLA
Sbjct:   39 ELIDSTKLVEVQVILILAYCSIILLGVVGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGEWKMGPVLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKRISFLIIGLAWGISALLASPLA 184          

HSP 2 Score: 90.5077 bits (223), Expect = 1.849e-41
Identity = 58/173 (33.53%), Postives = 90/173 (52.02%), Query Frame = -3
Query:  103 NISTCHEKWPDNR---WKGIYTVSSFIVQFVLPTIAISFCYFQISRTLQSRCNRXXXXXXXXXSRVLNDIKRKRKTNKMLIAMVVIFIVCWIPLNVLWIITDLIYSDEQSKLNTNLYFTTIFFICHLIAMCSALYNPFLYGWMNENFRQEFCSVFSCWRSRRALLIEQNSTFR 612
             I  C EKWP      +  +Y++S+ ++ +VLP   ISF Y +I   L++  +   +             +R+ K  KML+ +VV+F V W+PL+   +  D+    +   L+   Y   IF + H+IAMCS   NP LYGWMN N+R+ F S F C +   A+  E + TF+
Sbjct:  199 EIVACTEKWPGEEKSVYGTVYSLSTLLILYVLPLGIISFSYTRIWSKLRNHVSPGAASDHYH--------QRRHKMTKMLVCVVVVFAVSWLPLHAFQLAVDI----DSHVLDLKEY-KLIFTVFHIIAMCSTFANPLLYGWMNSNYRKAFLSAFRCEQRLDAIHSEVSMTFK 358          
BLAST of SMED30012106 vs. Ensembl Mouse
Match: Npy2r (neuropeptide Y receptor Y2 [Source:MGI Symbol;Acc:MGI:108418])

HSP 1 Score: 98.9821 bits (245), Expect = 1.849e-41
Identity = 52/146 (35.62%), Postives = 92/146 (63.01%), Query Frame = -2
Query:  647 KVLNSNTDLILKTFIISSYSMIFVLGLSGNALVIFVILRNKAMYTVTNFFITNLAASDILMCIVAVPFTPIALYLENWTLPELVCKLLPMTMAISVYVSTLTSLVISIDRYFVIVYPFKVRMKLSFCRFLLVLIWGLAILASFPLA 1084
            ++++S   + ++  +I +Y  I +LG+ GN+LVI V+++ K+M TVTNFFI NLA +D+L+  + +PFT     +  W +  ++C L+P    ++V VST+T  VI++DR+  IVY  + ++       ++ L WG++ L + PLA
Sbjct:   39 ELIDSTKLVEVQVILILAYCSIILLGVVGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGEWKMGPVLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKRISFLIIGLAWGISALLASPLA 184          

HSP 2 Score: 90.5077 bits (223), Expect = 1.849e-41
Identity = 58/173 (33.53%), Postives = 90/173 (52.02%), Query Frame = -3
Query:  103 NISTCHEKWPDNR---WKGIYTVSSFIVQFVLPTIAISFCYFQISRTLQSRCNRXXXXXXXXXSRVLNDIKRKRKTNKMLIAMVVIFIVCWIPLNVLWIITDLIYSDEQSKLNTNLYFTTIFFICHLIAMCSALYNPFLYGWMNENFRQEFCSVFSCWRSRRALLIEQNSTFR 612
             I  C EKWP      +  +Y++S+ ++ +VLP   ISF Y +I   L++  +   +             +R+ K  KML+ +VV+F V W+PL+   +  D+    +   L+   Y   IF + H+IAMCS   NP LYGWMN N+R+ F S F C +   A+  E + TF+
Sbjct:  199 EIVACTEKWPGEEKSVYGTVYSLSTLLILYVLPLGIISFSYTRIWSKLRNHVSPGAASDHYH--------QRRHKMTKMLVCVVVVFAVSWLPLHAFQLAVDI----DSHVLDLKEY-KLIFTVFHIIAMCSTFANPLLYGWMNSNYRKAFLSAFRCEQRLDAIHSEVSMTFK 358          
BLAST of SMED30012106 vs. Ensembl Mouse
Match: Npffr2 (neuropeptide FF receptor 2 [Source:MGI Symbol;Acc:MGI:1860130])

HSP 1 Score: 105.145 bits (261), Expect = 3.151e-37
Identity = 59/145 (40.69%), Postives = 87/145 (60.00%), Query Frame = -2
Query:  629 ISSYSMIFVLGLSGNALVIFVILRNKAMYTVTNFFITNLAASDILMCIVAVPFTPIALYLENWTLPELVCKLLPMTMAISVYVSTLTSLVISIDRYFVIVYPFKVRMKLSFCRFLLVLIWGLAILASFPLA--------KYHKKR 1039
            ISSY +IFVL + GN +V F+++RN+ M+TVTNFFI NLA SD+L+ I  +P T +   +  W     +CK+  +   ISV  S  T + I++DR+  +VYPFK ++ +      +V+IWGLAI    P A        KY++ R
Sbjct:   49 ISSYLLIFVLCMVGNTVVCFIVIRNRHMHTVTNFFILNLAISDLLVGIFCMPITLLDNIIAGWPFGSSMCKISGLVQGISVAASVFTLVAIAVDRFRCVVYPFKPKLTVKTAFVTIVIIWGLAIAIMTPSAIMLHVQEEKYYRVR 193          

HSP 2 Score: 70.0922 bits (170), Expect = 3.151e-37
Identity = 49/150 (32.67%), Postives = 76/150 (50.67%), Query Frame = -3
Query:  157 CHEKWPDNRWKGIYTVSSFIVQFVLPTIAISFCYFQISRTLQSRCNRXXXXXXXXXSRVLNDIKRKRKTNKMLIAMVVIFIVCWIPLNVLWIITDLIYSD-EQSKLNT-NLYFTTIFFICHLIAMCSALYNPFLYGWMNENFRQEFCSVF 600
            C E WP +  + IYT   F   ++ P   I   Y +I  +L         K+      V    K+K+K  KML+ + ++FI+ W+PL  L +++D  Y+D   +KL   N+Y   I+   H +A C++  NP +YG+ NENFR  F   F
Sbjct:  206 CREDWPRHEMRRIYTTVLFATIYLAPLSLIVIMYARIGASLFKTAAHCTGKQRPVQWHVS---KKKQKVIKMLLTVALLFILSWLPLWTLMMLSD--YTDLSPNKLRIINIY---IYPFAHWLAFCNSSVNPIIYGFFNENFRNGFQDAF 347          
BLAST of SMED30012106 vs. Ensembl Mouse
Match: Npy4r (neuropeptide Y receptor Y4 [Source:MGI Symbol;Acc:MGI:105374])

HSP 1 Score: 82.4185 bits (202), Expect = 9.429e-33
Identity = 49/147 (33.33%), Postives = 82/147 (55.78%), Query Frame = -2
Query:  653 NTSKVLNSNTDLILKTFIISSYSMIFVLGLSGNALVIFVILRNKAMYTVTNFFITNLAASDILMCIVAVPFTPIALYLENWTLPELVCKLLPMTMAISVYVSTLTSLVISIDRYFVIVYPFKVRMKLSFCRFLLVLIWGLAILASFP 1093
            N S     + +L+   FII++YS+  +LG+ GN  +IFV  R K    VTN  I NLA SD LMC++  P T     ++ W   E++CK+L     +SV VS L+ ++++++R+ +I+ P   +  +      +V+IW ++   S P
Sbjct:   29 NFSDGCQDSAELL--AFIITTYSIETILGVLGNLCLIFVTTRQKEKSNVTNLLIANLAFSDFLMCLICQPLTVTYTIMDYWIFGEVLCKMLTFIQCMSVTVSILSLVLVALERHQLIINPTGWKPSIFQAYLGIVVIWFVSCFLSLP 173          

HSP 2 Score: 77.7962 bits (190), Expect = 9.429e-33
Identity = 56/203 (27.59%), Postives = 93/203 (45.81%), Query Frame = -3
Query:   28 KKENDVLRNISTCHEKWPDNRWKGIYTVSSFIVQFVLPTIAISFCYFQISRTLQSRCNRXXXXXXXXXSRVLNDIKRKRKTNKMLIAMVVIFIVCWIPLNVLWIITDLIYSDEQSKLNTNLYFTTIFFICHLIAMCSALYNPFLYGWMNENFRQEFCSVFSCWRSRRALLIEQNSTFRKNSKKHPISDYHLSLIEANKKPHNK 636
             K  + L +   C   W  +  + IYT    + Q+ +P   I  CY +I + LQ +  + +       SR      + ++ N ML+ MV  F V W+PL+V   + D  Y +     + NL    IF +CHL+AM S   NPF+YG++N NF+++  ++      R           R  S+  P+S  H  L + + +  +K
Sbjct:  189 SKVVEFLEDKVVCFVSWSSDHHRLIYTTFLLLFQYCIPLAFILVCYIRIYQRLQRQ--KHVFHAHACSSRA----GQMKRINSMLMTMVTAFAVLWLPLHVFNTLEDW-YQEAIPACHGNL----IFLMCHLLAMASTCVNPFIYGFLNINFKKDIKALVLTCHCRSP---------RGESEHLPLSTVHTDLSKGSMRMGSK 371          
BLAST of SMED30012106 vs. UniProt/SwissProt
Match: sp|P79113|NPY2R_BOVIN (Neuropeptide Y receptor type 2 OS=Bos taurus OX=9913 GN=NPY2R PE=2 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 7.040e-43
Identity = 56/155 (36.13%), Postives = 95/155 (61.29%), Query Frame = -2
Query:  647 GIILLNTSKVLNSNTDLI-LKTFIISSYSMIFVLGLSGNALVIFVILRNKAMYTVTNFFITNLAASDILMCIVAVPFTPIALYLENWTLPELVCKLLPMTMAISVYVSTLTSLVISIDRYFVIVYPFKVRMKLSFCRFLLVLIWGLAILASFPLA 1108
            G +  ++   L  +T LI ++  +I +Y  I +LG+ GN+LVI V+++ K+M TVTNFFI NLA +D+L+  + +PFT     +  W +  ++C L+P    ++V VST+T  VI++DR+  IVY  + ++       ++ L WG++ L + PLA
Sbjct:   33 GELAPDSEPELIDSTKLIEVQVVLILAYCSIILLGVIGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGEWKMGPVLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKQISFLIIGLAWGVSALLASPLA 187          

HSP 2 Score: 96.6709 bits (239), Expect = 7.040e-43
Identity = 64/179 (35.75%), Postives = 96/179 (53.63%), Query Frame = -3
Query:   85 NISTCHEKWPDNR---WKGIYTVSSFIVQFVLPTIAISFCYFQISRTLQSRCNRXXXXXXXXXSRVLNDIKRKRKTNKMLIAMVVIFIVCWIPLNVLWIITDLIYSDEQSKLNTNLYFTTIFFICHLIAMCSALYNPFLYGWMNENFRQEFCSVFSCWRSRRALLIEQNSTFRKNSKKH 612
             I  C EKWP      +  IY++SS ++ +VLP   ISF Y +I   L++  +   +             +R++KT KML+ +VV+F V W+PL+   +  D+    +   L+   Y   IF + H+IAMCS   NP LYGWMN N+R+ F S F C +   A+  E + TF+  +KKH
Sbjct:  202 EIVACTEKWPGEEKGIYGTIYSLSSLLILYVLPLGIISFSYTRIWSKLKNHVSPGAAHDHYH--------QRRQKTTKMLVCVVVVFAVSWLPLHAFQLAVDI----DSHVLDLKEY-KLIFTVFHIIAMCSTFANPLLYGWMNSNYRKAFLSAFRCEQRLDAIHSEVSVTFK--AKKH 365          
BLAST of SMED30012106 vs. UniProt/SwissProt
Match: sp|Q9DDN6|NPY2R_CHICK (Neuropeptide Y receptor type 2 OS=Gallus gallus OX=9031 GN=NPY2R PE=3 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 2.475e-42
Identity = 63/180 (35.00%), Postives = 106/180 (58.89%), Query Frame = -2
Query:  647 MQVFNTINLYLQSFSLPFMAENQTQGIILLNTSKVLNSNTDLI-LKTFIISSYSMIFVLGLSGNALVIFVILRNKAMYTVTNFFITNLAASDILMCIVAVPFTPIALYLENWTLPELVCKLLPMTMAISVYVSTLTSLVISIDRYFVIVYPFKVRMKLSFCRFLLVLIWGLAILASFPLA 1183
            M++F    LYL  ++ P          + L+    L  +T L+ ++  +I +Y  I +LG+ GN+LVI VI++ K+M TVTNFFI NLA +D+L+  + +PFT +   L  W L  ++C L+P   A++V+VST+T  VI++DR+  IVY  + ++       ++ + W ++ L + PLA
Sbjct:   18 MELFT--KLYLPRYTTPVSE-------LALDPKPELKDSTTLVEVQIILIFAYCSIILLGVIGNSLVIHVIIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLVYTLLGEWKLGPVLCHLVPYAQALAVHVSTVTLTVIALDRHRCIVYHLESKISKRISFLIIGVAWAVSALLASPLA 188          

HSP 2 Score: 92.4337 bits (228), Expect = 2.475e-42
Identity = 61/179 (34.08%), Postives = 94/179 (52.51%), Query Frame = -3
Query:   91 NISTCHEKWPDNR---WKGIYTVSSFIVQFVLPTIAISFCYFQISRTLQSRCNRXXXXXXXXXSRVLNDI--KRKRKTNKMLIAMVVIFIVCWIPLNVLWIITDLIYSDEQSKLNTNLYFTTIFFICHLIAMCSALYNPFLYGWMNENFRQEFCSVFSCWRSRRALLIEQNSTFRKNSK 612
             I  C EKWP      +  IY+VS  ++Q+VLP   IS+ Y +I   L++  +              ND    R++KT KML+ +VV+F V W+P +   +++D+   D Q  L+   Y   I+ + H+IAMCS   NP LYGWMN N+R  F + F C +   ++  E ++ F+   K
Sbjct:  203 KIVVCSEKWPGEGQLNYGTIYSVSMLLIQYVLPLAIISYAYTRIWTKLKNHVSPGAG----------NDHYHHRRQKTTKMLVCVVVVFAVSWLPFHAFQLVSDI---DSQV-LDLKEY-KLIYTVFHVIAMCSTFANPLLYGWMNNNYRTAFLTAFQCEQRLDSIHPEVSAAFKARKK 366          
BLAST of SMED30012106 vs. UniProt/SwissProt
Match: sp|O02836|NPY2R_PIG (Neuropeptide Y receptor type 2 OS=Sus scrofa OX=9823 GN=NPY2R PE=2 SV=2)

HSP 1 Score: 102.449 bits (254), Expect = 3.475e-42
Identity = 56/156 (35.90%), Postives = 96/156 (61.54%), Query Frame = -2
Query:  647 QGIILLNTSKVLNSNTDLI-LKTFIISSYSMIFVLGLSGNALVIFVILRNKAMYTVTNFFITNLAASDILMCIVAVPFTPIALYLENWTLPELVCKLLPMTMAISVYVSTLTSLVISIDRYFVIVYPFKVRMKLSFCRFLLVLIWGLAILASFPLA 1111
            +G +  ++   L  +T LI ++  +I +Y  I +LG+ GN+LVI V+++ K+M TVTNFFI NLA +D+L+  + +PFT     +  W +  ++C L+P    ++V VST+T  VI++DR+  IVY  + ++       ++ L WG++ L + PLA
Sbjct:   30 RGELAPDSEPELKDSTKLIEVQIILILAYCSIILLGVVGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGEWKMGPVLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKRISFLIIGLAWGISALLASPLA 185          

HSP 2 Score: 92.0485 bits (227), Expect = 3.475e-42
Identity = 60/175 (34.29%), Postives = 93/175 (53.14%), Query Frame = -3
Query:  103 NISTCHEKWPDNR---WKGIYTVSSFIVQFVLPTIAISFCYFQISRTLQSRCNRXXXXXXXXXSRVLNDI--KRKRKTNKMLIAMVVIFIVCWIPLNVLWIITDLIYSDEQSKLNTNLYFTTIFFICHLIAMCSALYNPFLYGWMNENFRQEFCSVFSCWRSRRALLIEQNSTFR 612
             I  C EKWP      +  +Y++SS ++ +VLP   ISF Y +I   L++  +             +ND   +R++KT KML+ +VV+F V W+PL+   +  D+      S++     +  IF + H+IAMCS   NP LYGWMN N+R+ F S F C +   A+  E + T +
Sbjct:  200 EIVACTEKWPGEEKSIYGTVYSLSSLLILYVLPLGIISFSYARIWSKLKNHVSPGG----------VNDHYHQRRQKTTKMLVCVVVVFAVSWLPLHAFQLAVDI-----DSQVLDLKEYKLIFTVFHIIAMCSTFANPLLYGWMNSNYRKAFLSAFRCEQRLDAIHSEVSMTSK 359          
BLAST of SMED30012106 vs. UniProt/SwissProt
Match: sp|Q9GK74|NPY2R_MACMU (Neuropeptide Y receptor type 2 OS=Macaca mulatta OX=9544 GN=NPY2R PE=2 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 3.592e-42
Identity = 55/163 (33.74%), Postives = 98/163 (60.12%), Query Frame = -2
Query:  647 FMAENQTQGIILLNTSKVLNSNTDLI-LKTFIISSYSMIFVLGLSGNALVIFVILRNKAMYTVTNFFITNLAASDILMCIVAVPFTPIALYLENWTLPELVCKLLPMTMAISVYVSTLTSLVISIDRYFVIVYPFKVRMKLSFCRFLLVLIWGLAILASFPLA 1132
            +  +   +G ++ +    L  +T LI ++  +I +Y  I +LG+ GN+LVI V+++ K+M TVTNFFI NLA +D+++  + +PFT     +  W +  ++C L+P    ++V VST+T  VI++DR+  IVY  + ++       ++ L WG++ L + PLA
Sbjct:   22 YGPQTTPRGELVPDPEPELIDSTKLIEVQVVLILAYCSIILLGVIGNSLVIHVVIKFKSMRTVTNFFIANLAVADLVVNTLCLPFTLTYTLMGEWKMGPVLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKRISFLIIGLAWGISALLASPLA 184          

HSP 2 Score: 95.5153 bits (236), Expect = 3.592e-42
Identity = 63/175 (36.00%), Postives = 94/175 (53.71%), Query Frame = -3
Query:  103 NISTCHEKWPDNR---WKGIYTVSSFIVQFVLPTIAISFCYFQISRTLQSRCNRXXXXXXXXXSRVLNDI--KRKRKTNKMLIAMVVIFIVCWIPLNVLWIITDLIYSDEQSKLNTNLYFTTIFFICHLIAMCSALYNPFLYGWMNENFRQEFCSVFSCWRSRRALLIEQNSTFR 612
             I  C EKWP      +  +Y++SS ++ +VLP   ISF Y +I   L+S  +   +          ND   +R++KT KML+ +VV+F V W+PL+   +  D+    +   L+   Y   IF + H+IAMCS   NP LYGWMN N+R+ F S F C +   A+  E + TF+
Sbjct:  199 EIVACTEKWPGEEKSIYGTVYSLSSLLILYVLPLGIISFSYTRIWSKLKSHVSPGAA----------NDHYHQRRQKTTKMLVCVVVVFAVSWLPLHAFQLAVDI----DSHVLDLKEY-KLIFTVFHIIAMCSTFANPLLYGWMNSNYRKAFLSAFRCEQRLDAIHSEVSVTFK 358          
BLAST of SMED30012106 vs. UniProt/SwissProt
Match: sp|Q5IS62|NPY2R_PANTR (Neuropeptide Y receptor type 2 OS=Pan troglodytes OX=9598 GN=NPY2R PE=2 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 3.999e-42
Identity = 56/163 (34.36%), Postives = 98/163 (60.12%), Query Frame = -2
Query:  647 FMAENQTQGIILLNTSKVLNSNTDLI-LKTFIISSYSMIFVLGLSGNALVIFVILRNKAMYTVTNFFITNLAASDILMCIVAVPFTPIALYLENWTLPELVCKLLPMTMAISVYVSTLTSLVISIDRYFVIVYPFKVRMKLSFCRFLLVLIWGLAILASFPLA 1132
            +  +   +G ++ +    L  +T LI ++  +I +Y  I +LG+ GN+LVI V+++ K+M TVTNFFI NLA +D+L+  + +PFT     +  W +  ++C L+P    ++V VST+T  VI++DR+  IVY  + ++       ++ L WG++ L + PLA
Sbjct:   22 YGPQTTPRGELVPDPEPELIDSTKLIEVQVVLILAYCSIILLGVIGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGEWKMGPVLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKRISFLIIGLAWGISALLASPLA 184          

HSP 2 Score: 93.9745 bits (232), Expect = 3.999e-42
Identity = 64/175 (36.57%), Postives = 95/175 (54.29%), Query Frame = -3
Query:  103 NISTCHEKWPDNR---WKGIYTVSSFIVQFVLPTIAISFCYFQISRTLQSRCNRXXXXXXXXXSRVLNDI--KRKRKTNKMLIAMVVIFIVCWIPLNVLWIITDLIYSDEQSKLNTNLYFTTIFFICHLIAMCSALYNPFLYGWMNENFRQEFCSVFSCWRSRRALLIEQNSTFR 612
             I  C EKWP      +  +Y++SS ++ +VLP   ISF Y +I   L++  +   +          ND   +R++KT KML+ +VV+F V W+PL+   +  D+   D Q  L+   Y   IF + H+IAMCS   NP LYGWMN N+R+ F S F C +   A+  E + TF+
Sbjct:  199 EIVACTEKWPGEEKSIYGTVYSLSSLLILYVLPLGIISFSYTRIWSKLKNHVSPGAA----------NDHYHQRRQKTTKMLVCVVVVFAVSWLPLHAFQLAVDI---DSQV-LDLKEY-KLIFTVFHIIAMCSTFANPLLYGWMNSNYRKAFLSAFRCEQRLDAIHSEVSVTFK 358          
BLAST of SMED30012106 vs. TrEMBL
Match: A0A193KUS3 (NPYR-9 OS=Schmidtea mediterranea OX=79327 GN=npyr-9 PE=2 SV=1)

HSP 1 Score: 419.468 bits (1077), Expect = 0.000e+0
Identity = 212/212 (100.00%), Postives = 212/212 (100.00%), Query Frame = -3
Query:    1 KKENDVLRNISTCHEKWPDNRWKGIYTVSSFIVQFVLPTIAISFCYFQISRTLQSRCNRXXXXXXXXXSRVLNDIKRKRKTNKMLIAMVVIFIVCWIPLNVLWIITDLIYSDEQSKLNTNLYFTTIFFICHLIAMCSALYNPFLYGWMNENFRQEFCSVFSCWRSRRALLIEQNSTFRKNSKKHPISDYHLSLIEANKKPHNKLLNEFSQFS 636
            KKENDVLRNISTCHEKWPDNRWKGIYTVSSFIVQFVLPTIAISFCYFQISRTLQSRCNRKLSKKIKSLSRVLNDIKRKRKTNKMLIAMVVIFIVCWIPLNVLWIITDLIYSDEQSKLNTNLYFTTIFFICHLIAMCSALYNPFLYGWMNENFRQEFCSVFSCWRSRRALLIEQNSTFRKNSKKHPISDYHLSLIEANKKPHNKLLNEFSQFS
Sbjct:  165 KKENDVLRNISTCHEKWPDNRWKGIYTVSSFIVQFVLPTIAISFCYFQISRTLQSRCNRKLSKKIKSLSRVLNDIKRKRKTNKMLIAMVVIFIVCWIPLNVLWIITDLIYSDEQSKLNTNLYFTTIFFICHLIAMCSALYNPFLYGWMNENFRQEFCSVFSCWRSRRALLIEQNSTFRKNSKKHPISDYHLSLIEANKKPHNKLLNEFSQFS 376          

HSP 2 Score: 330.102 bits (845), Expect = 0.000e+0
Identity = 166/167 (99.40%), Postives = 166/167 (99.40%), Query Frame = -2
Query:  629 MAENQTQGIILLNTSKVLNSNTDLILKTFIISSYSMIFVLGLSGNALVIFVILRNKAMYTVTNFFITNLAASDILMCIVAVPFTPIALYLENWTLPELVCKLLPMTMAISVYVSTLTSLVISIDRYFVIVYPFKVRMKLSFCRFLLVLIWGLAILASFPLAKYHKKR 1129
            MAENQTQGIILLNTSKVLNSNTDLILKTFIISSYSMIFVLGLSGNALVIFVILRNKAMYTVTNFFITNLAASDILMCIVAVPFTPIALYLENWTLPELVCKLLPMTMAISVYVSTLTSLVISIDRYFVIVYPFKVRMKLSFCRFLLVLIWGLAILASFPLAKYHKK 
Sbjct:    1 MAENQTQGIILLNTSKVLNSNTDLILKTFIISSYSMIFVLGLSGNALVIFVILRNKAMYTVTNFFITNLAASDILMCIVAVPFTPIALYLENWTLPELVCKLLPMTMAISVYVSTLTSLVISIDRYFVIVYPFKVRMKLSFCRFLLVLIWGLAILASFPLAKYHKKE 167          
BLAST of SMED30012106 vs. TrEMBL
Match: A0A3S5ASN6 (G_PROTEIN_RECEP_F1_2 domain-containing protein (Fragment) OS=Protopolystoma xenopodis OX=117903 GN=PXEA_LOCUS30250 PE=4 SV=1)

HSP 1 Score: 182.57 bits (462), Expect = 1.339e-90
Identity = 93/166 (56.02%), Postives = 119/166 (71.69%), Query Frame = -2
Query:  632 MAENQTQGIILLNTSKVLNSNTDLILKTFIISSYSMIFVLGLSGNALVIFVILRNKAMYTVTNFFITNLAASDILMCIVAVPFTPIALYLENWTLPELVCKLLPMTMAISVYVSTLTSLVISIDRYFVIVYPFKVRMKLSFCRFLLVLIWGLAILASFPLAKYHKK 1129
            MA   TQ  +L  +      NT +I   FI S Y+++F LGL GN LV+ V+LR KAM T+TN FITNLA SDILM +VA PFTP ALY+++WTLP+ +CKLLP TM +SVYVSTLTS  I++DRYFVIV+PF +RMK   C  +++ +W +AIL S PLA Y +K
Sbjct:   88 MATPTTQSSMLTTSWDDAKKNTAVI--AFIFSLYAIVFFLGLPGNILVVHVVLRTKAMQTITNLFITNLAISDILMTLVATPFTPFALYVDSWTLPDALCKLLPTTMGVSVYVSTLTSTAIAVDRYFVIVHPFVLRMKKWLCLIIIITVWTIAILISMPLAVYQQK 251          

HSP 2 Score: 181.415 bits (459), Expect = 1.339e-90
Identity = 83/162 (51.23%), Postives = 118/162 (72.84%), Query Frame = -3
Query:  151 KKENDVLRNISTCHEKWPDNRWKGIYTVSSFIVQFVLPTIAISFCYFQISRTLQSRCNRXXXXXXXXXSRVLNDIKRKRKTNKMLIAMVVIFIVCWIPLNVLWIITDLIYSDEQSKLNTNLYFTTIFFICHLIAMCSALYNPFLYGWMNENFRQEFCSVFSC 636
            +K  D ++NI++C E+WP    + ++T+ SF++QFV+P   IS CY ++S+ L+ RC  K+   +KS  +   +I+RKR+TN MLIAMV+IF+VCWIPLNV WI+TD+I   + + +  N YFT IFF+CHL+AM SA+YNPFLY WMNENFR+EF  +  C
Sbjct:  250 QKNFDPIKNITSCQERWPREAAREVFTIVSFVLQFVVPCSIISVCYLKVSQILRMRCIVKIGSGVKSRYQGEQEIRRKRRTNTMLIAMVIIFVVCWIPLNVHWIVTDVINDGQINGVRRNKYFTLIFFVCHLLAMSSAVYNPFLYAWMNENFRKEFRRILPC 411          
BLAST of SMED30012106 vs. TrEMBL
Match: A0A183W5E7 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Trichobilharzia regenti OX=157069 GN=TRE_LOCUS7584 PE=4 SV=1)

HSP 1 Score: 172.94 bits (437), Expect = 4.658e-85
Identity = 77/163 (47.24%), Postives = 115/163 (70.55%), Query Frame = -3
Query:  148 KKENDVLRNISTCHEKWPDNRWKGIYTVSSFIVQFVLPTIAISFCYFQISRTLQSRCNRXXXXXXXXXSRVLNDIKRKRKTNKMLIAMVVIFIVCWIPLNVLWIITDLIYSDEQSKLNTNLYFTTIFFICHLIAMCSALYNPFLYGWMNENFRQEFCSVFSCW 636
            +K  D + N+S+C E WP    + ++T+ SF++QFV+P   IS CYF+IS  L+SR + ++    K+  +   +IKRKR+TN MLIAMVVIF++CWIPLN+LW++ D+   +  + + ++  F+ IFF+CHL+AM SA+YNPFLY WMN NFR+EF  +  C+
Sbjct:  189 QKHKDPMNNVSSCRENWPKESSREVFTIVSFVLQFVVPCSIISVCYFRISLLLRSRLHTQIGSGTKTQMKEEREIKRKRRTNTMLIAMVVIFVICWIPLNILWMVMDVHSEEHMNDVQSSKNFSLIFFVCHLLAMSSAVYNPFLYAWMNNNFRKEFHRIVPCF 351          

HSP 2 Score: 172.555 bits (436), Expect = 4.658e-85
Identity = 82/145 (56.55%), Postives = 111/145 (76.55%), Query Frame = -2
Query:  626 LILKTFIISSYSMIFVLGLSGNALVIFVILRNKAMYTVTNFFITNLAASDILMCIVAVPFTPIALYLENWTLPELVCKLLPMTMAISVYVSTLTSLVISIDRYFVIVYPFKVRMKLSFCRFLLVLIWGLAILASFPLAKYHKKRK 1060
            L +K  II+ YS I ++G++GN LV++++LR K + T+TN FI NLA SDILM +VA PFTP++LY+ NWTLPE VCKLLP TM +SVYVSTLTS+ I++DR+FVIV+PF  RMK+  C  ++  +W +A+L S PLA Y +K K
Sbjct:   48 LPVKLLIIALYSCITLMGVTGNLLVVWIVLRVKPLQTITNIFIANLAVSDILMSLVATPFTPLSLYMSNWTLPEAVCKLLPTTMGVSVYVSTLTSMAIALDRFFVIVHPFLPRMKIWLCFIIIFTVWIIAVLISMPLAVYQQKHK 192          
BLAST of SMED30012106 vs. TrEMBL
Match: A0A183N3J7 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS22872 PE=4 SV=1)

HSP 1 Score: 174.481 bits (441), Expect = 5.629e-84
Identity = 81/164 (49.39%), Postives = 119/164 (72.56%), Query Frame = -3
Query:  148 KKENDVLRNISTCHEKWPDNRWKGIYTVSSFIVQFVLPTIAISFCYFQISRTLQSRCNRXXXXXXXXXSRVLNDIKRKRKTNKMLIAMVVIFIVCWIPLNVLWIITDLIYSDEQ-SKLNTNLYFTTIFFICHLIAMCSALYNPFLYGWMNENFRQEFCSVFSCW 636
            +K  D + N+S+C E WP    + ++T+ SF++QFV+P   IS CYF+IS  L++R + ++    K+  +   +IKRKR+TN MLIAMVVIF++CWIPLN+LW++ D ++S+EQ + +  + +FT IFFICHL+AM SA+YNPFLY WMN NFR+EF  +  C+
Sbjct:  170 QKHKDPINNVSSCRENWPKESSREVFTIVSFVLQFVIPCSIISVCYFRISLLLRARLHTQIGSGTKTQMKEEREIKRKRRTNTMLIAMVVIFVICWIPLNILWMVMD-VHSEEQINDVQNSKHFTLIFFICHLLAMSSAVYNPFLYAWMNSNFRKEFHRILPCF 332          

HSP 2 Score: 167.162 bits (422), Expect = 5.629e-84
Identity = 81/145 (55.86%), Postives = 110/145 (75.86%), Query Frame = -2
Query:  626 LILKTFIISSYSMIFVLGLSGNALVIFVILRNKAMYTVTNFFITNLAASDILMCIVAVPFTPIALYLENWTLPELVCKLLPMTMAISVYVSTLTSLVISIDRYFVIVYPFKVRMKLSFCRFLLVLIWGLAILASFPLAKYHKKRK 1060
            L +K  II  YS I ++G++GN LV++++LR K + T+TN FI NLA SDILM +VA PFTP++LY+ +WTLPE VCKLLP TM +SVYVSTLTS+ I++DR+FVIV+PF  RMK+  C  ++  +W +A+L S PLA Y +K K
Sbjct:   29 LPVKLLIIILYSFITLIGVTGNLLVVWIVLRVKLLQTITNIFIANLAISDILMSLVATPFTPLSLYMNDWTLPEAVCKLLPTTMGVSVYVSTLTSMAIALDRFFVIVHPFLPRMKVWLCFIIIFTVWIIAVLISMPLAVYQQKHK 173          
BLAST of SMED30012106 vs. TrEMBL
Match: A0A183L098 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Schistosoma curassoni OX=6186 GN=SCUD_LOCUS20746 PE=4 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 7.913e-84
Identity = 82/164 (50.00%), Postives = 118/164 (71.95%), Query Frame = -3
Query:  148 KKENDVLRNISTCHEKWPDNRWKGIYTVSSFIVQFVLPTIAISFCYFQISRTLQSRCNRXXXXXXXXXSRVLNDIKRKRKTNKMLIAMVVIFIVCWIPLNVLWIITDLIYSDEQ-SKLNTNLYFTTIFFICHLIAMCSALYNPFLYGWMNENFRQEFCSVFSCW 636
            +K  D + N+S+C E WP    + ++T+ SF++QFV+P   IS CYF+IS  L++R + ++    K+  +   DIKRKR+TN MLIAMVVIF++CWIPLN+LW++ D ++S+EQ + +  +  FT IFFICHL+AM SA+YNPFLY WMN NFR+EF  +  C+
Sbjct:  170 QKHKDPINNVSSCRENWPKESSREVFTIVSFVLQFVIPCSIISVCYFRISLLLRARLHTQIGSGTKTHIKEERDIKRKRRTNTMLIAMVVIFVICWIPLNILWMVMD-VHSEEQINDVQNSKNFTLIFFICHLLAMSSAVYNPFLYAWMNSNFRKEFHRILPCF 332          

HSP 2 Score: 167.162 bits (422), Expect = 7.913e-84
Identity = 81/145 (55.86%), Postives = 110/145 (75.86%), Query Frame = -2
Query:  626 LILKTFIISSYSMIFVLGLSGNALVIFVILRNKAMYTVTNFFITNLAASDILMCIVAVPFTPIALYLENWTLPELVCKLLPMTMAISVYVSTLTSLVISIDRYFVIVYPFKVRMKLSFCRFLLVLIWGLAILASFPLAKYHKKRK 1060
            L +K  II  YS I ++G++GN LV++++LR K + T+TN FI NLA SDILM +VA PFTP++LY+ +WTLPE VCKLLP TM +SVYVSTLTS+ I++DR+FVIV+PF  RMK+  C  ++  +W +A+L S PLA Y +K K
Sbjct:   29 LPVKLLIIILYSFITLIGVTGNLLVVWIVLRVKLLQTITNIFIANLAISDILMSLVATPFTPLSLYMNDWTLPEAVCKLLPTTMGVSVYVSTLTSMAIALDRFFVIVHPFLPRMKVWLCFIIIFTVWIIAVLISMPLAVYQQKHK 173          
BLAST of SMED30012106 vs. Ensembl Cavefish
Match: npy2r (neuropeptide Y receptor Y2 [Source:ZFIN;Acc:ZDB-GENE-040924-8])

HSP 1 Score: 103.99 bits (258), Expect = 1.428e-43
Identity = 64/167 (38.32%), Postives = 102/167 (61.08%), Query Frame = -2
Query:  647 SLPFMAENQTQGIILLNTSKVLNSNTDLI-LKTFIISSYSMIFVLGLSGNALVIFVILRNKAMYTVTNFFITNLAASDILMCIVAVPFTPIALYLENWTLPELVCKLLPMTMAISVYVSTLTSLVISIDRYFVIVYPFKVRMKLSFCRFLLVLIW-GLAILASFPLA 1141
            SLP M   Q +G +L      L+ +T LI ++  +I +YS I + G++GNALVI+V+ + + ++TVTNFFI NLA +D+L+  + +PFT +      W   + +C LLP    ++V VST+T  +I++DRY  IV+  + +M    C  ++ + W   A+LAS PLA
Sbjct:   32 SLPIM---QDEGALL----DGLDDSTKLIGVQVILILAYSSIILFGVTGNALVIYVVYKFRNLHTVTNFFIVNLAVADLLVNTLCLPFTLMYTLYGEWKFGQAMCYLLPYAQGLAVNVSTITLNIIALDRYRSIVHHMETKMSKDVCAVVIAVTWVASAVLAS-PLA 190          

HSP 2 Score: 92.4337 bits (228), Expect = 1.428e-43
Identity = 61/180 (33.89%), Postives = 93/180 (51.67%), Query Frame = -3
Query:  130 SPLFLWLNITKKENDVLRNISTCHEKWPDNRWKG-IYTVSSFIVQFVLPTIAISFCYFQISRTLQSRCNRXXXXXXXXXSRVLNDIKRKRKTNKMLIAMVVIFIVCWIPLNVLWIITDLIYSDEQSKLNTNLYFTTIFFICHLIAMCSALYNPFLYGWMNENFRQEFCSVFSCWRSRRAL 666
            SPL ++      +    ++I  C EKWP +   G +Y++S F +Q+ LP   ISF Y +I   L+   +    +         +  +R++KT KML  +V +F V W+P +   +  D+  S  + K    LY  T+F   H++AMCSA  NP LYGWMN N+R  F +V  C R+   L
Sbjct:  187 SPLAIFREYVTFDLTPEQSIQGCAEKWPGSSTDGTVYSISMFFLQYGLPLSVISFAYARIWTKLRKHISPGGGRS--------DRHRRRQKTTKMLAVVVAVFAVSWLPFHAFQLAVDIDSSVLEMKDYKLLY--TVF---HIVAMCSAFANPILYGWMNRNYRGAFAAVCKCGRAESRL 353          
BLAST of SMED30012106 vs. Ensembl Cavefish
Match: npy7r (neuropeptide Y receptor type 2-like [Source:NCBI gene;Acc:103037035])

HSP 1 Score: 99.3673 bits (246), Expect = 1.803e-41
Identity = 57/169 (33.73%), Postives = 98/169 (57.99%), Query Frame = -2
Query:  629 AENQTQGIILLNTSK---VLNSNTDLILKTFIISSYSMIFVLGLSGNALVIFVILRNKAMYTVTNFFITNLAASDILMCIVAVPFTPIALYLENWTLPELVCKLLPMTMAISVYVSTLTSLVISIDRYFVIVYPFKVRMKLSFCRFLLVLIWGLAILASFPLAKYHKKR 1126
             E+   G   ++  K   V +    L ++  +I++Y++I +LGL GNALVI++I+  + M TVTN+FI NLA +D+++  + +PFT     L+ W    ++C ++P   A+SV+VS LT  VI+++RY  IV+    R+       ++ L W  A + + PLA + + R
Sbjct:   18 GEDHNLGNDTMDLHKPVFVDDITKHLSVQIALITAYTLIILLGLMGNALVIYMIVLYRNMRTVTNYFIANLALADLMVDTMCLPFTLAYTLLDEWKFGAVMCHMVPYAQALSVHVSILTLTVIALERYRCIVFHLGQRLTRCTSFIIITLTWAFAAILAGPLAIFREYR 186          

HSP 2 Score: 90.1225 bits (222), Expect = 1.803e-41
Identity = 65/179 (36.31%), Postives = 91/179 (50.84%), Query Frame = -3
Query:   88 ISTCHEKWPD--NRWKGIYTVSSFIVQFVLPTIAISFCYFQISRTLQ---SRCNRXXXXXXXXXSRVLNDIKRKRKTNKMLIAMVVIFIVCWIPLNVLWIITDLIYSDEQSKLNTNLYFTTIFFICHLIAMCSALYNPFLYGWMNENFRQEFCSVFSCWRSRRALLIEQNSTFRKNSKK 609
            I+ C EKWP   NR   IY++S  ++Q+V P   IS+ Y  I   L+   S  NR             ++I R++KT KML  +VV+F VCW+P +V  + +DL   D   K        T+F   H++AMCS   NP LYGWMN+N+R  F   F C    +   I    +FR  S +
Sbjct:  197 IAVCSEKWPHGTNRDAIIYSISMLLLQYVFPLGIISYAYVCIWVKLKNHVSPSNRN------------DNISRRKKTTKMLALVVVVFAVCWLPFHVFQLASDL---DLVLKFKEYKLLYTLF---HIVAMCSTFTNPLLYGWMNKNYRNGFLMFFRC--EHKPDTIHPEGSFRTRSLR 355          
BLAST of SMED30012106 vs. Ensembl Cavefish
Match: npffr2b (neuropeptide FF receptor 2-like [Source:NCBI gene;Acc:103031865])

HSP 1 Score: 106.301 bits (264), Expect = 6.419e-39
Identity = 59/124 (47.58%), Postives = 81/124 (65.32%), Query Frame = -2
Query:  668 ISSYSMIFVLGLSGNALVIFVILRNKAMYTVTNFFITNLAASDILMCIVAVPFTPIALYLENWTLPELVCKLLPMTMAISVYVSTLTSLVISIDRYFVIVYPFKVRMKLSFCRFLLVLIWGLAI 1039
            I SY +IFV+ + GN LV F++LR+K+M TVTN FI NLA SD+L+ I  +P T +   +  W    LVCKL  M   ISV  S  T +VI++DR+  IVYPFK ++ +S    ++V+IW LAI
Sbjct:   52 IVSYLLIFVVCMVGNGLVCFIVLRSKSMRTVTNLFILNLAISDLLVGIFCMPTTLVDNIITGWPFGSLVCKLSGMVQGISVSASVFTLVVIAVDRFRCIVYPFKQKLTISTSTVIIVIIWVLAI 175          

HSP 2 Score: 74.7146 bits (182), Expect = 6.419e-39
Identity = 50/176 (28.41%), Postives = 85/176 (48.30%), Query Frame = -3
Query:  136 LNITKKENDVLRNISTCHEKWPDNRWKGIYTVSSFIVQFVLPTIAISFCYFQISRTLQSRCNRXXXXXXXXXSRVLNDIKRKRKTNKMLIAMVVIFIVCWIPLNVLWIITDLIYSDEQSKLNTNLYFTTIFFICHLIAMCSALYNPFLYGWMNENFRQEFCSVF-----SCWRSRR 648
            ++I   E++  R    C E WP    + IYT   F   ++ P   I   Y +I  TL  +    +  +     R     ++K++  KML+ + ++FI+ W+PL  L +++D     E      N+Y   ++ + H +A C++  NP +YG+ NENFR+ F  VF     S  R +R
Sbjct:  193 VSILLGESNATRPFYWCRENWPSQEMRKIYTTVLFANIYLAPLTLIVIMYARIGITL-FKTAVPVPTRGGYEGRGHTVSRKKKRVIKMLLVVALLFILSWLPLWTLMMLSDYASLSEYQHRVINIY---VYPLAHWLAFCNSSVNPIIYGFFNENFRRGFQIVFKLQFCSAQRGKR 364          
BLAST of SMED30012106 vs. Ensembl Cavefish
Match: npffr2b (neuropeptide FF receptor 2-like [Source:NCBI gene;Acc:103031865])

HSP 1 Score: 106.301 bits (264), Expect = 3.094e-37
Identity = 59/124 (47.58%), Postives = 81/124 (65.32%), Query Frame = -2
Query:  668 ISSYSMIFVLGLSGNALVIFVILRNKAMYTVTNFFITNLAASDILMCIVAVPFTPIALYLENWTLPELVCKLLPMTMAISVYVSTLTSLVISIDRYFVIVYPFKVRMKLSFCRFLLVLIWGLAI 1039
            I SY +IFV+ + GN LV F++LR+K+M TVTN FI NLA SD+L+ I  +P T +   +  W    LVCKL  M   ISV  S  T +VI++DR+  IVYPFK ++ +S    ++V+IW LAI
Sbjct:   58 IVSYLLIFVVCMVGNGLVCFIVLRSKSMRTVTNLFILNLAISDLLVGIFCMPTTLVDNIITGWPFGSLVCKLSGMVQGISVSASVFTLVVIAVDRFRCIVYPFKQKLTISTSTVIIVIIWVLAI 181          

HSP 2 Score: 68.5514 bits (166), Expect = 3.094e-37
Identity = 52/190 (27.37%), Postives = 85/190 (44.74%), Query Frame = -3
Query:  136 LNITKKENDVLRNISTCHEKWPDNRWKGIYTVSSFIVQFVLPTIAISFCYFQISRTL-------QSRCNRXXXXXXXXX-------SRVLNDIKRKRKTNKMLIAMVVIFIVCWIPLNVLWIITDLIYSDEQSKLNTNLYFTTIFFICHLIAMCSALYNPFLYGWMNENFRQEFCSVF-----SCWRSRR 648
            ++I   E++  R    C E WP    + IYT   F   ++ P   I   Y +I  TL        +R     S              R     ++K++  KML+ + ++FI+ W+PL  L +++D     E      N+Y   ++ + H +A C++  NP +YG+ NENFR+ F  VF     S  R +R
Sbjct:  199 VSILLGESNATRPFYWCRENWPSQEMRKIYTTVLFANIYLAPLTLIVIMYARIGITLFKTAVPVPTRAGGSDSGTGSGSGKEGGYEGRGHTVSRKKKRVIKMLLVVALLFILSWLPLWTLMMLSDYASLSEYQHRVINIY---VYPLAHWLAFCNSSVNPIIYGFFNENFRRGFQIVFKLQFCSAQRGKR 385          
BLAST of SMED30012106 vs. Ensembl Cavefish
Match: prlhr2b (prolactin-releasing peptide receptor-like [Source:NCBI gene;Acc:103046295])

HSP 1 Score: 95.9005 bits (237), Expect = 2.839e-36
Identity = 56/141 (39.72%), Postives = 85/141 (60.28%), Query Frame = -2
Query:  638 KTFIISSYSMIFVLGLSGNALVIFVILRNKAMYTVTNFFITNLAASDILMCIVAVPFT-PIALYLENWTLPELVCKLLPMTMAISVYVSTLTSLVISIDRYFVIVYPFKVRMKLSFCRFLLVLIWGLA--ILASFPLAKYH 1051
            K  I+  Y ++ V+G+ GN L+I+VI R++ M+ VTN FI NLA SD+LMC+  VPFT   A     WT    +C L+ +   ++VYVS  T   I++DRY+  V+P K R+ +  C ++L  IW L+  ++A   +  YH
Sbjct:   64 KPLIVPCYVLVVVVGVFGNYLLIYVICRSRKMHNVTNVFIGNLAFSDMLMCVTCVPFTLAYAFNPRGWTFGRFMCYLVFLVQPVTVYVSVFTLTAIAVDRYYATVHPLKKRISMVACVYILSGIWLLSCTLVAPAVVHTYH 204          

HSP 2 Score: 75.8702 bits (185), Expect = 2.839e-36
Identity = 45/157 (28.66%), Postives = 83/157 (52.87%), Query Frame = -3
Query:  145 NISTCHEKW-PDNRWKGIYTVSSFIVQFVLPTIAISFCYFQISRTLQSRCNRXXXXXXXXXSRVLNDIKRKRKTNKMLIAMVVIFIVCWIPLNVLWIITDLIYSDEQSKLNTNLYFTTIFFICHLIAMCSALYNPFLYGWMNENFRQEFCSVFSCWR 612
            +++ C E W      + +Y  S+ ++ ++LP  A+   Y  IS  L++     ++   ++ ++      RKRK  +++  +V  F VCW+P++V  ++ D+       +L    +F  I  +CHL AM S+  NPFLY W+++ FR E   +F+C R
Sbjct:  211 DLTICEEFWLGQETERLVYAYSTLLITYILPLSAVCVSYLCISVKLRN----CVAPGHRTRAQAEAQRARKRKIFRLVSLVVAAFGVCWLPIHVFNVLRDI-----DIRLINKRHFLLIQLLCHLCAMSSSCCNPFLYAWLHDRFRAELRKIFTCRR 358          
BLAST of SMED30012106 vs. Ensembl Sea Lamprey
Match: prlh2r (prolactin releasing hormone 2 receptor [Source:ZFIN;Acc:ZDB-GENE-120411-41])

HSP 1 Score: 98.5969 bits (244), Expect = 5.960e-41
Identity = 52/126 (41.27%), Postives = 76/126 (60.32%), Query Frame = -2
Query:  680 LKTFIISSYSMIFVLGLSGNALVIFVILRNKAMYTVTNFFITNLAASDILMCIVAVPFTPIALY-LENWTLPELVCKLLPMTMAISVYVSTLTSLVISIDRYFVIVYPFKVRMKLSFCRFLLVLIW 1054
            LK F++  Y+ + V+G+ GN L+++VI R K M+ VTN  I NLA SD+LMC + VP T   ++    W     +C  + +   +SVYVS  T  VI++DRY V VYP + R+ +  C +LL  IW
Sbjct:   20 LKPFVVLFYTAVVVVGVLGNFLLVYVICRVKKMHNVTNLLIGNLAFSDLLMCAMCVPLTLAYVFDARGWVFGSFMCYFVFLMQPVSVYVSVFTLTVIAVDRYIVTVYPLRRRITIPTCGYLLAAIW 145          

HSP 2 Score: 86.6557 bits (213), Expect = 5.960e-41
Identity = 50/158 (31.65%), Postives = 85/158 (53.80%), Query Frame = -3
Query:  145 RNISTCHEKW-PDNRWKGIYTVSSFIVQFVLPTIAISFCYFQISRTLQSRCNRXXXXXXXXXSRVLNDIKRKRKTNKMLIAMVVIFIVCWIPLNVLWIITDLIYSDEQSKLNTNLYFTTIFFICHLIAMCSALYNPFLYGWMNENFRQEFCSVFSCWR 615
            + ++ C E W    R +  Y  S+ ++ + LP + IS  YF+IS  L++R    +     + ++   D  R+RKT ++L+ +V  F VCW+PL++   + D+       +L    YF  +  +CH  AM SA YNPF+Y W+++ FR E   +F+  R
Sbjct:  167 QRMTICEEFWIGTERERLAYAYSTLVLTYGLPLLVISLSYFKISVKLKNR----VVPGTVTQNQAEMDRARRRKTFRLLVLVVTAFSVCWLPLHIFNFLRDV-----DIRLIDKYYFNLVQLLCHWFAMSSACYNPFIYAWLHDRFRSELKKMFTVKR 315          
BLAST of SMED30012106 vs. Ensembl Sea Lamprey
Match: npy8br (neuropeptide Y receptor Y8b [Source:ZFIN;Acc:ZDB-GENE-980526-208])

HSP 1 Score: 87.0409 bits (214), Expect = 5.747e-34
Identity = 50/160 (31.25%), Postives = 88/160 (55.00%), Query Frame = -2
Query:  605 NSNTDLILKTFIISSYSMIFVLGLSGNALVIFVILRNKAMYTVTNFFITNLAASDILMCIVAVPFTPIALYLENWTLPELVCKLLPMTMAISVYVSTLTSLVISIDRYFVIVYPFKVRMKLSFCRFLLVLIWGLAILASFPLAKYH---KKRKRCIEEYF 1075
            +  T   +++F+I++Y ++  LGL GN+L++ VILR+  ++ VTN  I NLA SD+L+ +V +P T     +++W   E +CK  P     +V VS  + ++I+I+R+ +I+ P   +  L+     +  IW  A   S P   +H    +  R +  YF
Sbjct:   30 HCQTPQAVRSFVIATYCVLIALGLLGNSLLVLVILRHSELHNVTNILIVNLAFSDMLVGLVCLPLTIAYTLMDHWIFGEALCKGSPFLQCSAVSVSIFSLVLIAIERHQLIINPTGWKPSLNHAYVAIGAIWVTAFAMSSPFLAFHVLTDEPYRNLSHYF 189          

HSP 2 Score: 74.7146 bits (182), Expect = 5.747e-34
Identity = 47/151 (31.13%), Postives = 70/151 (46.36%), Query Frame = -3
Query:  151 TCHEKWPDNRWKGIYTVSSFIVQFVLPTIAISFCYFQISRTLQSRCNRXXXXXXXXXSRVLNDIKRKRKTNKMLIAMVVIFIVCWIPLNVLWIITDLIYSDEQSKLNTNLYFTTIFFICHLIAMCSALYNPFLYGWMNENFRQEFCSVFSC 603
             C E WP +  K  +T S  + QF  P + +  CY +I   L+ R     + +    + V       +K N ML+A+V  F +CW+PL     +     SD    L  +     IF +CHL AM S   NP  YG++N NF++E  +   C
Sbjct:  197 ACIELWPSDTSKFAFTTSLLVFQFSCPLLFVFLCYLRIFLRLRQRKKMLPTGREGGGNGV--RASHMKKINMMLVAIVAGFAICWLPLYAFNAV-----SDWNPTLLLHCQHDLIFSLCHLTAMLSICINPIFYGFLNNNFQKELKATILC 340          
BLAST of SMED30012106 vs. Ensembl Sea Lamprey
Match: si:dkey-202l22.3 (prolactin releasing hormone receptor [Source:HGNC Symbol;Acc:HGNC:4464])

HSP 1 Score: 88.9669 bits (219), Expect = 3.068e-32
Identity = 47/128 (36.72%), Postives = 73/128 (57.03%), Query Frame = -2
Query:  680 LILKTFIISSYSMIFVLGLSGNALVIFVILRNKAMYTVTNFFITNLAASDILMCIVAVPFTPI-ALYLENWTLPELVCKLLPMTMAISVYVSTLTSLVISIDRYFVIVYPFKVRMKLSFCRFLLVLIW 1060
            L LK   I  Y+++ ++G+SGN L+I VI R K ++  TNF + NLA SD+L+C+  VP +   A     W    L+C L+ +    +V+VS L+   I++DRY V+ YP + R+ +  C      IW
Sbjct:   64 LSLKQIFIPLYALLTLVGVSGNLLLILVIARTKRLHNATNFLLGNLALSDLLVCLTCVPISAAFAFEPRGWVYGALLCYLVALLQPATVHVSVLSLTAIALDRYVVVAYPIRRRVAVRSCALTAGFIW 191          

HSP 2 Score: 67.0106 bits (162), Expect = 3.068e-32
Identity = 42/146 (28.77%), Postives = 73/146 (50.00%), Query Frame = -3
Query:  172 CHEKW---PDNRWKGIYTVSSFIVQFVLPTIAISFCYFQISRTLQSRCNRXXXXXXXXXSRVLNDIKRKRKTNKMLIAMVVIFIVCWIPLNVLWIITDLIYSDEQSKLNTNLYFTTIFFICHLIAMCSALYNPFLYGWMNENFRQE 600
            C E W    D R    Y+ +  IV ++LP +A+S  Y  IS TL+ R     +    +  R  +  +++RKT ++L+  V  F +CW+PL ++++     +  +      N +F  I   CH +AM S  +NPF+Y  ++  F + 
Sbjct:  218 CEELWTGLEDQRLA--YSCAMMIVSYLLPLLAVSASYCAISLTLRGRVPPGGAHCTVNARRTWH--QKRRKTFRLLVMSVGTFALCWLPLQLVYL-----FRLKDPTCTPNEHFYVIQLCCHWVAMSSTCWNPFIYASLHHKFARA 354          
BLAST of SMED30012106 vs. Ensembl Sea Lamprey
Match: npffr1l3 (neuropeptide FF receptor 1 like 3 [Source:ZFIN;Acc:ZDB-GENE-070424-44])

HSP 1 Score: 93.5893 bits (231), Expect = 1.914e-31
Identity = 49/122 (40.16%), Postives = 77/122 (63.11%), Query Frame = -2
Query:  668 SYSMIFVLGLSGNALVIFVILRNKAMYTVTNFFITNLAASDILMCIVAVPFTPIALYLENWTLPELVCKLLPMTMAISVYVSTLTSLVISIDRYFVIVYPFKVRMKLSFCRFLLVLIWGLAI 1033
            +Y  IF+L + GN LV +V+L+++ M TVTN FI NLA SD+L+ I  +P T +   +  W    +VCK+  +    SV  S  T + I++DR+  IVYPFK ++++S   F +++IW LA+
Sbjct:   55 AYLFIFLLCMIGNGLVCYVVLQSRRMRTVTNLFILNLAVSDLLVGIFCMPITLVDNLITGWPFGVVVCKMSGLVQGTSVSASVFTLVAIAVDRFRCIVYPFKRKLRISHALFTILVIWALAL 176          

HSP 2 Score: 59.6918 bits (143), Expect = 1.914e-31
Identity = 43/167 (25.75%), Postives = 71/167 (42.51%), Query Frame = -3
Query:  157 TKKENDVLRNISTCHEKWPDNRWKGIYTVSSFIVQFVLPTIAISFCYFQISRTLQS------RCNRXXXXXXXXXSRVLNDIKRKRKTNKMLIAMVVIFIVCWIPLNVLWIITDLIYSDEQSKLNTNLYFTTIFFICHLIAMCSALYNPFLYGWMNENFRQEFCSVF 639
            +   ND    +  C E WPD R +  YT   F   ++ P   I   Y +I   L S            +             +R+ K  KMLI + ++F++ W+PL   W +  L+     S  +       ++ + H +A  ++  NP +YG+ NENFR+ F + F
Sbjct:  199 SDGSNDT-HPLHQCWEAWPDPRMRKAYTTVLFANVYLAPLALILLMYARIGFRLCSLSASAAAAASAAAPSRGGGGGATGVTRRRVKVIKMLIIVAMLFMLSWLPL---WTVMMLVDYANLSPWDLAFLNMYVYPVAHWLAFFNSSVNPIVYGYFNENFRRGFQAAF 361          
BLAST of SMED30012106 vs. Ensembl Sea Lamprey
Match: sstr1a (somatostatin receptor 1a [Source:ZFIN;Acc:ZDB-GENE-090429-1])

HSP 1 Score: 78.5666 bits (192), Expect = 3.952e-28
Identity = 44/140 (31.43%), Postives = 80/140 (57.14%), Query Frame = -2
Query:  629 IISSYSMIFVLGLSGNALVIFVILRNKAMYTVTNFFITNLAASDILMCIVAVPFTPIALYLENWTLPELVCKLLPMTMAISVYVSTLTSLVISIDRYFVIVYPFKVR--MKLSFCRFLLVLIWGLAILASFPLAKYHKKR 1042
            ++++YS++ ++GL GN++VI+VILR   M T TN +I NLA +D L  +++VPF   +  L +W     +C+L+     I+++ S     V++ DRY  +V+P K     + S  + +   +W L+++   P+  Y   R
Sbjct:   16 VMAAYSLVCLVGLFGNSMVIYVILRYAKMKTATNIYILNLAVADELF-MMSVPFLATSTALHHWPFGSSLCRLVLSVDGINMFTSVFCLTVLTFDRYVAVVHPIKAARYRRPSVAKTINAAVWALSMVIILPIVVYADTR 154          

HSP 2 Score: 63.5438 bits (153), Expect = 3.952e-28
Identity = 36/145 (24.83%), Postives = 69/145 (47.59%), Query Frame = -3
Query:  169 TCHEKWPDNRWKGIYTVSSFIVQFVLPTIAISFCYFQISRTLQSRCNRXXXXXXXXXSRVLNDIKRKRKTNKMLIAMVVIFIVCWIPLNVLWIITDLIYSDEQSKLNTNLYFTTIFFICHLIAMCSALYNPFLYGWMNENFRQEF 603
             C+  WP   W   + V +F V F+LP  AI  CY  I   +++   R   ++ K         + +RK   M+  +V +F+ CW+P  V+ ++   ++  +Q          T+  +  ++   ++  NP LYG+++++FR  F
Sbjct:  162 VCNLLWPRPEWSAAFVVYTFTVGFLLPVAAICLCYALIVAKMRAVALRAGWQQRK---------RSERKVTLMVTMVVAVFVACWMPFYVVQLVN--VFEGQQGA--------TVNQLAVILGYANSCANPILYGFLSDSFRHSF 287          
BLAST of SMED30012106 vs. Ensembl Nematostella
Match: EDO44418 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVN5])

HSP 1 Score: 102.064 bits (253), Expect = 6.093e-32
Identity = 55/145 (37.93%), Postives = 84/145 (57.93%), Query Frame = -2
Query:  608 SYSMIFVLGLSGNALVIFVILRNKAMYTVTNFFITNLAASDILMCIVAVPFTPIALYLENWTLPELVCKLLPMTMAISVYVSTLTSLVISIDRYFVIVYPFKVRMKLSFCRFLLVLIWGLAILASFPL---AKYHKKRKRCIEEY 1033
            +Y+ I  L L GN +VIF + RN+ M +VTN FI NLAASD+L+  + +P     LY   W    ++CKL+    ++SV  S LT L I+ DR+  I++PF+ RM     + +++LIW L++    PL    K H    +C E++
Sbjct:    2 AYATIIALSLVGNTVVIFTVCRNRHMKSVTNLFIANLAASDLLITFLGMPHQITELYTTEWMFGTVLCKLVVYLQSVSVGSSVLTLLAITKDRFVAIIFPFRPRMSFKTAKTIIMLIWSLSLGIMAPLIYATKVHN--NQCTEDW 144          

HSP 2 Score: 53.5286 bits (127), Expect = 6.093e-32
Identity = 46/149 (30.87%), Postives = 74/149 (49.66%), Query Frame = -3
Query:  169 CHEKW-PDNRWKGI---YTVSSFIVQFVLPTIAISFCYFQISRTLQSRCNRXXXXXXXXXSRVLNDIKRKRKTNKMLIAMVVIFIVCWIPLNVLWIITDLI-YSDEQSKLNTNLYFTTIFFICHLIAMCSALYNPFLYGWMNENFRQEF 600
            C E W P    K     YTV  F++ + +P + ++  Y  I R L  R  R       + S+  N++ RK K  KMLI ++++F   W+PL+V   I+    +  + S  NT LYF ++F     +   ++  NP+LY   N+N+R  F
Sbjct:  140 CTEDWTPAFDAKTAPRDYTVVLFVMLYAVPMLTMAVLYAIIVRKLWRR-RRIGEVIPSASSK--NEVSRK-KVIKMLITVIMLFTFSWLPLHVFSFISFFAPFCPDTS--NTALYFVSLF-----LGHGNSAANPYLYALFNQNYRDGF 277          
BLAST of SMED30012106 vs. Ensembl Nematostella
Match: EDO46084 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR06])

HSP 1 Score: 77.7962 bits (190), Expect = 3.566e-30
Identity = 45/141 (31.91%), Postives = 77/141 (54.61%), Query Frame = -2
Query:  710 MAENQTQGIILLNTSKVLNSNTDLILKTFIISSYSMIFVLGLSGNALVIFVILRNKAMYTVTNFFITNLAASDILMCIVAVPFT-PIALYLENWTLPELVCKLLPMTMAISVYVSTLTSLVISIDRYFVIVYPFKVRMKLS 1129
            +A N TQG+   + S        +  K   +S Y++IF++   GN+LV  VI R + M TVTN+FI NLA +D+ + ++ +PF  P+      W     +CK++     + ++ S  T + +S++R++ IVYP +  M  S
Sbjct:   12 LARN-TQGV--FSHSGGDTGGESMTFKVLKLSLYALIFLISTVGNSLVCIVIARRRRMRTVTNYFILNLAIADLAITLICIPFDIPVQENGYKWPYGAFMCKIMYPLQTMCMFASIFTLVAVSLNRFWAIVYPLRQEMSKS 149          

HSP 2 Score: 71.633 bits (174), Expect = 3.566e-30
Identity = 46/156 (29.49%), Postives = 74/156 (47.44%), Query Frame = -3
Query:  151 LRNISTCHEKWPDNRWKGIYTVSSFIVQFVLPTIAISFCYFQISRTLQSRCNRXXXXXXXXXSRVLNDIKRKRKTNKMLIAMVVIFIVCWIPLNVLWIITDLIYSDEQSKLNTNLYFTTIFFICHLIAMCSALYNPFLYGWMNENFRQEFCSVFSC 618
            L+N   C E WP+  ++  YT   F+VQ++LP   I+F Y +I   L+ +C    +           D    RK  +MLI + ++F +C +P NV+W+  D    ++   +   +  T I      I   ++  NP  Y   NE FR+EF   F+C
Sbjct:  175 LKNGDDCSESWPEPGYRKAYTACIFVVQYLLPLTLIAFAYLKIGFELR-KCVGTRTANSALERAKQED---TRKVVRMLIIVTLLFAMCVLPNNVMWLWLDFGNGNDYEHIWEMVAVTNI------ILFANSATNPVAYTICNERFREEFRLYFTC 320          
BLAST of SMED30012106 vs. Ensembl Nematostella
Match: EDO46030 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR08])

HSP 1 Score: 77.7962 bits (190), Expect = 1.541e-29
Identity = 48/140 (34.29%), Postives = 83/140 (59.29%), Query Frame = -2
Query:  605 GNALVIFVILRNKAMYTVTNFFITNLAASDILMCIVAVPFT-PIALYLENWTLPELVCKLL-PM-TMAISVYVSTLTSLVISIDRYFVIVYPFKVRMKLSFCRFLLVLIWGLAILASFPLAKY-----HKKRKRCIEEYF 1000
            GN+L +FVI+R + M TVTN+FI NLA +D+ + ++ +PF  P+      W     +CK+L P+ TM +   V TLTS  +S+ RY  I++P + ++ +   + + V IW L+++   P++ Y     HK+  +  EE++
Sbjct:   21 GNSLTVFVIMRRRKMKTVTNYFILNLAIADLTLTLICIPFDIPVQEMDYIWPYGPFMCKILYPLQTMCLFASVFTLTS--VSVARYRAIIHPLRPQLTVKRAKVITVFIWMLSVV---PVSPYIYVLEHKEETQYCEEHW 155          

HSP 2 Score: 69.707 bits (169), Expect = 1.541e-29
Identity = 39/142 (27.46%), Postives = 77/142 (54.23%), Query Frame = -3
Query:  175 CHEKWPDNRWKGIYTVSSFIVQFVLPTIAISFCYFQISRTLQSRCNRXXXXXXXXXSRVLNDIKRKRKTNKMLIAMVVIFIVCWIPLNVLWIITDLIYSDEQSKLNTNLYFTTIFFICHLIAMCSALYNPFLYGWMNENFRQ 600
            C E W D + + IYTV+ F++Q+++P   I+  Y +I + L ++     +K ++S        +  RK  +MLIA+  +F VC +P N++W+  D   +D+       +YF  +   C+++   ++  NP  Y  +N+++R+
Sbjct:  151 CEEHWVDTKSRKIYTVTLFVIQYIIPLSLITAAYARIGKELGAKKLHADNKHLQSA-----QAEEARKVIRMLIAVTALFAVCVLPTNIMWLWLDFGKADQ-----VFVYFWEVVAFCNIMTFANSAANPVCYTLLNDHYRR 282          
BLAST of SMED30012106 vs. Ensembl Nematostella
Match: EDO49619 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFL1])

HSP 1 Score: 74.7146 bits (182), Expect = 2.073e-29
Identity = 42/127 (33.07%), Postives = 70/127 (55.12%), Query Frame = -2
Query:  653 YSMIFVLGLSGNALVIFVILRNKAMYTVTNFFITNLAASDILMCIVAVPFT-PIALYLENWTLPELVCKLLPMTMAISVYVSTLTSLVISIDRYFVIVYPFKVRMKLSFCRFLLVLIWGLAILASFP 1030
            +++IF++G+ GN+LV  VI +   M    N+ I NLA +DI + +V +PF   I +Y + W L   +CK++  +M      S  T   IS DRY  +V+P+K R+ +     ++V  W ++ L   P
Sbjct:    2 FAIIFIVGVVGNSLVCLVIFKTPNMRNTRNYLIVNLAIADITVALVCIPFDVVIRVYGDTWVLGAAMCKMVWPSMTFVATCSAATLAAISFDRYRAVVHPWKPRLSMRQTLAVIVSTWLVSFLVVLP 128          

HSP 2 Score: 72.4034 bits (176), Expect = 2.073e-29
Identity = 43/154 (27.92%), Postives = 80/154 (51.95%), Query Frame = -3
Query:  151 TCHEKWPDNRWKGIYTVSSFIVQFVLPTIAISFCYFQISRTLQSRCNRXXXXXXXXXSRVLNDIKRKRKTN---KMLIAMVVIFIVCWIPLNVLWIITDLIYSDEQSKLNTNLYFTTIFFICHLIAMCSALYNPFLYGWMNENFRQEFCSVFSC 603
            +C E W  +  + +YTV  F+  + LP + I+F Y +++  L+ + NR         +++ + I    K N   KML+ +V+I+ +C +P  VLW+  +    +E   +NT L FT       ++   +++ NPFLY  +N+ F++ F  +  C
Sbjct:  139 SCTEFWLKDIHRQLYTVFLFVFAYALPLVIIAFAYSRVALKLREQSNR------IEKNKLASGIPSSSKYNWITKMLVTVVLIYALCLLPNQVLWLWMEFGTGNEFEHMNTLLTFT------GMLVYINSIVNPFLYAGLNDEFKKGFARLLCC 280          
BLAST of SMED30012106 vs. Ensembl Nematostella
Match: EDO40944 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5Q4])

HSP 1 Score: 78.1814 bits (191), Expect = 4.850e-27
Identity = 42/125 (33.60%), Postives = 74/125 (59.20%), Query Frame = -2
Query:  653 MIFVLGLSGNALVIFVILRNKAMYTVTNFFITNLAASDILMCIVAVPFT-PIALYLENWTLPELVCKLLPMTMAISVYVSTLTSLVISIDRYFVIVYPFKVRMKLSFCRFLLVLIWGLAILASFP 1024
            +IF++   GN+LV  VILR + M TVTN+F+ NLA +D+ +  + +PF  P+      W     +CK+L     +S++ S  T   +S+ RY+ IV+P + ++ +S  + ++V IW ++I+   P
Sbjct:    2 IIFLISAVGNSLVCIVILRRRRMKTVTNYFVLNLAIADLALTCICIPFDIPVQEMNYVWPYGGFMCKILYPLQTLSLFASVFTLTAVSLTRYWAIVHPLRQQLSVSNSKRIIVAIWVISIIPVSP 126          

HSP 2 Score: 60.8474 bits (146), Expect = 4.850e-27
Identity = 42/149 (28.19%), Postives = 72/149 (48.32%), Query Frame = -3
Query:  163 TCHEKWPDNRWKGIYTVSSFIVQFVLPTIAISFCYFQISRTLQSRCNRXXXXXXXXXSRVLNDI--KRKRKTNKMLIAMVVIFIVCWIPLNVLWIITDLIYSDEQSKLNTNLYFTTIFFICHLIAMCSALYNPFLYGWMNENFRQEFCS 603
            +C E W D   + +YT   F+ Q+VLP   I+  Y  I   L+ R  R  S         L D+  +  RK  +ML  + V+F V  +P N++W+  D  +++++        F  +   C+++   ++  NP  Y  +NE +R+EF S
Sbjct:  139 SCEENWGDTSMRKVYTAVLFMFQYVLPLTVIAGAYIGIGIELRKRQTRDRSGG-------LRDVHAEETRKVLRMLKVVTVVFAVFVLPTNIMWLWLDFGHAEQEYD-----RFWDLVAFCNIVTFANSAANPICYTVLNETYRKEFKS 275          
BLAST of SMED30012106 vs. Ensembl Medaka
Match: npy2rl (neuropeptide Y receptor type 2 [Source:NCBI gene;Acc:101162714])

HSP 1 Score: 105.531 bits (262), Expect = 1.913e-47
Identity = 58/142 (40.85%), Postives = 89/142 (62.68%), Query Frame = -2
Query:  635 LILKTFIISSYSMIFVLGLSGNALVIFVILRNKAMYTVTNFFITNLAASDILMCIVAVPFTPIALYLENWTLPELVCKLLPMTMAISVYVSTLTSLVISIDRYFVIVYPFKVRMKLSFCRFLLVLIWGLAILASFPLAKYHK 1060
            L ++  +I +YS I VLG+ GN+LVI+VI R K + TVTNFFI NLA +D+L+  + +PFT +      W     +C LLP    ++V+VST+T  VI++DR+  IVY  + RM+   C  ++ L W L+ + + PLA + +
Sbjct:   59 LSVQVVLILAYSTIIVLGVLGNSLVIYVIYRFKTLRTVTNFFIANLAVADLLVNTLCLPFTLVYTLQGEWKFGSTLCFLLPYAQGLAVHVSTVTLNVIALDRHRCIVYHLETRMRKDVCFGVIALTWVLSAVLASPLAIFRE 200          

HSP 2 Score: 103.99 bits (258), Expect = 1.913e-47
Identity = 60/158 (37.97%), Postives = 83/158 (52.53%), Query Frame = -3
Query:  142 NISTCHEKWPDNRWKG-IYTVSSFIVQFVLPTIAISFCYFQISRTLQSRCNRXXXXXXXXXSRVLNDIKRKRKTNKMLIAMVVIFIVCWIPLNVLWIITDLIYSDEQSKLNTNLYFTTIFFICHLIAMCSALYNPFLYGWMNENFRQEFCSVFSCWRS 612
             I  C EKWP     G IY++S  I+Q+ LP   ISF Y +I   L+   +        S        +R+RKT KML+ MVV+F V W+P +   + TD+      +K+     F  ++ I H++AMCS   NP LYGWMN N+R  F +VF C R 
Sbjct:  211 TIQVCTEKWPGKSTDGTIYSISMLILQYFLPLSIISFAYARIWSKLRGHVSPAEGGANSSAGS--ERHRRRRKTTKMLVTMVVVFAVSWLPFHAFQLATDI-----DNKVLDMRDFRLLYTIFHVVAMCSTFANPLLYGWMNRNYRAAFLAVFKCRRG 361          
BLAST of SMED30012106 vs. Ensembl Medaka
Match: npy2rl (neuropeptide Y receptor type 2 [Source:NCBI gene;Acc:101162714])

HSP 1 Score: 105.531 bits (262), Expect = 1.913e-47
Identity = 58/142 (40.85%), Postives = 89/142 (62.68%), Query Frame = -2
Query:  635 LILKTFIISSYSMIFVLGLSGNALVIFVILRNKAMYTVTNFFITNLAASDILMCIVAVPFTPIALYLENWTLPELVCKLLPMTMAISVYVSTLTSLVISIDRYFVIVYPFKVRMKLSFCRFLLVLIWGLAILASFPLAKYHK 1060
            L ++  +I +YS I VLG+ GN+LVI+VI R K + TVTNFFI NLA +D+L+  + +PFT +      W     +C LLP    ++V+VST+T  VI++DR+  IVY  + RM+   C  ++ L W L+ + + PLA + +
Sbjct:   59 LSVQVVLILAYSTIIVLGVLGNSLVIYVIYRFKTLRTVTNFFIANLAVADLLVNTLCLPFTLVYTLQGEWKFGSTLCFLLPYAQGLAVHVSTVTLNVIALDRHRCIVYHLETRMRKDVCFGVIALTWVLSAVLASPLAIFRE 200          

HSP 2 Score: 103.99 bits (258), Expect = 1.913e-47
Identity = 60/158 (37.97%), Postives = 83/158 (52.53%), Query Frame = -3
Query:  142 NISTCHEKWPDNRWKG-IYTVSSFIVQFVLPTIAISFCYFQISRTLQSRCNRXXXXXXXXXSRVLNDIKRKRKTNKMLIAMVVIFIVCWIPLNVLWIITDLIYSDEQSKLNTNLYFTTIFFICHLIAMCSALYNPFLYGWMNENFRQEFCSVFSCWRS 612
             I  C EKWP     G IY++S  I+Q+ LP   ISF Y +I   L+   +        S        +R+RKT KML+ MVV+F V W+P +   + TD+      +K+     F  ++ I H++AMCS   NP LYGWMN N+R  F +VF C R 
Sbjct:  211 TIQVCTEKWPGKSTDGTIYSISMLILQYFLPLSIISFAYARIWSKLRGHVSPAEGGANSSAGS--ERHRRRRKTTKMLVTMVVVFAVSWLPFHAFQLATDI-----DNKVLDMRDFRLLYTIFHVVAMCSTFANPLLYGWMNRNYRAAFLAVFKCRRG 361          
BLAST of SMED30012106 vs. Ensembl Medaka
Match: npy7r (PRELI domain-containing protein 1, mitochondrial [Source:NCBI gene;Acc:101174272])

HSP 1 Score: 99.7525 bits (247), Expect = 1.303e-42
Identity = 59/178 (33.15%), Postives = 91/178 (51.12%), Query Frame = -3
Query:   82 ISTCHEKWPDN--RWKGIYTVSSFIVQFVLPTIAISFCYFQISRTLQSRCNRXXXXXXXXXSRVLNDIKRKRKTNKMLIAMVVIFIVCWIPLNVLWIITDLIYSDEQSKLNTNLYFTTIFFICHLIAMCSALYNPFLYGWMNENFRQEFCSVFSCWRSRRALLIEQNSTFRKNSKKHP 609
            I+ C EKWP    R   IY++   ++Q+++P   IS+ Y  I   L++  +              ++I R++KT KML  +VV+F  CW+P +V  + +DL   D   +     +  T+F   H++AMCS   NP LYGWMN+N+R  F  VF C     +   E   +FR  S + P
Sbjct:  195 IAVCSEKWPHGTSRDGVIYSLFMLLLQYIIPLAVISYAYICIWVKLKNHISPSSRN---------DNINRRKKTTKMLALVVVVFATCWLPFHVFQLASDL---DLVLRFEEYKFIYTVF---HVVAMCSTFANPLLYGWMNKNYRNGFLMVFRCEDKPESFHPE--GSFRTRSVRGP 355          

HSP 2 Score: 93.2041 bits (230), Expect = 1.303e-42
Identity = 62/172 (36.05%), Postives = 104/172 (60.47%), Query Frame = -2
Query:  617 QGIILLNTSKVLNS---NTD----LILKTFIISSYSMIFVLGLSGNALVIFVILRNKAMYTVTNFFITNLAASDILMCIVAVPFTPIALYLENWTLPELVCKLLPMTMAISVYVSTLTSLVISIDRYFVIVYPFKVRMKLSFCRFLLVLIWGLAILASFPLAKYHKKRKRCI 1111
            +G   LN S  L+    +TD    L ++  +I++YS+I +LGL GN+LVI++I+R + M TVTNFFI NLA +D+L+  + +PFT +   L+ W    ++C ++P   A+SV+VS LT  VI+++RY  IV+    R+       ++   W ++ + + PLA + + R+  I
Sbjct:   17 EGNFQLNDSMGLHQPGFHTDITKHLGVQITLITAYSLIILLGLLGNSLVIYMIIRYRNMRTVTNFFIANLALADLLVNTLCLPFTLVYTLLDEWKFGAVLCHMVPFAQALSVHVSILTLTVIALERYRCIVFHLGRRLTWHSSLLIMAFTWTVSAVLAAPLAIFREYRQEEI 188          
BLAST of SMED30012106 vs. Ensembl Medaka
Match: prlhr2a (prolactin-releasing peptide receptor [Source:NCBI gene;Acc:101174270])

HSP 1 Score: 103.605 bits (257), Expect = 6.143e-39
Identity = 53/125 (42.40%), Postives = 77/125 (61.60%), Query Frame = -2
Query:  680 KTFIISSYSMIFVLGLSGNALVIFVILRNKAMYTVTNFFITNLAASDILMCIVAVPFT-PIALYLENWTLPELVCKLLPMTMAISVYVSTLTSLVISIDRYFVIVYPFKVRMKLSFCRFLLVLIW 1051
            K  II SY+++ ++G+ GN L+++VI R++ M+ VTNFFI NLA SD+LMC   VPFT   A     W     +C L+ +   ++VYVS  T   I +DRY+  V+P K R+ +  C +LL  IW
Sbjct:   55 KLLIIPSYTVVALVGIFGNYLLLYVICRSRKMHNVTNFFIGNLAFSDMLMCATWVPFTLAYAFNPHGWVFGRFMCYLVYLIQPVTVYVSVFTLTAIGVDRYYATVHPLKKRISVLACTYLLSGIW 179          

HSP 2 Score: 77.0258 bits (188), Expect = 6.143e-39
Identity = 53/168 (31.55%), Postives = 82/168 (48.81%), Query Frame = -3
Query:  115 RNISTCHEKW-PDNRWKGIYTVSSFIVQFVLPTIAISFCYFQISRTLQSRCNRXXXXXXXXXSRVLNDIKRKRKTNKMLIAMVVIFIVCWIPLNVLWIITDLIYSDEQSKLNTNLYFTTIFFICHLIAMCSALYNPFLYGWMNENFRQEFCSVFSCWRSRRALLIEQN 615
               + C E W    R +  Y  S+ ++ +VLP   +   Y  IS  L+S     +     + S+      RKRKT +++  +V  F VCW+P++V  ++ D+        L    YF  I  +CHL AM S+  NPFLY W+++ FR E   +F+C   RR + I  N
Sbjct:  201 EGFTICEEFWMGQERERLAYAYSTLLITYVLPLSTLCISYLCISVKLRS----CVVPGHHTQSQAEAQRMRKRKTFRLVSLVVAAFGVCWMPISVFNVLRDI-----DIDLIDKRYFLLIQLLCHLCAMSSSCCNPFLYAWLHDRFRAELRKMFTC---RRRIGISAN 356          
BLAST of SMED30012106 vs. Ensembl Medaka
Match: ENSORLT00000042596.1 (neuropeptide FF receptor 2 [Source:NCBI gene;Acc:101169169])

HSP 1 Score: 101.679 bits (252), Expect = 1.816e-36
Identity = 56/126 (44.44%), Postives = 82/126 (65.08%), Query Frame = -2
Query:  668 FIISSYSMIFVLGLSGNALVIFVILRNKAMYTVTNFFITNLAASDILMCIVAVPFTPIALYLENWTLPELVCKLLPMTMAISVYVSTLTSLVISIDRYFVIVYPFKVRMKLSFCRFLLVLIWGLAI 1045
            FIIS Y +IF++ + GN +V F++LR+K M+TVTN FI NLA SD+L+ I  +P T +   +  W    LVCK+  M   ISV  S  T + I++DR+  IVYPFK ++ +S    ++V+IW LA+
Sbjct:   95 FIIS-YLLIFLVCMVGNGVVCFIVLRSKNMWTVTNLFILNLAVSDLLVGIFCMPTTLLDNIITGWPFGSLVCKMSGMVQGISVSASVFTLVAIAVDRFRCIVYPFKQKLTISTATMIIVIIWVLAV 219          

HSP 2 Score: 70.8626 bits (172), Expect = 1.816e-36
Identity = 46/148 (31.08%), Postives = 74/148 (50.00%), Query Frame = -3
Query:  157 CHEKWPDNRWKGIYTVSSFIVQFVLPTIAISFCYFQISRTLQSRCNRXXXXXXXXXSRVLNDIKRKRKTNKMLIAMVVIFIVCWIPLNVLWIITDLIYSDEQSKLNTNLYFTTIFFICHLIAMCSALYNPFLYGWMNENFRQEFCSVF 600
            C E WP+   + IYT   F   ++ P   I   Y +I  TL         K  +      N  K+K++  KML+ + ++FI+ W+PL  L +++D     EQ     N+Y   ++   H +A  ++  NP +YG+ NENFR+ F +VF
Sbjct:  253 CKEDWPNQEMRKIYTTVLFANIYLAPLSLIVIMYARIGITLFKTTVPTGGKPGQENRH--NVSKKKQRVIKMLLVVALLFIMSWLPLWTLMMLSDYARLTEQQYRIINIY---VYPFAHWLAFFNSSVNPIIYGFFNENFRRGFQAVF 395          
BLAST of SMED30012106 vs. Planmine SMEST
Match: SMESG000066072.1 (SMESG000066072.1)

HSP 1 Score: 418.313 bits (1074), Expect = 0.000e+0
Identity = 211/212 (99.53%), Postives = 212/212 (100.00%), Query Frame = -3
Query:    1 KKENDVLRNISTCHEKWPDNRWKGIYTVSSFIVQFVLPTIAISFCYFQISRTLQSRCNRXXXXXXXXXSRVLNDIKRKRKTNKMLIAMVVIFIVCWIPLNVLWIITDLIYSDEQSKLNTNLYFTTIFFICHLIAMCSALYNPFLYGWMNENFRQEFCSVFSCWRSRRALLIEQNSTFRKNSKKHPISDYHLSLIEANKKPHNKLLNEFSQFS 636
            KKENDVLRNISTCHEKWPDNRWKGIYTVSSFIVQFVLPTIAISFCYFQISRTLQSRCNRKLSKKIKSLSRVLNDIKRKRKTNKMLIAMVVIFIVCWIPLNVLWIITDLIYSDEQSKLNTNLYFTTIFFICHLIAMCSALYNPFLYGWMNENFRQEFCSVFSCWRSRRALLIEQNSTFRKNSKKHPISDYHLSLIEANKKPHN+LLNEFSQFS
Sbjct:  165 KKENDVLRNISTCHEKWPDNRWKGIYTVSSFIVQFVLPTIAISFCYFQISRTLQSRCNRKLSKKIKSLSRVLNDIKRKRKTNKMLIAMVVIFIVCWIPLNVLWIITDLIYSDEQSKLNTNLYFTTIFFICHLIAMCSALYNPFLYGWMNENFRQEFCSVFSCWRSRRALLIEQNSTFRKNSKKHPISDYHLSLIEANKKPHNELLNEFSQFS 376          

HSP 2 Score: 330.102 bits (845), Expect = 0.000e+0
Identity = 166/167 (99.40%), Postives = 166/167 (99.40%), Query Frame = -2
Query:  629 MAENQTQGIILLNTSKVLNSNTDLILKTFIISSYSMIFVLGLSGNALVIFVILRNKAMYTVTNFFITNLAASDILMCIVAVPFTPIALYLENWTLPELVCKLLPMTMAISVYVSTLTSLVISIDRYFVIVYPFKVRMKLSFCRFLLVLIWGLAILASFPLAKYHKKR 1129
            MAENQTQGIILLNTSKVLNSNTDLILKTFIISSYSMIFVLGLSGNALVIFVILRNKAMYTVTNFFITNLAASDILMCIVAVPFTPIALYLENWTLPELVCKLLPMTMAISVYVSTLTSLVISIDRYFVIVYPFKVRMKLSFCRFLLVLIWGLAILASFPLAKYHKK 
Sbjct:    1 MAENQTQGIILLNTSKVLNSNTDLILKTFIISSYSMIFVLGLSGNALVIFVILRNKAMYTVTNFFITNLAASDILMCIVAVPFTPIALYLENWTLPELVCKLLPMTMAISVYVSTLTSLVISIDRYFVIVYPFKVRMKLSFCRFLLVLIWGLAILASFPLAKYHKKE 167          
BLAST of SMED30012106 vs. Planmine SMEST
Match: SMESG000059151.1 (SMESG000059151.1)

HSP 1 Score: 173.326 bits (438), Expect = 1.535e-86
Identity = 87/142 (61.27%), Postives = 115/142 (80.99%), Query Frame = -2
Query:  629 LKTFIISSYSMIFVLGLSGNALVIFVILRNKAMYTVTNFFITNLAASDILMCIVAVPFTPIALYLENWTLPELVCKLLPMTMAISVYVSTLTSLVISIDRYFVIVYPFKVRMKLSFCRFLLVLIWGLAILASFPLAKYHKKR 1054
            L+  +I+ YS+IFVLG+ GN+ VIFV++R++ M T+TN FI+NLA SDI+MC++AVPFTPIAL++ NWTLP  +CK+LPMTM +SVYVSTLTS  I+IDR+F+IV+PF  RMK S C F++ +IW +AIL S PLA Y  KR
Sbjct:   17 LQYLVIAGYSIIFVLGVVGNSFVIFVVMRSRHMRTITNIFISNLALSDIIMCLIAVPFTPIALFMNNWTLPASLCKVLPMTMGVSVYVSTLTSTAIAIDRFFIIVHPFIPRMKNSLCGFIICVIWIIAILISLPLAVYQTKR 158          

HSP 2 Score: 166.007 bits (419), Expect = 1.535e-86
Identity = 87/204 (42.65%), Postives = 122/204 (59.80%), Query Frame = -3
Query:   22 KENDVLRNISTCHEKWPDNRWKGIYTVSSFIVQFVLPTIAISFCYFQISRTLQSRCNRXXXXXXXXXSRVLNDIKRKRKTNKMLIAMVVIFIVCWIPLNVLWIITDLIYSDEQSKLNTNLYFTTIFFICHLIAMCSALYNPFLYGWMNENFRQEFCSVFSCWRSRRALLIEQNSTFRKNSKKHPISDYHLSLIEANKKPHNKLL 633
            K ND+  N S C E WP +  + ++T  SF++QFVLP   IS CYF+IS+ L+ RC  K+    KS+     +IKRKRKTNKMLIAMV IF++CWIPLN LW+ TD+   + +  L    +F   FFICH+IAM SA+YNPFLY W+N+NF++EF ++  C       ++  N +          + Y ++  E  +    K L
Sbjct:  157 KRNDLQSNTSKCQEVWPIDSSREVFTFVSFVLQFVLPCSIISVCYFKISKILRERCKSKVGSGTKSIRGKEGEIKRKRKTNKMLIAMVTIFVICWIPLNSLWMATDM-SMNFKYDLRLQFFFPIGFFICHMIAMSSAVYNPFLYAWLNDNFKREFRNLVPCLSCILKPVLPNNPSVTCRPDSRIATTYQMTTCEQEEDSSKKTL 359          
BLAST of SMED30012106 vs. Planmine SMEST
Match: SMESG000036403.1 (SMESG000036403.1)

HSP 1 Score: 137.502 bits (345), Expect = 1.240e-65
Identity = 68/122 (55.74%), Postives = 84/122 (68.85%), Query Frame = -2
Query:  614 MYTVTNFFITNLAASDILMCIVAVPFTPIALYLENWTLPELVCKLLPMTMAISVYVSTLTSLVISIDRYFVIVYPFKVRMKLSFCRFLLVLIWGLAILASFPLAKYHKK-------RKRCIE 958
            M T+TN FITNLA SDIL  ++A+PFTPIA+YLE W  P  +CKLLPMTM +SVYVSTLTS  I++DRY +IV+PF  RMK+  C  L+ LIW +  L + PLA Y  K       R  C+E
Sbjct:    1 MQTITNMFITNLALSDILTTLIAIPFTPIAVYLEEWIFPAFLCKLLPMTMGLSVYVSTLTSTAIALDRYIMIVHPFIPRMKMKVCILLIFLIWVVGTLITLPLAVYQSKLFMNSTNRTDCVE 122          

HSP 2 Score: 132.109 bits (331), Expect = 1.240e-65
Identity = 78/177 (44.07%), Postives = 111/177 (62.71%), Query Frame = -3
Query:   94 NISTCHEKWPDNRWKGIYTVSSFIVQFVLPTIAISFCYFQISRTLQSRCNRXXXXXXXXXSRVLNDIKRKRKTNKMLIAMVVIFIVCWIPLNVLWIITDLIYSDEQSKLNTNLYFTTIFFICHLIAMCSALYNPFLYGWMNENFRQEFCSVFSCWR----SRRALLIEQNSTFRKNS 612
            N + C E W   + + IYT  +FI+QF++P +  S CYFQ+S+ L  R   K+  +IKS  R   ++KRKR+TN MLIAMV+IF++CW PLN+LWI  +++   + S L+ + +F   F   HLIAM   +YNPFLYGWMN+NFR EF  V  C +         L+E N+ F++ S
Sbjct:  116 NRTDCVEVWQTPKSREIYTSFNFILQFIMPCLITSICYFQVSKVLNMRGANKIGCRIKSREREELEVKRKRRTNHMLIAMVIIFVMCWTPLNLLWIFGEILQKFDIS-LSQSGHFFLFFLCFHLIAMSGTMYNPFLYGWMNKNFRLEFQKVLPCLKIPVEPDTKTLVEDNTHFKRGS 291          
BLAST of SMED30012106 vs. Planmine SMEST
Match: SMESG000053241.1 (SMESG000053241.1)

HSP 1 Score: 83.1889 bits (204), Expect = 7.777e-34
Identity = 48/130 (36.92%), Postives = 81/130 (62.31%), Query Frame = -2
Query:  650 SYSMIFVLGLSGNALVIFVILRNKAMYTVTNFFITNLAASDILMCIVAVPFTPIAL--YLENWTLPELVCKLLPMTMAISVYVSTLTSLVISIDRYFVIVYPFKVRMKLSFCRFLLVLIWGLAILASFPL 1033
            SY  + V+G  G++LVI+V+LR+K + T  N FI NLA +D+++C  + PF  I L  + + W   E VCKL+ +    +V VST++   I++DRY VI+ P +  ++L     +++ IW L+++ + PL
Sbjct:   58 SYIAMIVIGTLGSSLVIYVVLRSKTLRTPRNMFILNLAITDLILCAFSQPFNIIRLLSFHKEWIFGEWVCKLVGLFTGTNVCVSTISITAIALDRYQVILCPTRNSLQLIGAIKVMLGIWILSLIIASPL 187          

HSP 2 Score: 80.1073 bits (196), Expect = 7.777e-34
Identity = 53/182 (29.12%), Postives = 97/182 (53.30%), Query Frame = -3
Query:  169 SPLFLWLNITKKENDVLRNISTCHEKWPD---NRWKGIYTVSSFIVQFVLPTIAISFCYFQISRTLQSRCNRXXXXXXXXXSRVLN-------------DIKRKRKTNKMLIAMVVIFIVCWIPLNVLWIITDLIYSDEQSKLNTNLYFTTIFFICHLIAMCSALYNPFLYGWMNENFRQEF 666
            SPL L+  + +  N +  N + C E   +    + K  Y++++ ++ +V+P   ++  Y +I R ++ R N    K ++S + + N             DI+R+R+ N +L+++ ++F + W+PLN++ +I DL     +S +        I  IC L+ + SA  NP LYGW+N+NFR EF
Sbjct:  185 SPLVLFSGV-ETVNMLKANHTRCTEHTVEIYMRKLKVGYSIATLVLLYVIPLSIVTITYMKIYRIIKQRMNNLHKKDLESSNSLPNSHKMELLTDKQKYDIQRQRRANILLLSITIVFAISWLPLNLINMIMDLYLMYNESTVGP--MSLRIQSICLLMVLTSACTNPILYGWLNDNFRHEF 363          
BLAST of SMED30012106 vs. Planmine SMEST
Match: SMESG000052051.1 (SMESG000052051.1)

HSP 1 Score: 88.5817 bits (218), Expect = 1.426e-30
Identity = 50/151 (33.11%), Postives = 83/151 (54.97%), Query Frame = -2
Query:  614 IISSYSMIFVLGLSGNALVIFVILRNKAMYTVTNFFITNLAASDILMCIVAVPFTPIALYLEN--WTLPELVCKLLPMTMAISVYVSTLTSLVISIDRYFVIVYPFKVRMKLSFCRFLLVLIWGLAILASFPLAKY------HKKRKRCIE 1042
            I+S Y ++ + G  G+ LV+ V+LR K M    N FI N+A +D ++CI   PF  I L  ++  W   E +CK++      +++VST++   I++DR++VI+YP K  +       +++LIW  A + + PLA +      H  R  C E
Sbjct:   71 ILSMYIIMILFGACGSILVVLVVLRKKQMQNPRNLFILNVAVTDFILCIFTQPFNLIRLLSQHKEWVYGETLCKMVSFFTGTNMFVSTMSISAIAVDRFYVIMYPTKKSLDNRGATGVIILIWFFAFILASPLAIFSHLDSVHSIRYECTE 221          

HSP 2 Score: 63.5438 bits (153), Expect = 1.426e-30
Identity = 53/187 (28.34%), Postives = 83/187 (44.39%), Query Frame = -3
Query:  145 KGIYTVSSFIVQFVLPTIAISFCYFQISRTLQSRCNR--------XXXXXXXXXSRVLND---------------------IKRKRKTNKMLIAMVVIFIVCWIPLNVLWIITD--LIYSDE--------------QSKLNTNLYFTTIFFICHLIAMCSALYNPFLYGWMNENFRQEFCSVFSCWR 570
            K +Y+V   + Q++LP I +   Y +I R ++SR  +          S    + S +L D                     I R+RK N +L ++ V+F + W+PLN+  +  D  L Y ++              QS ++   Y T    +C L+ + SA  NP LY W+NE+FR EF   F  WR
Sbjct:  232 KLVYSVFGMLFQYLLPLIILLTVYTKIYRRMESRIRKHSNYPKQELASTDQATQSNLLQDSKTLSQFSSFSLLKEQKHLVEISRQRKVNILLFSIAVVFTLSWLPLNINNMAMDFQLYYYNKDMENVTSYYSATATQSTVSYTQYVTITQAVCLLLVLSSACTNPILYSWLNESFRNEF-QRFLFWR 417          
The following BLAST results are available for this feature:
BLAST of SMED30012106 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NPY2R9.256e-4334.36neuropeptide Y receptor Y2 [Source:HGNC Symbol;Acc... [more]
NPY2R9.256e-4334.36neuropeptide Y receptor Y2 [Source:HGNC Symbol;Acc... [more]
NPFFR25.931e-3338.78neuropeptide FF receptor 2 [Source:HGNC Symbol;Acc... [more]
NPFFR26.493e-3338.78neuropeptide FF receptor 2 [Source:HGNC Symbol;Acc... [more]
NPFFR21.540e-3240.60neuropeptide FF receptor 2 [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of SMED30012106 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
npr-61.117e-4432.82NeuroPeptide Receptor family [Source:UniProtKB/Tr... [more]
npr-39.319e-3632.75NeuroPeptide Receptor family [Source:UniProtKB/Tr... [more]
npr-23.881e-3528.65NeuroPeptide Receptor family [Source:UniProtKB/Tr... [more]
npr-23.916e-3528.65NeuroPeptide Receptor family [Source:UniProtKB/Tr... [more]
npr-24.858e-3530.07NeuroPeptide Receptor family [Source:UniProtKB/Tr... [more]
back to top
BLAST of SMED30012106 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sNPF-R4.625e-3953.79gene:FBgn0036934 transcript:FBtr0332667[more]
sNPF-R4.625e-3953.79gene:FBgn0036934 transcript:FBtr0074871[more]
RYa-R6.519e-3236.72gene:FBgn0004842 transcript:FBtr0345267[more]
RYa-R1.028e-3136.72gene:FBgn0004842 transcript:FBtr0085100[more]
RYa-R1.274e-3136.72gene:FBgn0004842 transcript:FBtr0345268[more]
back to top
BLAST of SMED30012106 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
npy2rl1.958e-4835.75neuropeptide Y receptor Y2, like [Source:ZFIN;Acc:... [more]
npy7r2.613e-4137.68neuropeptide Y receptor Y7 [Source:ZFIN;Acc:ZDB-GE... [more]
npffr1l31.365e-3742.52neuropeptide FF receptor 1 like 3 [Source:ZFIN;Acc... [more]
npy1r2.718e-3736.22neuropeptide Y receptor Y1 [Source:ZFIN;Acc:ZDB-GE... [more]
npy1r2.763e-3736.22neuropeptide Y receptor Y1 [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of SMED30012106 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
taf1b1.227e-4634.91TATA-box binding protein associated factor, RNA po... [more]
NPY2R7.032e-4337.68neuropeptide Y receptor Y2 [Source:NCBI gene;Acc:1... [more]
errfi11.949e-3837.95ERBB receptor feedback inhibitor 1 [Source:Xenbase... [more]
ENSXETT00000044281.15.913e-3739.06pep primary_assembly:Xenopus_tropicalis_v9.1:3:115... [more]
gamt2.681e-3433.74guanidinoacetate N-methyltransferase [Source:Xenba... [more]
back to top
BLAST of SMED30012106 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Npy2r1.849e-4135.62neuropeptide Y receptor Y2 [Source:MGI Symbol;Acc:... [more]
Npy2r1.849e-4135.62neuropeptide Y receptor Y2 [Source:MGI Symbol;Acc:... [more]
Npy2r1.849e-4135.62neuropeptide Y receptor Y2 [Source:MGI Symbol;Acc:... [more]
Npffr23.151e-3740.69neuropeptide FF receptor 2 [Source:MGI Symbol;Acc:... [more]
Npy4r9.429e-3333.33neuropeptide Y receptor Y4 [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of SMED30012106 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P79113|NPY2R_BOVIN7.040e-4336.13Neuropeptide Y receptor type 2 OS=Bos taurus OX=99... [more]
sp|Q9DDN6|NPY2R_CHICK2.475e-4235.00Neuropeptide Y receptor type 2 OS=Gallus gallus OX... [more]
sp|O02836|NPY2R_PIG3.475e-4235.90Neuropeptide Y receptor type 2 OS=Sus scrofa OX=98... [more]
sp|Q9GK74|NPY2R_MACMU3.592e-4233.74Neuropeptide Y receptor type 2 OS=Macaca mulatta O... [more]
sp|Q5IS62|NPY2R_PANTR3.999e-4234.36Neuropeptide Y receptor type 2 OS=Pan troglodytes ... [more]
back to top
BLAST of SMED30012106 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A193KUS30.000e+0100.00NPYR-9 OS=Schmidtea mediterranea OX=79327 GN=npyr-... [more]
A0A3S5ASN61.339e-9056.02G_PROTEIN_RECEP_F1_2 domain-containing protein (Fr... [more]
A0A183W5E74.658e-8547.24G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A183N3J75.629e-8449.39G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A183L0987.913e-8450.00G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
back to top
BLAST of SMED30012106 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
npy2r1.428e-4338.32neuropeptide Y receptor Y2 [Source:ZFIN;Acc:ZDB-GE... [more]
npy7r1.803e-4133.73neuropeptide Y receptor type 2-like [Source:NCBI g... [more]
npffr2b6.419e-3947.58neuropeptide FF receptor 2-like [Source:NCBI gene;... [more]
npffr2b3.094e-3747.58neuropeptide FF receptor 2-like [Source:NCBI gene;... [more]
prlhr2b2.839e-3639.72prolactin-releasing peptide receptor-like [Source:... [more]
back to top
BLAST of SMED30012106 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prlh2r5.960e-4141.27prolactin releasing hormone 2 receptor [Source:ZFI... [more]
npy8br5.747e-3431.25neuropeptide Y receptor Y8b [Source:ZFIN;Acc:ZDB-G... [more]
si:dkey-202l22.33.068e-3236.72prolactin releasing hormone receptor [Source:HGNC ... [more]
npffr1l31.914e-3140.16neuropeptide FF receptor 1 like 3 [Source:ZFIN;Acc... [more]
sstr1a3.952e-2831.43somatostatin receptor 1a [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of SMED30012106 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30012106 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO444186.093e-3237.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO460843.566e-3031.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO460301.541e-2934.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO496192.073e-2933.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO409444.850e-2733.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30012106 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
npy2rl1.913e-4740.85neuropeptide Y receptor type 2 [Source:NCBI gene;A... [more]
npy2rl1.913e-4740.85neuropeptide Y receptor type 2 [Source:NCBI gene;A... [more]
npy7r1.303e-4233.15PRELI domain-containing protein 1, mitochondrial [... [more]
prlhr2a6.143e-3942.40prolactin-releasing peptide receptor [Source:NCBI ... [more]
ENSORLT00000042596.11.816e-3644.44neuropeptide FF receptor 2 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of SMED30012106 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000066072.10.000e+099.53SMESG000066072.1[more]
SMESG000059151.11.535e-8661.27SMESG000059151.1[more]
SMESG000036403.11.240e-6555.74SMESG000036403.1[more]
SMESG000053241.17.777e-3436.92SMESG000053241.1[more]
SMESG000052051.11.426e-3033.11SMESG000052051.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012106 ID=SMED30012106|Name=SMED30012106|organism=Schmidtea mediterranea sexual|type=transcript|length=1184bp
CGAAAACTGACTGAATTCATTTAACAATTTATTGTGAGGTTTCTTGTTAG
CTTCTATCAATGACAAATGATAATCGGAAATCGGATGCTTTTTACTGTTT
TTGCGGAATGTACTATTTTGTTCAATTAACAGGGCCCTTCGAGATCTCCA
ACAACTAAACACACTGCAAAACTCTTGACGAAAGTTTTCATTCATCCAAC
CATACAGAAAGGGGTTATACAGAGCACTACACATGGCGATTAGATGGCAA
ATGAAAAATATTGTTGTAAAATACAAATTGGTGTTCAATTTACTCTGTTC
ATCCGAGTAGATGAGGTCTGTAATAATCCAAAGAACATTCAATGGGATCC
AACAAACAATAAATATCACGACCATCGCTATTAGCATTTTGTTGGTTTTT
CGTTTTCGTTTTATGTCATTTAATACTCTTGAAAGGCTTTTGATTTTTTT
ACTGAGTTTCCTATTGCAACGGCTTTGAAGGGTGCGAGATATCTGAAAAT
AACAGAATGAAATTGCAATTGTTGGCAGAACAAATTGGACAATGAAACTG
CTGACGGTGTAAATTCCTTTCCATCGATTGTCGGGCCATTTTTCATGACA
GGTGGAAATATTCCTCAATACATCGTTTTCTTTTTTTGTGATATTTAGCC
AGAGGAAAAGAGGCGAGAATTGCTAAGCCCCAGATCAACACTAAAAGAAA
TCTACAGAACGATAATTTCATTCGCACTTTGAACGGGTAAACAATAACGA
AATATCTGTCGATGGATATAACCAAACTCGTGAGAGTTGAAACATAAACT
GATATTGCCATTGTCATTGGGAGAAGTTTACAAACTAATTCTGGCAAAGT
CCAATTTTCTAAATAGAGAGCAATCGGAGTGAAAGGAACCGCGACGATGC
ACATTAAAATGTCTGATGCTGCAAGATTTGTGATGAAAAAATTCGTCACT
GTATACATGGCCTTGTTTCGAAGAATAACAAATATTACAAGAGCATTACC
AGATAATCCAAGAACAAATATCATTGAATAAGATGATATGATAAAGGTTT
TCAATATCAAATCTGTATTCGAATTCAGAACCTTCGAAGTATTTAATAAA
ATAATGCCTTGAGTTTGGTTTTCAGCCATAAACGGTAAGGAAAAACTTTG
TAAATAGAGATTTATAGTGTTGAAAACTTGCATT
back to top

protein sequence of SMED30012106-orf-1

>SMED30012106-orf-1 ID=SMED30012106-orf-1|Name=SMED30012106-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=197bp
MQVFNTINLYLQSFSLPFMAENQTQGIILLNTSKVLNSNTDLILKTFIIS
SYSMIFVLGLSGNALVIFVILRNKAMYTVTNFFITNLAASDILMCIVAVP
FTPIALYLENWTLPELVCKLLPMTMAISVYVSTLTSLVISIDRYFVIVYP
FKVRMKLSFCRFLLVLIWGLAILASFPLAKYHKKRKRCIEEYFHLS*
back to top

protein sequence of SMED30012106-orf-2

>SMED30012106-orf-2 ID=SMED30012106-orf-2|Name=SMED30012106-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=129bp
MLIAMVVIFIVCWIPLNVLWIITDLIYSDEQSKLNTNLYFTTIFFICHLI
AMCSALYNPFLYGWMNENFRQEFCSVFSCWRSRRALLIEQNSTFRKNSKK
HPISDYHLSLIEANKKPHNKLLNEFSQFS
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR000276GPCR_Rhodpsn
IPR017452GPCR_Rhodpsn_7TM
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000276G protein-coupled receptor, rhodopsin-likePRINTSPR00237GPCRRHODOPSNcoord: 47..71
score: 30.18
coord: 159..180
score: 22.12
coord: 80..101
score: 34.37
coord: 125..147
score: 30.98
IPR000276G protein-coupled receptor, rhodopsin-likePFAMPF000017tm_1coord: 62..195
e-value: 1.5E-28
score: 99.9
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 20..196
e-value: 6.0E-44
score: 151.9
NoneNo IPR availablePANTHERPTHR24235FAMILY NOT NAMEDcoord: 39..187
NoneNo IPR availableCDDcd152037tmA_NPYR-likecoord: 46..196
e-value: 1.52536E-54
score: 173.174
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 35..191
NoneNo IPR availableTMHMMTMhelixcoord: 82..104
NoneNo IPR availableTMHMMTMhelixcoord: 48..70
NoneNo IPR availableTMHMMTMhelixcoord: 162..179
NoneNo IPR availableTMHMMTMhelixcoord: 119..141
IPR017452GPCR, rhodopsin-like, 7TMPROSITEPS50262G_PROTEIN_RECEP_F1_2coord: 62..196
score: 28.195