SMED30012092

Overview
NameSMED30012092
Smed IDSMED30012092
Length (bp)426
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30012092 (SMED30012092) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30012092 (SMED30012092) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30012092 (SMED30012092) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30012092 (SMED30012092) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012092

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30012092SMESG000073142.1 Contig1637GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
protonephridiaSMED30012092SMESG000073142.1 dd_Smed_v4_1835_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30012092SMESG000073142.1 dd_Smed_v4_1835_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30012092SMESG000073142.1 dd_Smed_v4_1835_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30012092 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.001339:56042..56467 +2004
Homology
BLAST of SMED30012092 vs. Ensembl Human
Match: BRK1 (BRICK1 subunit of SCAR/WAVE actin nucleating complex [Source:HGNC Symbol;Acc:HGNC:23057])

HSP 1 Score: 77.0258 bits (188), Expect = 4.176e-19
Identity = 32/63 (50.79%), Postives = 50/63 (79.37%), Query Frame = -2
Query:  123 QPEVKQDWDNREYEQVISTSIKKMSEFFNHFDSSCRVRLAKMDERLSRLEKQVDLIEAQVNQA 311
            Q E+ QDW NREY ++I++SIKK+++F N FD SCR RLA ++E+L+ LE++++ IEA+V + 
Sbjct:    9 QREIHQDWANREYIEIITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERRIEYIEARVTKG 71          
BLAST of SMED30012092 vs. Ensembl Celegans
Match: Y57G11C.1147 (pep chromosome:WBcel235:IV:14796606:14797490:-1 gene:WBGene00303007.1 transcript:Y57G11C.1147.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y57G11C.1147)

HSP 1 Score: 68.1662 bits (165), Expect = 4.809e-16
Identity = 27/65 (41.54%), Postives = 49/65 (75.38%), Query Frame = -2
Query:  117 QPEVKQDWDNREYEQVISTSIKKMSEFFNHFDSSCRVRLAKMDERLSRLEKQVDLIEAQVNQANP 311
            Q ++K DWDNRE+EQ+I+ +IK ++ F + F+ SCR +LA + ++L+ LE++V+ +EA+V + + 
Sbjct:    8 QQQLKDDWDNREFEQIIADNIKNIANFLSSFELSCRTKLATLSDKLNLLERKVEFLEARVTKGDT 72          
BLAST of SMED30012092 vs. Ensembl Fly
Match: HSPC300 (gene:FBgn0061198 transcript:FBtr0072194)

HSP 1 Score: 75.0998 bits (183), Expect = 1.416e-18
Identity = 32/63 (50.79%), Postives = 48/63 (76.19%), Query Frame = -2
Query:  123 QPEVKQDWDNREYEQVISTSIKKMSEFFNHFDSSCRVRLAKMDERLSRLEKQVDLIEAQVNQA 311
            Q ++ QDW NREY +VI+ SIK++++F N FD SCR RLA ++E+L+ LE+++D +EA V Q 
Sbjct:   10 QKQIHQDWANREYIEVITASIKRITDFLNSFDMSCRSRLAVLNEKLTILERRIDYLEACVAQG 72          
BLAST of SMED30012092 vs. Ensembl Fly
Match: HSPC300 (gene:FBgn0061198 transcript:FBtr0343346)

HSP 1 Score: 75.0998 bits (183), Expect = 1.416e-18
Identity = 32/63 (50.79%), Postives = 48/63 (76.19%), Query Frame = -2
Query:  123 QPEVKQDWDNREYEQVISTSIKKMSEFFNHFDSSCRVRLAKMDERLSRLEKQVDLIEAQVNQA 311
            Q ++ QDW NREY +VI+ SIK++++F N FD SCR RLA ++E+L+ LE+++D +EA V Q 
Sbjct:   10 QKQIHQDWANREYIEVITASIKRITDFLNSFDMSCRSRLAVLNEKLTILERRIDYLEACVAQG 72          
BLAST of SMED30012092 vs. Ensembl Zebrafish
Match: brk1 (BRICK1 subunit of SCAR/WAVE actin nucleating complex [Source:NCBI gene;Acc:415187])

HSP 1 Score: 77.7962 bits (190), Expect = 1.759e-19
Identity = 33/63 (52.38%), Postives = 50/63 (79.37%), Query Frame = -2
Query:  123 QPEVKQDWDNREYEQVISTSIKKMSEFFNHFDSSCRVRLAKMDERLSRLEKQVDLIEAQVNQA 311
            Q E+ QDW NREY +VI++SIKK+++F N FD SCR RLA ++E+L+ LE++++ IEA+V + 
Sbjct:    9 QREIHQDWANREYIEVITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERRIEYIEARVTKG 71          
BLAST of SMED30012092 vs. Ensembl Zebrafish
Match: brk1 (BRICK1 subunit of SCAR/WAVE actin nucleating complex [Source:NCBI gene;Acc:415187])

HSP 1 Score: 77.7962 bits (190), Expect = 1.759e-19
Identity = 33/63 (52.38%), Postives = 50/63 (79.37%), Query Frame = -2
Query:  123 QPEVKQDWDNREYEQVISTSIKKMSEFFNHFDSSCRVRLAKMDERLSRLEKQVDLIEAQVNQA 311
            Q E+ QDW NREY +VI++SIKK+++F N FD SCR RLA ++E+L+ LE++++ IEA+V + 
Sbjct:    9 QREIHQDWANREYIEVITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERRIEYIEARVTKG 71          
BLAST of SMED30012092 vs. Ensembl Zebrafish
Match: brk1 (BRICK1 subunit of SCAR/WAVE actin nucleating complex [Source:NCBI gene;Acc:415187])

HSP 1 Score: 75.8702 bits (185), Expect = 1.081e-18
Identity = 33/60 (55.00%), Postives = 49/60 (81.67%), Query Frame = -2
Query:  132 QPEVKQDWDNREYEQVISTSIKKMSEFFNHFDSSCRVRLAKMDERLSRLEKQVDLIEAQV 311
            Q E+ QDW NREY +VI++SIKK+++F N FD SCR RLA ++E+L+ LE++++ IEA+V
Sbjct:    9 QREIHQDWANREYIEVITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERRIEYIEARV 68          
BLAST of SMED30012092 vs. Ensembl Xenopus
Match: ano9 (anoctamin 9 [Source:Xenbase;Acc:XB-GENE-6049747])

HSP 1 Score: 75.0998 bits (183), Expect = 2.083e-18
Identity = 33/61 (54.10%), Postives = 49/61 (80.33%), Query Frame = -2
Query:  129 QPEVKQDWDNREYEQVISTSIKKMSEFFNHFDSSCRVRLAKMDERLSRLEKQVDLIEAQVN 311
            Q E+ QDW NREY +VI++SIKK+++F N FD SCR RLA ++E+L+ LE++++ IEA+ N
Sbjct:    9 QREIHQDWANREYIEVITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERRIEYIEARNN 69          
BLAST of SMED30012092 vs. Ensembl Xenopus
Match: ano9 (anoctamin 9 [Source:Xenbase;Acc:XB-GENE-6049747])

HSP 1 Score: 77.411 bits (189), Expect = 3.332e-18
Identity = 33/63 (52.38%), Postives = 50/63 (79.37%), Query Frame = -2
Query:  123 QPEVKQDWDNREYEQVISTSIKKMSEFFNHFDSSCRVRLAKMDERLSRLEKQVDLIEAQVNQA 311
            Q E+ QDW NREY +VI++SIKK+++F N FD SCR RLA ++E+L+ LE++++ IEA+V + 
Sbjct:  104 QREIHQDWANREYIEVITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERRIEYIEARVTKG 166          
BLAST of SMED30012092 vs. Ensembl Mouse
Match: Brk1 (BRICK1, SCAR/WAVE actin-nucleating complex subunit [Source:MGI Symbol;Acc:MGI:1915406])

HSP 1 Score: 78.1814 bits (191), Expect = 1.152e-19
Identity = 33/63 (52.38%), Postives = 50/63 (79.37%), Query Frame = -2
Query:  123 QPEVKQDWDNREYEQVISTSIKKMSEFFNHFDSSCRVRLAKMDERLSRLEKQVDLIEAQVNQA 311
            Q E+ QDW NREY ++I++SIKK+S+F N FD SCR RLA ++E+L+ LE++++ IEA+V + 
Sbjct:    9 QREIHQDWANREYIEIITSSIKKISDFLNSFDMSCRSRLATLNEKLTALERRIEYIEARVTKG 71          
BLAST of SMED30012092 vs. UniProt/SwissProt
Match: sp|Q91VR8|BRK1_MOUSE (Protein BRICK1 OS=Mus musculus OX=10090 GN=Brk1 PE=1 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 8.059e-19
Identity = 33/63 (52.38%), Postives = 50/63 (79.37%), Query Frame = -2
Query:  123 QPEVKQDWDNREYEQVISTSIKKMSEFFNHFDSSCRVRLAKMDERLSRLEKQVDLIEAQVNQA 311
            Q E+ QDW NREY ++I++SIKK+S+F N FD SCR RLA ++E+L+ LE++++ IEA+V + 
Sbjct:    9 QREIHQDWANREYIEIITSSIKKISDFLNSFDMSCRSRLATLNEKLTALERRIEYIEARVTKG 71          
BLAST of SMED30012092 vs. UniProt/SwissProt
Match: sp|A2BD66|BRK1B_XENLA (Probable protein BRICK1-B OS=Xenopus laevis OX=8355 GN=brk1-b PE=3 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 1.166e-18
Identity = 33/63 (52.38%), Postives = 50/63 (79.37%), Query Frame = -2
Query:  123 QPEVKQDWDNREYEQVISTSIKKMSEFFNHFDSSCRVRLAKMDERLSRLEKQVDLIEAQVNQA 311
            Q E+ QDW NREY +VI++SIKK+++F N FD SCR RLA ++E+L+ LE++++ IEA+V + 
Sbjct:    9 QREIHQDWANREYIEVITSSIKKIADFLNSFDMSCRSRLATLNEKLTTLERRIEYIEARVTKG 71          
BLAST of SMED30012092 vs. UniProt/SwissProt
Match: sp|Q6IQ86|BRK1_DANRE (Probable protein BRICK1 OS=Danio rerio OX=7955 GN=brk1 PE=3 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 1.328e-18
Identity = 33/63 (52.38%), Postives = 50/63 (79.37%), Query Frame = -2
Query:  123 QPEVKQDWDNREYEQVISTSIKKMSEFFNHFDSSCRVRLAKMDERLSRLEKQVDLIEAQVNQA 311
            Q E+ QDW NREY +VI++SIKK+++F N FD SCR RLA ++E+L+ LE++++ IEA+V + 
Sbjct:    9 QREIHQDWANREYIEVITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERRIEYIEARVTKG 71          
BLAST of SMED30012092 vs. UniProt/SwissProt
Match: sp|Q6P7G6|BRK1A_XENLA (Probable protein BRICK1-A OS=Xenopus laevis OX=8355 GN=brk1-a PE=3 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 1.546e-18
Identity = 33/63 (52.38%), Postives = 50/63 (79.37%), Query Frame = -2
Query:  123 QPEVKQDWDNREYEQVISTSIKKMSEFFNHFDSSCRVRLAKMDERLSRLEKQVDLIEAQVNQA 311
            Q E+ QDW NREY +VI++SIKK+++F N FD SCR RLA ++E+L+ LE++++ IEA+V + 
Sbjct:    9 QREIHQDWANREYIEVITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERRIEYIEARVTKG 71          
BLAST of SMED30012092 vs. UniProt/SwissProt
Match: sp|Q8WUW1|BRK1_HUMAN (Protein BRICK1 OS=Homo sapiens OX=9606 GN=BRK1 PE=1 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 2.006e-18
Identity = 32/63 (50.79%), Postives = 50/63 (79.37%), Query Frame = -2
Query:  123 QPEVKQDWDNREYEQVISTSIKKMSEFFNHFDSSCRVRLAKMDERLSRLEKQVDLIEAQVNQA 311
            Q E+ QDW NREY ++I++SIKK+++F N FD SCR RLA ++E+L+ LE++++ IEA+V + 
Sbjct:    9 QREIHQDWANREYIEIITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERRIEYIEARVTKG 71          
BLAST of SMED30012092 vs. TrEMBL
Match: E4X4Z7 (Uncharacterized protein OS=Oikopleura dioica OX=34765 GN=GSOID_T00002221001 PE=4 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 6.445e-18
Identity = 36/68 (52.94%), Postives = 56/68 (82.35%), Query Frame = -2
Query:  114 QPEVKQDWDNREYEQVISTSIKKMSEFFNHFDSSCRVRLAKMDERLSRLEKQVDLIEAQVNQ--ANPQ 311
            Q ++++DW+NREY +VI+T IKK+S+F N FDSSCR R A+MDE+L+ LE+++D +EA++++  AN Q
Sbjct:    9 QRQIQEDWNNREYVEVITTQIKKISDFLNSFDSSCRGRFAQMDEKLTTLERRIDFLEARISRSLANGQ 76          
BLAST of SMED30012092 vs. TrEMBL
Match: A0A4Y7LYB9 (EOG090X0ON0 OS=Ceriodaphnia reticulata OX=302197 GN=EOG090X0ON0 PE=2 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 7.769e-17
Identity = 32/65 (49.23%), Postives = 52/65 (80.00%), Query Frame = -2
Query:  117 QPEVKQDWDNREYEQVISTSIKKMSEFFNHFDSSCRVRLAKMDERLSRLEKQVDLIEAQVNQANP 311
            Q + +QDW NREY +VI++SIKK+++F N FD SCR RLA ++E+L+RLE++++ +EA+V + + 
Sbjct:    8 QKQTQQDWANREYIEVITSSIKKITDFLNSFDMSCRGRLAGLNEKLTRLERKIEYLEARVTKGDT 72          
BLAST of SMED30012092 vs. TrEMBL
Match: A0A3P9CUK3 (Uncharacterized protein OS=Maylandia zebra OX=106582 PE=4 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 8.892e-17
Identity = 34/63 (53.97%), Postives = 51/63 (80.95%), Query Frame = -2
Query:  123 QPEVKQDWDNREYEQVISTSIKKMSEFFNHFDSSCRVRLAKMDERLSRLEKQVDLIEAQVNQA 311
            Q E+ QDW NREY +VI++SIKK+++F N FD SCR RLAK++E+L+ LE++++ IEA+V + 
Sbjct:    9 QREIHQDWANREYIEVITSSIKKIADFLNSFDMSCRSRLAKINEKLTALERRIEYIEARVTKG 71          
BLAST of SMED30012092 vs. TrEMBL
Match: A0A4Y7NJM2 (EOG090X0ON0 OS=Moina brachiata OX=675436 GN=EOG090X0ON0 PE=2 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 9.432e-17
Identity = 32/65 (49.23%), Postives = 52/65 (80.00%), Query Frame = -2
Query:  117 QPEVKQDWDNREYEQVISTSIKKMSEFFNHFDSSCRVRLAKMDERLSRLEKQVDLIEAQVNQANP 311
            Q + +QDW NREY +VI++SIKK+++F N FD SCR RLA ++E+L+RLE++++ +EA+V + + 
Sbjct:   10 QKQTQQDWANREYIEVITSSIKKITDFLNSFDMSCRGRLAGLNEKLTRLERKIEYLEARVTKGDT 74          
BLAST of SMED30012092 vs. TrEMBL
Match: A0A4Y7NKM9 (EOG090X0ON0 OS=Megafenestra aurita OX=2291010 GN=EOG090X0ON0 PE=2 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 1.832e-16
Identity = 32/65 (49.23%), Postives = 52/65 (80.00%), Query Frame = -2
Query:  117 QPEVKQDWDNREYEQVISTSIKKMSEFFNHFDSSCRVRLAKMDERLSRLEKQVDLIEAQVNQANP 311
            Q + +QDW NREY +VI++SIKK+++F N FD SCR RLA ++E+L+RLE++++ +EA+V + + 
Sbjct:    8 QKQTQQDWANREYIEVITSSIKKITDFLNSFDMSCRGRLAVLNEKLTRLERKIEYLEARVTKGDT 72          
BLAST of SMED30012092 vs. Ensembl Cavefish
Match: BRK1 (BRICK1 subunit of SCAR/WAVE actin nucleating complex [Source:NCBI gene;Acc:103032283])

HSP 1 Score: 77.7962 bits (190), Expect = 1.491e-19
Identity = 33/63 (52.38%), Postives = 50/63 (79.37%), Query Frame = -2
Query:  123 QPEVKQDWDNREYEQVISTSIKKMSEFFNHFDSSCRVRLAKMDERLSRLEKQVDLIEAQVNQA 311
            Q E+ QDW NREY +VI++SIKK+++F N FD SCR RLA ++E+L+ LE++++ IEA+V + 
Sbjct:    9 QREIHQDWANREYIEVITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERRIEYIEARVTKG 71          
BLAST of SMED30012092 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003544.1 (pep scaffold:Pmarinus_7.0:GL479924:18905:21371:-1 gene:ENSPMAG00000003239.1 transcript:ENSPMAT00000003544.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 76.6406 bits (187), Expect = 8.570e-20
Identity = 32/63 (50.79%), Postives = 50/63 (79.37%), Query Frame = -2
Query:  123 QPEVKQDWDNREYEQVISTSIKKMSEFFNHFDSSCRVRLAKMDERLSRLEKQVDLIEAQVNQA 311
            Q ++ QDW NREY +VI++SIKK+++F N FD SCR RLA ++E+L+ LE++++ IEA+V + 
Sbjct:    9 QRQIHQDWANREYIEVITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERRIEYIEARVTKG 71          
BLAST of SMED30012092 vs. Ensembl Nematostella
Match: EDO39509 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9Z3])

HSP 1 Score: 70.4774 bits (171), Expect = 3.139e-17
Identity = 29/63 (46.03%), Postives = 48/63 (76.19%), Query Frame = -2
Query:  123 QPEVKQDWDNREYEQVISTSIKKMSEFFNHFDSSCRVRLAKMDERLSRLEKQVDLIEAQVNQA 311
            Q  +++DW NRE+ +V+S  IKK++EF N FD SCR +LAK++E+++ LE +++ IEA+V + 
Sbjct:    5 QKNIQEDWQNREFVEVVSEGIKKIAEFLNDFDISCRSKLAKLNEKVTALELKIEYIEARVTKG 67          
BLAST of SMED30012092 vs. Ensembl Medaka
Match: brk1 (BRICK1 subunit of SCAR/WAVE actin nucleating complex [Source:NCBI gene;Acc:415187])

HSP 1 Score: 77.7962 bits (190), Expect = 4.099e-19
Identity = 33/64 (51.56%), Postives = 51/64 (79.69%), Query Frame = -2
Query:  120 QPEVKQDWDNREYEQVISTSIKKMSEFFNHFDSSCRVRLAKMDERLSRLEKQVDLIEAQVNQAN 311
            Q E+ QDW NREY +VI++SIKK+++F N FD SCR RLA ++E+L+ LE++++ IEA+V ++ 
Sbjct:    9 QREIHQDWANREYIEVITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERRIEYIEARVTESG 72          
BLAST of SMED30012092 vs. Planmine SMEST
Match: SMESG000073142.1 (SMESG000073142.1)

HSP 1 Score: 145.591 bits (366), Expect = 1.801e-46
Identity = 70/70 (100.00%), Postives = 70/70 (100.00%), Query Frame = -2
Query:  111 MNEQPEVKQDWDNREYEQVISTSIKKMSEFFNHFDSSCRVRLAKMDERLSRLEKQVDLIEAQVNQANPQR 320
            MNEQPEVKQDWDNREYEQVISTSIKKMSEFFNHFDSSCRVRLAKMDERLSRLEKQVDLIEAQVNQANPQR
Sbjct:    1 MNEQPEVKQDWDNREYEQVISTSIKKMSEFFNHFDSSCRVRLAKMDERLSRLEKQVDLIEAQVNQANPQR 70          
The following BLAST results are available for this feature:
BLAST of SMED30012092 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
BRK14.176e-1950.79BRICK1 subunit of SCAR/WAVE actin nucleating compl... [more]
back to top
BLAST of SMED30012092 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Y57G11C.11474.809e-1641.54pep chromosome:WBcel235:IV:14796606:14797490:-1 ge... [more]
back to top
BLAST of SMED30012092 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
HSPC3001.416e-1850.79gene:FBgn0061198 transcript:FBtr0072194[more]
HSPC3001.416e-1850.79gene:FBgn0061198 transcript:FBtr0343346[more]
back to top
BLAST of SMED30012092 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
brk11.759e-1952.38BRICK1 subunit of SCAR/WAVE actin nucleating compl... [more]
brk11.759e-1952.38BRICK1 subunit of SCAR/WAVE actin nucleating compl... [more]
brk11.081e-1855.00BRICK1 subunit of SCAR/WAVE actin nucleating compl... [more]
back to top
BLAST of SMED30012092 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ano92.083e-1854.10anoctamin 9 [Source:Xenbase;Acc:XB-GENE-6049747][more]
ano93.332e-1852.38anoctamin 9 [Source:Xenbase;Acc:XB-GENE-6049747][more]
back to top
BLAST of SMED30012092 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Brk11.152e-1952.38BRICK1, SCAR/WAVE actin-nucleating complex subunit... [more]
back to top
BLAST of SMED30012092 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q91VR8|BRK1_MOUSE8.059e-1952.38Protein BRICK1 OS=Mus musculus OX=10090 GN=Brk1 PE... [more]
sp|A2BD66|BRK1B_XENLA1.166e-1852.38Probable protein BRICK1-B OS=Xenopus laevis OX=835... [more]
sp|Q6IQ86|BRK1_DANRE1.328e-1852.38Probable protein BRICK1 OS=Danio rerio OX=7955 GN=... [more]
sp|Q6P7G6|BRK1A_XENLA1.546e-1852.38Probable protein BRICK1-A OS=Xenopus laevis OX=835... [more]
sp|Q8WUW1|BRK1_HUMAN2.006e-1850.79Protein BRICK1 OS=Homo sapiens OX=9606 GN=BRK1 PE=... [more]
back to top
BLAST of SMED30012092 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
E4X4Z76.445e-1852.94Uncharacterized protein OS=Oikopleura dioica OX=34... [more]
A0A4Y7LYB97.769e-1749.23EOG090X0ON0 OS=Ceriodaphnia reticulata OX=302197 G... [more]
A0A3P9CUK38.892e-1753.97Uncharacterized protein OS=Maylandia zebra OX=1065... [more]
A0A4Y7NJM29.432e-1749.23EOG090X0ON0 OS=Moina brachiata OX=675436 GN=EOG090... [more]
A0A4Y7NKM91.832e-1649.23EOG090X0ON0 OS=Megafenestra aurita OX=2291010 GN=E... [more]
back to top
BLAST of SMED30012092 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
BRK11.491e-1952.38BRICK1 subunit of SCAR/WAVE actin nucleating compl... [more]
back to top
BLAST of SMED30012092 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000003544.18.570e-2050.79pep scaffold:Pmarinus_7.0:GL479924:18905:21371:-1 ... [more]
back to top
BLAST of SMED30012092 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30012092 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO395093.139e-1746.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30012092 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
brk14.099e-1951.56BRICK1 subunit of SCAR/WAVE actin nucleating compl... [more]
back to top
BLAST of SMED30012092 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000073142.11.801e-46100.00SMESG000073142.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012092 ID=SMED30012092|Name=SMED30012092|organism=Schmidtea mediterranea sexual|type=transcript|length=426bp
CTTTGACAAAAGCAAATNNNTTTNNNTTNTAAAGNNTTTATGCATTGACA
TATATTTAAAAATCAAAAATTATATATACTTTGAAAATGAATAAATGTAA
TATTAATTTATCTTTGAGGATTTGCTTGATTGACTTGTGCTTCGATCAGA
TCAACTTGCTTTTCTAATCTACTGAGTCGTTCATCCATTTTAGCTAACCG
AACGCGGCAAGATGAGTCAAAATGATTAAAAAATTCACTCATTTTTTTTA
TACTCGTGCTTATAACTTGTTCATATTCTCTATTATCCCAATCTTGCTTC
ACTTCTGGTTGTTCATTCATAATAATAATTAGGAAATTAACCAACTACAA
ATAAATTTAAAAAGAACAATTTCTAAAATATAGTTAAACAANGATAATNA
TNAATNNANNNTANAGCCGTTATTAA
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000070intestinal phagocyte
Vocabulary: molecular function
TermDefinition
GO:0044877macromolecular complex binding
GO:0032403protein complex binding
Vocabulary: INTERPRO
TermDefinition
IPR019309WASHC3
IPR033378BRICK1
Vocabulary: cellular component
TermDefinition
GO:0071203WASH complex
GO:0031209SCAR complex
Vocabulary: biological process
TermDefinition
GO:0007015actin filament organization
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 42..62
NoneNo IPR availableGENE3DG3DSA:1.20.5.110coord: 1..63
e-value: 3.9E-26
score: 92.3
NoneNo IPR availablePRODOMPD593487coord: 7..61
e-value: 3.0E-13
score: 176.0
IPR019309WASH complex subunit 3PFAMPF10152CCDC53coord: 24..64
e-value: 9.9E-6
score: 26.0
IPR033378Protein BRICK1PANTHERPTHR33668FAMILY NOT NAMEDcoord: 4..67