transmembrane protein 107

Overview
Nametransmembrane protein 107
Smed IDSMED30012091
Length (bp)630
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of transmembrane protein 107 (SMED30012091) t-SNE clustered cells

Violin plots show distribution of expression levels for transmembrane protein 107 (SMED30012091) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of transmembrane protein 107 (SMED30012091) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for transmembrane protein 107 (SMED30012091) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012091

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30012091SMESG000016814.1 SmedASXL_059628SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30012091SMESG000016814.1 dd_Smed_v4_9492_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30012091SMESG000016814.1 dd_Smed_v4_9492_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30012091SMESG000016814.1 dd_Smed_v6_9492_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30012091SMESG000016814.1 Contig43569newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30012091SMESG000016814.1 Contig43569uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30012091SMESG000016814.1 dd_Smed_v4_9492_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of transmembrane protein 107 vs. Ensembl Human
Match: TMEM107 (transmembrane protein 107 [Source:HGNC Symbol;Acc:HGNC:28128])

HSP 1 Score: 61.6178 bits (148), Expect = 9.994e-12
Identity = 36/126 (28.57%), Postives = 63/126 (50.00%), Query Frame = 1
Query:  103 KIISILFQLIPTIILLMERDSFVKSALSISYSAQDYNNLNIQFIVAISLFFFFTFGESLSHLVGCSILMPYQCIFSSLCHXXXXXXXXXXXXDRWPSSDYWYIFGFSSILPFVTECLTIARMLAIK 480
            + +++L  L+  I L   RDS +++ L ++++ ++Y+  +IQ + A+S+       E    L G S+    Q + S   H    +    F+ +RW  + YWYIF F S LP VTE      +  +K
Sbjct:   11 RFLTLLAHLVVVITLFWSRDSNIQACLPLTFTPEEYDKQDIQLVAALSVTLGLFAVELAGFLSGVSMFNSTQSLISIGAHCSASVALSFFIFERWECTTYWYIFVFCSALPAVTEMALFVTVFGLK 136          
BLAST of transmembrane protein 107 vs. Ensembl Human
Match: TMEM107 (transmembrane protein 107 [Source:HGNC Symbol;Acc:HGNC:28128])

HSP 1 Score: 53.1434 bits (126), Expect = 1.389e-8
Identity = 35/132 (26.52%), Postives = 63/132 (47.73%), Query Frame = 1
Query:  103 KIISILFQLIPTIILLMERDSFVKSALSISYSAQDYNNLNI------QFIVAISLFFFFTFGESLSHLVGCSILMPYQCIFSSLCHXXXXXXXXXXXXDRWPSSDYWYIFGFSSILPFVTECLTIARMLAIK 480
            + +++L  L+  I L   RDS +++ L ++++ ++Y+  +I      + + A+S+       E    L G S+    Q + S   H    +    F+ +RW  + YWYIF F S LP VTE      +  +K
Sbjct:   11 RFLTLLAHLVVVITLFWSRDSNIQACLPLTFTPEEYDKQDIHPLPLCRLVAALSVTLGLFAVELAGFLSGVSMFNSTQSLISIGAHCSASVALSFFIFERWECTTYWYIFVFCSALPAVTEMALFVTVFGLK 142          
BLAST of transmembrane protein 107 vs. Ensembl Zebrafish
Match: tmem107l (transmembrane protein 107 like [Source:ZFIN;Acc:ZDB-GENE-090313-269])

HSP 1 Score: 55.4546 bits (132), Expect = 1.471e-9
Identity = 32/126 (25.40%), Postives = 65/126 (51.59%), Query Frame = 1
Query:  103 KIISILFQLIPTIILLMERDSFVKSALSISYSAQDYNNLNIQFIVAISLFFFFTFGESLSHLVGCSILMPYQCIFSSLCHXXXXXXXXXXXXDRWPSSDYWYIFGFSSILPFVTECLTIARMLAIK 480
            + ++++  L+  II+   R+  V++ L + Y+ ++Y   + + +VA+S+       E +  L G S+    Q + S  CH  G +    F+ ++W  S YW+IF F S++P + E + +  +   K
Sbjct:   11 RFLTLIAHLVIVIIIFWSREYSVRACLPLDYTNEEYTAEDTRLVVALSVTLGLLAIELVGFLCGISMFNNNQALLSIGCHSSGSVALLFFMFEQWTCSIYWWIFSFCSVIPALYEMVIVVVVFGCK 136          
BLAST of transmembrane protein 107 vs. Ensembl Zebrafish
Match: tmem107l (transmembrane protein 107 like [Source:ZFIN;Acc:ZDB-GENE-090313-269])

HSP 1 Score: 55.4546 bits (132), Expect = 1.471e-9
Identity = 32/126 (25.40%), Postives = 65/126 (51.59%), Query Frame = 1
Query:  103 KIISILFQLIPTIILLMERDSFVKSALSISYSAQDYNNLNIQFIVAISLFFFFTFGESLSHLVGCSILMPYQCIFSSLCHXXXXXXXXXXXXDRWPSSDYWYIFGFSSILPFVTECLTIARMLAIK 480
            + ++++  L+  II+   R+  V++ L + Y+ ++Y   + + +VA+S+       E +  L G S+    Q + S  CH  G +    F+ ++W  S YW+IF F S++P + E + +  +   K
Sbjct:   11 RFLTLIAHLVIVIIIFWSREYSVRACLPLDYTNEEYTAEDTRLVVALSVTLGLLAIELVGFLCGISMFNNNQALLSIGCHSSGSVALLFFMFEQWTCSIYWWIFSFCSVIPALYEMVIVVVVFGCK 136          
BLAST of transmembrane protein 107 vs. Ensembl Zebrafish
Match: tmem107l (transmembrane protein 107 like [Source:ZFIN;Acc:ZDB-GENE-090313-269])

HSP 1 Score: 55.4546 bits (132), Expect = 1.471e-9
Identity = 32/126 (25.40%), Postives = 65/126 (51.59%), Query Frame = 1
Query:  103 KIISILFQLIPTIILLMERDSFVKSALSISYSAQDYNNLNIQFIVAISLFFFFTFGESLSHLVGCSILMPYQCIFSSLCHXXXXXXXXXXXXDRWPSSDYWYIFGFSSILPFVTECLTIARMLAIK 480
            + ++++  L+  II+   R+  V++ L + Y+ ++Y   + + +VA+S+       E +  L G S+    Q + S  CH  G +    F+ ++W  S YW+IF F S++P + E + +  +   K
Sbjct:   11 RFLTLIAHLVIVIIIFWSREYSVRACLPLDYTNEEYTAEDTRLVVALSVTLGLLAIELVGFLCGISMFNNNQALLSIGCHSSGSVALLFFMFEQWTCSIYWWIFSFCSVIPALYEMVIVVVVFGCK 136          
BLAST of transmembrane protein 107 vs. Ensembl Zebrafish
Match: tmem107 (transmembrane protein 107 [Source:NCBI gene;Acc:406492])

HSP 1 Score: 44.669 bits (104), Expect = 8.467e-6
Identity = 28/115 (24.35%), Postives = 51/115 (44.35%), Query Frame = 1
Query:  103 KIISILFQLIPTIILLMERDSFVKSALSISYSAQDYNNLNIQFIVAISLFFFFTFGESLSHLVGCSILMPYQCIFSSLCHXXXXXXXXXXXXDRWPSSDYWYIFGFSSILPFVTE 447
            + +++   L+  I +   RD+ ++S L + ++   Y   + +  VA+S+       E    L G S+    Q + S + H    +    F+  +WP   YW IF   S+ P V E
Sbjct:   11 RFLTLTAHLVIIITIFWSRDNNIQSCLPLEFTEDQYRTEDTRLTVALSVTLALFVLELAGFLSGVSMFNSNQALLSLITHSSACVCLSFFVFHQWPCWTYWIIFSICSVFPAVVE 125          
BLAST of transmembrane protein 107 vs. Ensembl Xenopus
Match: TMEM107 (transmembrane protein 107 [Source:NCBI gene;Acc:101731170])

HSP 1 Score: 58.5362 bits (140), Expect = 1.315e-10
Identity = 35/115 (30.43%), Postives = 59/115 (51.30%), Query Frame = 1
Query:  103 KIISILFQLIPTIILLMERDSFVKSALSISYSAQDYNNLNIQFIVAISLFFFFTFGESLSHLVGCSILMPYQCIFSSLCHXXXXXXXXXXXXDRWPSSDYWYIFGFSSILPFVTE 447
            + +++   L+  II+   RD+ V + L I ++ Q Y++ + + IVA+S+       E    L G S+    Q + S   H    +   +F+ ++W  + YWYIFGF S LP  TE
Sbjct:   11 RFLTLTAHLVIVIIIFWSRDNNVLACLPIDFTPQQYSSRDTELIVALSVTLGLFAIEYAGFLSGVSMFNKTQSLLSLAAHCAASVSLSLFVSEQWECTSYWYIFGFCSALPAFTE 125          
BLAST of transmembrane protein 107 vs. Ensembl Mouse
Match: Tmem107 (transmembrane protein 107 [Source:MGI Symbol;Acc:MGI:1914160])

HSP 1 Score: 55.8398 bits (133), Expect = 1.100e-9
Identity = 32/115 (27.83%), Postives = 55/115 (47.83%), Query Frame = 1
Query:  103 KIISILFQLIPTIILLMERDSFVKSALSISYSAQDYNNLNIQFIVAISLFFFFTFGESLSHLVGCSILMPYQCIFSSLCHXXXXXXXXXXXXDRWPSSDYWYIFGFSSILPFVTE 447
            + +++L  L+  I L   R+S +++ L + ++ ++Y   + Q + A+ L       E    L G S+    Q + S   H    +    F+ +RW  + YWYIF F S  P VTE
Sbjct:   11 RFLTLLAHLVVVITLFWSRESNIQACLPLKFTPEEYEKQDNQLVAALCLTLGLFAVELAGFLSGVSMFNSTQSLLSIAAHCSASVALSFFVFERWECTTYWYIFTFCSAFPAVTE 125          
BLAST of transmembrane protein 107 vs. Ensembl Mouse
Match: Tmem107 (transmembrane protein 107 [Source:MGI Symbol;Acc:MGI:1914160])

HSP 1 Score: 47.7506 bits (112), Expect = 1.029e-6
Identity = 27/106 (25.47%), Postives = 50/106 (47.17%), Query Frame = 1
Query:  103 KIISILFQLIPTIILLMERDSFVKSALSISYSAQDYNNLNIQFIVAISLFFFFTFGESLSHLVGCSILMPYQCIFSSLCHXXXXXXXXXXXXDRWPSSDYWYIFGF 420
            + +++L  L+  I L   R+S +++ L + ++ ++Y   + Q + A+ L       E    L G S+    Q + S   H    +    F+ +RW  + YWYIF F
Sbjct:   11 RFLTLLAHLVVVITLFWSRESNIQACLPLKFTPEEYEKQDNQLVAALCLTLGLFAVELAGFLSGVSMFNSTQSLLSIAAHCSASVALSFFVFERWECTTYWYIFTF 116          
BLAST of transmembrane protein 107 vs. UniProt/SwissProt
Match: sp|Q6UX40|TM107_HUMAN (Transmembrane protein 107 OS=Homo sapiens OX=9606 GN=TMEM107 PE=1 SV=1)

HSP 1 Score: 61.6178 bits (148), Expect = 4.799e-11
Identity = 36/126 (28.57%), Postives = 63/126 (50.00%), Query Frame = 1
Query:  103 KIISILFQLIPTIILLMERDSFVKSALSISYSAQDYNNLNIQFIVAISLFFFFTFGESLSHLVGCSILMPYQCIFSSLCHXXXXXXXXXXXXDRWPSSDYWYIFGFSSILPFVTECLTIARMLAIK 480
            + +++L  L+  I L   RDS +++ L ++++ ++Y+  +IQ + A+S+       E    L G S+    Q + S   H    +    F+ +RW  + YWYIF F S LP VTE      +  +K
Sbjct:   11 RFLTLLAHLVVVITLFWSRDSNIQACLPLTFTPEEYDKQDIQLVAALSVTLGLFAVELAGFLSGVSMFNSTQSLISIGAHCSASVALSFFIFERWECTTYWYIFVFCSALPAVTEMALFVTVFGLK 136          
BLAST of transmembrane protein 107 vs. UniProt/SwissProt
Match: sp|D3ZFW5|TM107_RAT (Transmembrane protein 107 OS=Rattus norvegicus OX=10116 GN=Tmem107 PE=3 SV=1)

HSP 1 Score: 56.225 bits (134), Expect = 5.964e-9
Identity = 32/115 (27.83%), Postives = 55/115 (47.83%), Query Frame = 1
Query:  103 KIISILFQLIPTIILLMERDSFVKSALSISYSAQDYNNLNIQFIVAISLFFFFTFGESLSHLVGCSILMPYQCIFSSLCHXXXXXXXXXXXXDRWPSSDYWYIFGFSSILPFVTE 447
            + +++L  L+  I L   R+S +++ L + ++ ++Y   + Q + A+ L       E    L G S+    Q + S   H    +    F+ +RW  + YWYIF F S  P VTE
Sbjct:   11 RFLTLLAHLVIVITLFWSRESNIQACLPLKFTPEEYEKQDNQLVAALCLTLGLFAVELAGFLSGVSMFNSTQSLLSIAAHCSASVALSFFIFERWECTTYWYIFAFCSAFPAVTE 125          
BLAST of transmembrane protein 107 vs. UniProt/SwissProt
Match: sp|Q9CPV0|TM107_MOUSE (Transmembrane protein 107 OS=Mus musculus OX=10090 GN=Tmem107 PE=1 SV=1)

HSP 1 Score: 55.8398 bits (133), Expect = 7.695e-9
Identity = 32/115 (27.83%), Postives = 55/115 (47.83%), Query Frame = 1
Query:  103 KIISILFQLIPTIILLMERDSFVKSALSISYSAQDYNNLNIQFIVAISLFFFFTFGESLSHLVGCSILMPYQCIFSSLCHXXXXXXXXXXXXDRWPSSDYWYIFGFSSILPFVTE 447
            + +++L  L+  I L   R+S +++ L + ++ ++Y   + Q + A+ L       E    L G S+    Q + S   H    +    F+ +RW  + YWYIF F S  P VTE
Sbjct:   11 RFLTLLAHLVVVITLFWSRESNIQACLPLKFTPEEYEKQDNQLVAALCLTLGLFAVELAGFLSGVSMFNSTQSLLSIAAHCSASVALSFFVFERWECTTYWYIFTFCSAFPAVTE 125          
BLAST of transmembrane protein 107 vs. TrEMBL
Match: R7V2C9 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_148161 PE=4 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 6.360e-14
Identity = 39/115 (33.91%), Postives = 64/115 (55.65%), Query Frame = 1
Query:  103 KIISILFQLIPTIILLMERDSFVKSALSISYSAQDYNNLNIQFIVAISLFFFFTFGESLSHLVGCSILMPYQCIFSSLCHXXXXXXXXXXXXDRWPSSDYWYIFGFSSILPFVTE 447
            + + ++  L+ TI++L+ RDS VK+ L ++YS  +Y++ + + IV +S+       E +  + G S+ M  Q + S+  H    +    F+ D WP   YWYIFGF S  P VTE
Sbjct:   10 RFLCMIAHLVLTIVILLSRDSNVKACLPLNYSPNEYDSKDTELIVGLSVALGLLVFELVGFMGGISMFMSSQAMISTTLHASAAVSLAYFIFDAWPCGHYWYIFGFCSAFPAVTE 124          
BLAST of transmembrane protein 107 vs. TrEMBL
Match: A0A2C9LGI1 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106053542 PE=4 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 7.067e-14
Identity = 41/138 (29.71%), Postives = 70/138 (50.72%), Query Frame = 1
Query:   76 MKPPTFSSCKIISILFQLIPTIILLMERDSFVKSALSISYSAQDYNNLNIQFIVAISLFFFFTFGESLSHLVGCSILMPYQCIFSSLCHXXXXXXXXXXXXDRWPSSDYWYIFGFSSILPFVTECLTIARMLAIKPHY 489
            M+       + ++++  L+  I++   RD  VK  L   Y++ D+N+ +I+ IVA+S+       E +  + G ++ MP+Q + S+  H    +    FL D+WP   YWYIFGF S  P   E + I  +L  +  Y
Sbjct:    1 MQGTGLVPARFLTLIAHLVLVIVVFWTRDENVKMCLPEDYTSSDFNDKDIEMIVALSITLGLFAVEFIGFMGGVTMFMPFQALLSTAAHSGAAIALAYFLFDQWPCHWYWYIFGFCSAFPACMEIIYIIGILCFRKGY 138          
BLAST of transmembrane protein 107 vs. TrEMBL
Match: V3ZPK0 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_236353 PE=4 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 1.344e-13
Identity = 43/138 (31.16%), Postives = 69/138 (50.00%), Query Frame = 1
Query:   76 MKPPTFSSCKIISILFQLIPTIILLMERDSFVKSALSISYSAQDYNNLNIQFIVAISLFFFFTFGESLSHLVGCSILMPYQCIFSSLCHXXXXXXXXXXXXDRWPSSDYWYIFGFSSILPFVTECLTIARMLAIKPHY 489
            MK       + ++I+  L+  I++   +   +  +L   YS+  Y + + Q  VA+S+       E +  + G ++ MP+Q + S+  H    +    FL D WPS  YWY+FGF S  P VTE +TI  +LA K  Y
Sbjct:    1 MKLTGLIPARFLTIIAHLVIVIVIFFSKGENIVMSLPEDYSSDQYTSKDTQITVALSVTLGLFVLELIGFIGGITMFMPFQSLLSTCAHSSAAIVLSYFLFDGWPSDWYWYVFGFCSAFPAVTELITIIGVLAFKKGY 138          
BLAST of transmembrane protein 107 vs. TrEMBL
Match: A0A267H7X0 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig009266g1 PE=4 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 1.515e-13
Identity = 47/146 (32.19%), Postives = 82/146 (56.16%), Query Frame = 1
Query:  100 CKIISILFQLIPTIILLMERDSFVKSALSISYSAQDYNNLNIQFIVAISLF-FFFTFGESLSHLVGCSILMPYQCIFSSLCHXXXXXXXXXXXXDRWPSSDYWYIFGFSSILPFVTECLTIARMLAIKPHYRKRKTA*KPISFLRQ 534
             + + ++  ++ T+ + + RD  +K++LS +Y+  +YN  +++FI+ +++  F F F E LS L G ++ +P Q +FS+  H  G +   +FLLD WP +D++YIFGF    P VTE   I    +  P     K+A  P    +Q
Sbjct:    9 ARFLVLISHIVITVTIFISRDLHIKASLSTTYTTAEYNAEDLKFIIVLAVSCFLFAF-ELLSFLFGVTMFLPTQSLFSTASHFAGSVALLLFLLDSWPVNDFFYIFGFCIAFPAVTEVFAIISAFSYSP-----KSAEAPAKSSKQ 148          
BLAST of transmembrane protein 107 vs. TrEMBL
Match: A0A1S3HYH9 (transmembrane protein 107 OS=Lingula unguis OX=7574 GN=LOC106159355 PE=4 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 8.217e-13
Identity = 43/124 (34.68%), Postives = 64/124 (51.61%), Query Frame = 1
Query:  100 CKIISILFQLIPTIILLMERDSFVKSALSISYSAQDYNNLNIQFIVAISLFFFFTFGESLSHLVGCSILMPYQCIFSSLCHXXXXXXXXXXXXDRWPSSDYWYIFGFSSILPFVTECLTIARML 471
             + ++++  L+ TI +   RD  VKS L I YS   Y   + + IVA+S+   F   E +  L G S+ M  Q + S+  H    +    FL D WP  +YWY+FGF S  P VTE + +  +L
Sbjct:    9 ARFLTLIAHLVITITIFWSRDENVKSCLPIQYSPDAYTAKDTELIVALSITMAFFALELVGFLSGFSMFMYTQGMISTAAHASAAVTLAYFLFDAWPCDNYWYVFGFCSAFPAVTELIVLIGVL 132          
BLAST of transmembrane protein 107 vs. Ensembl Cavefish
Match: tmem107l (transmembrane protein 107-like [Source:NCBI gene;Acc:103046146])

HSP 1 Score: 63.929 bits (154), Expect = 7.020e-13
Identity = 35/128 (27.34%), Postives = 68/128 (53.12%), Query Frame = 1
Query:  103 KIISILFQLIPTIILLMERDSFVKSALSISYSAQDYNNLNIQFIVAISLFFFFTFGESLSHLVGCSILMPYQCIFSSLCHXXXXXXXXXXXXDRWPSSDYWYIFGFSSILPFVTECLTIARMLAIKPH 486
            + ++++  L+  I +   R++ V++ L + Y+ ++YN  + + +VA+S+     F E      G S+    Q + S+ CH  G +    FL ++W  S YW+IFGF S++P + E   +  +L +K  
Sbjct:   11 RFLTLIAHLVIVITIFWSRENNVRACLPLEYTNEEYNQEDTRLVVALSVTLGLFFVELAGFFSGISMFNNNQSLLSTACHASGAVALLFFLFEQWTCSIYWWIFGFCSVIPALYEMFLLFTVLGLKKK 138          
BLAST of transmembrane protein 107 vs. Ensembl Cavefish
Match: tmem107 (transmembrane protein 107-like [Source:NCBI gene;Acc:103024721])

HSP 1 Score: 45.4394 bits (106), Expect = 4.287e-6
Identity = 28/128 (21.88%), Postives = 58/128 (45.31%), Query Frame = 1
Query:  103 KIISILFQLIPTIILLMERDSFVKSALSISYSAQDYNNLNIQFIVAISLFFFFTFGESLSHLVGCSILMPYQCIFSSLCHXXXXXXXXXXXXDRWPSSDYWYIFGFSSILPFVTECLTIARMLAIKPH 486
            + +++   L+  I +   RD+ V++ L + ++   Y N + + ++ +S+       E L    G S+    Q + S   H    +    F+ ++W    YW IF   S++P V E + +  +L +K  
Sbjct:   11 RFLTLTAHLVIVITIFWSRDNNVRACLPLDFTEDQYRNEDNRLVIGLSVTLGLFALELLGFFSGVSMFNTNQGLLSVAAHCSASVSLSFFIFEQWECWYYWVIFSLCSVVPAVGELVQMFAVLCLKKK 138          
BLAST of transmembrane protein 107 vs. Ensembl Nematostella
Match: EDO45045 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RU98])

HSP 1 Score: 54.6842 bits (130), Expect = 6.995e-10
Identity = 31/136 (22.79%), Postives = 66/136 (48.53%), Query Frame = 1
Query:   76 MKPPTFSSCKIISILFQLIPTIILLMERDSFVKSALSISYSAQDYNNLNIQFIVAISLFFFFTFGESLSHLVGCSILMPYQCIFSSLCHXXXXXXXXXXXXDRWPSSDYWYIFGFSSILPFVTECLTIARMLAIKP 483
            M   +  + + +S++  L+ T+ +   +++ V + L ++Y+  +YN+ + + +V +SL   F   E    + G S+      + S   H    +   +F+L+ W    +WYIFGF S  P + E   +  +L ++ 
Sbjct:    1 MLSGSLVAARFLSLVAHLVITVTIFWSKEANVVACLPLNYTQTEYNDKHTELVVGLSLTLAFLVLEFGGFIGGVSMFNSTASMLSITAHTSAAISLSMFVLESWDCDKFWYIFGFCSAFPAIIEICVLIGVLGLRA 136          
BLAST of transmembrane protein 107 vs. Ensembl Medaka
Match: tmem107 (transmembrane protein 107 [Source:NCBI gene;Acc:101155221])

HSP 1 Score: 45.4394 bits (106), Expect = 4.866e-6
Identity = 32/135 (23.70%), Postives = 57/135 (42.22%), Query Frame = 1
Query:   76 MKPPTFSSCKIISILFQLIPTIILLMERDSFVKSALSISYSAQDYNNLNIQFIVAISLFFFFTFGESLSHLVGCSILMPYQCIFSSLCHXXXXXXXXXXXXDRWPSSDYWYIFGFSSILPFVTECLTIARMLAIK 480
            M P T      +     L+  I +   R++ VK+ L + ++ + Y+  + + +VA+S        E      G S+    Q + S+  H    +    FL ++W    YW+IF   S+LP   E L    +  +K
Sbjct:    1 MHPATGCCSNPMRHRAHLVIVITIFWSRENNVKACLPLEFTQEQYDTEDRKLVVALSATLGLFAIELAGFFSGVSMFSSSQGLLSTGVHASASVALLFFLFEQWECDIYWWIFAICSVLPAFVEILLFIAVFGLK 135          
BLAST of transmembrane protein 107 vs. Planmine SMEST
Match: SMESG000016814.1 (SMESG000016814.1)

HSP 1 Score: 264.618 bits (675), Expect = 2.024e-91
Identity = 144/144 (100.00%), Postives = 144/144 (100.00%), Query Frame = 1
Query:   76 MKPPTFSSCKIISILFQLIPTIILLMERDSFVKSALSISYSAQDYNNLNIQFIVAISLFFFFTFGESLSHLVGCSILMPYQCIFSSLCHXXXXXXXXXXXXDRWPSSDYWYIFGFSSILPFVTECLTIARMLAIKPHYRKRKTA 507
            MKPPTFSSCKIISILFQLIPTIILLMERDSFVKSALSISYSAQDYNNLNIQFIVAISLFFFFTFGESLSHLVGCSILMPYQCIFSSLCHLFGGLFTFIFLLDRWPSSDYWYIFGFSSILPFVTECLTIARMLAIKPHYRKRKTA
Sbjct:    1 MKPPTFSSCKIISILFQLIPTIILLMERDSFVKSALSISYSAQDYNNLNIQFIVAISLFFFFTFGESLSHLVGCSILMPYQCIFSSLCHLFGGLFTFIFLLDRWPSSDYWYIFGFSSILPFVTECLTIARMLAIKPHYRKRKTA 144          
BLAST of transmembrane protein 107 vs. Planmine SMEST
Match: SMESG000016814.1 (SMESG000016814.1)

HSP 1 Score: 218.009 bits (554), Expect = 2.252e-73
Identity = 119/119 (100.00%), Postives = 119/119 (100.00%), Query Frame = 1
Query:  151 MERDSFVKSALSISYSAQDYNNLNIQFIVAISLFFFFTFGESLSHLVGCSILMPYQCIFSSLCHXXXXXXXXXXXXDRWPSSDYWYIFGFSSILPFVTECLTIARMLAIKPHYRKRKTA 507
            MERDSFVKSALSISYSAQDYNNLNIQFIVAISLFFFFTFGESLSHLVGCSILMPYQCIFSSLCHLFGGLFTFIFLLDRWPSSDYWYIFGFSSILPFVTECLTIARMLAIKPHYRKRKTA
Sbjct:    1 MERDSFVKSALSISYSAQDYNNLNIQFIVAISLFFFFTFGESLSHLVGCSILMPYQCIFSSLCHLFGGLFTFIFLLDRWPSSDYWYIFGFSSILPFVTECLTIARMLAIKPHYRKRKTA 119          
BLAST of transmembrane protein 107 vs. Planmine SMEST
Match: SMESG000062875.1 (SMESG000062875.1)

HSP 1 Score: 50.8322 bits (120), Expect = 4.209e-8
Identity = 47/153 (30.72%), Postives = 75/153 (49.02%), Query Frame = 1
Query:   91 FSSCKIISILFQLIPTIILLMERDSFVKSALSISY----SAQDYNNLNIQFIVAISLFFF----------FTFGES----LSHLVGCSILMPYQCIFSSLCHXXXXXXXXXXXXDRWPSSDYWYIFGFSSILPFVTECLTIARMLAIKPHYRK 495
            FS+ + ++++ QLI TI LL+ ++ ++K  +S S     S+Q  + +NI   ++I L  F          F+F +S    LSHL+G S L+ Y                       W  S YWY+FGF+ I+PF+TE ++I R  +   H  K
Sbjct:    7 FSAIRFVALVLQLILTIHLLIIKNVYIKQTVSQSQASLTSSQITSEMNIVLPISIGLMIFELICFSIRSMFSFTQSMISTLSHLLGSSTLLIYTV-------------------SIWSWSVYWYVFGFTVIVPFLTEIISIGRSFSYDRHTMK 140          
BLAST of transmembrane protein 107 vs. Planmine SMEST
Match: SMESG000062875.1 (SMESG000062875.1)

HSP 1 Score: 48.9062 bits (115), Expect = 9.440e-7
Identity = 47/153 (30.72%), Postives = 75/153 (49.02%), Query Frame = 1
Query:   91 FSSCKIISILFQLIPTIILLMERDSFVKSALSISY----SAQDYNNLNIQFIVAISLFFF----------FTFGES----LSHLVGCSILMPYQCIFSSLCHXXXXXXXXXXXXDRWPSSDYWYIFGFSSILPFVTECLTIARMLAIKPHYRK 495
            FS+ + ++++ QLI TI LL+ ++ ++K  +S S     S+Q  + +NI   ++I L  F          F+F +S    LSHL+G S L+ Y                       W  S YWY+FGF+ I+PF+TE ++I R  +   H  K
Sbjct:    7 FSAIRFVALVLQLILTIHLLIIKNVYIKQTVSQSQASLTSSQITSEMNIVLPISIGLMIFELICFSIRSMFSFTQSMISTLSHLLGSSTLLIYTVSI-------------------WSWSVYWYVFGFTVIVPFLTEIISIGRSFSYDRHTMK 140          
The following BLAST results are available for this feature:
BLAST of transmembrane protein 107 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
TMEM1079.994e-1228.57transmembrane protein 107 [Source:HGNC Symbol;Acc:... [more]
TMEM1071.389e-826.52transmembrane protein 107 [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of transmembrane protein 107 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of transmembrane protein 107 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of transmembrane protein 107 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
tmem107l1.471e-925.40transmembrane protein 107 like [Source:ZFIN;Acc:ZD... [more]
tmem107l1.471e-925.40transmembrane protein 107 like [Source:ZFIN;Acc:ZD... [more]
tmem107l1.471e-925.40transmembrane protein 107 like [Source:ZFIN;Acc:ZD... [more]
tmem1078.467e-624.35transmembrane protein 107 [Source:NCBI gene;Acc:40... [more]
back to top
BLAST of transmembrane protein 107 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
TMEM1071.315e-1030.43transmembrane protein 107 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of transmembrane protein 107 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Tmem1071.100e-927.83transmembrane protein 107 [Source:MGI Symbol;Acc:M... [more]
Tmem1071.029e-625.47transmembrane protein 107 [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of transmembrane protein 107 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|Q6UX40|TM107_HUMAN4.799e-1128.57Transmembrane protein 107 OS=Homo sapiens OX=9606 ... [more]
sp|D3ZFW5|TM107_RAT5.964e-927.83Transmembrane protein 107 OS=Rattus norvegicus OX=... [more]
sp|Q9CPV0|TM107_MOUSE7.695e-927.83Transmembrane protein 107 OS=Mus musculus OX=10090... [more]
back to top
BLAST of transmembrane protein 107 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
R7V2C96.360e-1433.91Uncharacterized protein OS=Capitella teleta OX=283... [more]
A0A2C9LGI17.067e-1429.71Uncharacterized protein OS=Biomphalaria glabrata O... [more]
V3ZPK01.344e-1331.16Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
A0A267H7X01.515e-1332.19Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1S3HYH98.217e-1334.68transmembrane protein 107 OS=Lingula unguis OX=757... [more]
back to top
BLAST of transmembrane protein 107 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
tmem107l7.020e-1327.34transmembrane protein 107-like [Source:NCBI gene;A... [more]
tmem1074.287e-621.88transmembrane protein 107-like [Source:NCBI gene;A... [more]
back to top
BLAST of transmembrane protein 107 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of transmembrane protein 107 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of transmembrane protein 107 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO450456.995e-1022.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of transmembrane protein 107 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tmem1074.866e-623.70transmembrane protein 107 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of transmembrane protein 107 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000016814.12.024e-91100.00SMESG000016814.1[more]
SMESG000016814.12.252e-73100.00SMESG000016814.1[more]
SMESG000062875.14.209e-830.72SMESG000062875.1[more]
SMESG000062875.19.440e-730.72SMESG000062875.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012091 ID=SMED30012091|Name=transmembrane protein 107|organism=Schmidtea mediterranea sexual|type=transcript|length=630bp
CACCGAATGTGATATTTTAAAAAAATCGTTATTCTTCATCTTAATTAATA
TAATATTGAACAAAAGTGACTTATAATGAAACCTCCTACATTTTCATCAT
GTAAAATAATCTCGATATTATTTCAATTAATACCAACTATTATTTTGTTA
ATGGAACGAGATAGTTTTGTCAAATCAGCTTTGTCTATTTCATATTCAGC
CCAAGATTATAATAATCTTAATATCCAGTTTATCGTCGCAATTTCGCTGT
TTTTTTTCTTCACATTCGGTGAAAGTTTGTCTCATCTAGTTGGTTGTTCA
ATTCTAATGCCTTATCAATGCATTTTCTCATCGTTGTGCCACCTTTTCGG
TGGGCTGTTCACGTTTATTTTCCTCCTTGACAGATGGCCATCGAGCGATT
ATTGGTACATATTTGGATTCTCCAGCATTCTGCCGTTCGTTACCGAATGC
CTGACGATTGCTCGAATGCTCGCTATCAAGCCGCACTACAGAAAACGGAA
AACCGCTTGAAAACCGATTTCATTTCTCAGACAAATGTAAATAAATGCGA
TATATTGATTTTGTCTCGCGATCAAACCGATCGCTTTATTGGATTTCTTT
ACGGCAAATAATCAATAAATACTATAGGCG
back to top

protein sequence of SMED30012091-orf-1

>SMED30012091-orf-1 ID=SMED30012091-orf-1|Name=SMED30012091-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=145bp
MKPPTFSSCKIISILFQLIPTIILLMERDSFVKSALSISYSAQDYNNLNI
QFIVAISLFFFFTFGESLSHLVGCSILMPYQCIFSSLCHLFGGLFTFIFL
LDRWPSSDYWYIFGFSSILPFVTECLTIARMLAIKPHYRKRKTA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR029248TMEM107
Vocabulary: molecular function
TermDefinition
GO:0003674molecular_function
Vocabulary: cellular component
TermDefinition
GO:0005575cellular_component
GO:0016020membrane
GO:0016021integral component of membrane
GO:0035869ciliary transition zone
Vocabulary: biological process
TermDefinition
GO:0007275multicellular organism development
GO:0008150biological_process
GO:0021532neural tube patterning
GO:0030030cell projection organization
GO:0042733embryonic digit morphogenesis
GO:0060271cilium morphogenesis
GO:1904491protein localization to ciliary transition zone
GO:1905515non-motile cilium assembly
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR029248Transmembrane protein 107PFAMPF14995TMEM107coord: 9..127
e-value: 1.1E-17
score: 64.6
IPR029248Transmembrane protein 107PANTHERPTHR34341FAMILY NOT NAMEDcoord: 13..134
NoneNo IPR availableTMHMMTMhelixcoord: 79..101
NoneNo IPR availableTMHMMTMhelixcoord: 50..72
NoneNo IPR availableTMHMMTMhelixcoord: 7..26
NoneNo IPR availableTMHMMTMhelixcoord: 111..133