G_PROTEIN_RECEP_F1_2 domain-containing protein

Overview
NameG_PROTEIN_RECEP_F1_2 domain-containing protein
Smed IDSMED30012077
Length (bp)1815
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30012077) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30012077) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012077

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
reproductive organSMED30012077h1SMcG0003394 Contig37861uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30012077h1SMcG0003394 Contig37861newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Match: GHSR (growth hormone secretagogue receptor [Source:HGNC Symbol;Acc:HGNC:4267])

HSP 1 Score: 62.7734 bits (151), Expect = 4.405e-10
Identity = 40/168 (23.81%), Postives = 85/168 (50.60%), Query Frame = 3
Query:  342 QMNETSATSNEKTLLEIRQIF-LPISYQLQLYSIPIFLTVGILGNPISFVVWVSRKLRRNNSSAVYIAMLAINDFFVVICSIIYYLR----HSWGFGIIDIRGICKFYMVIFTFLQYNSILLVFGFTIERWIAVCYPFRRERCCTENRAWIACGIIFSSVFISVFPLF 830
             ++  ++  N+    E+ Q+F  P+   +    + +F+ VGI GN ++ +V VSR      ++ +Y++ +A +D  + +C  +  +R      W FG +    +CK +  +     Y ++L +   ++ER+ A+C+P R +   T+ R  +   +I++  F S  P+F
Sbjct:   18 DLDWDASPGNDSLGDELLQLFPAPLLAGVTATCVALFV-VGIAGNLLTMLV-VSRFRELRTTTNLYLSSMAFSDLLIFLCMPLDLVRLWQYRPWNFGDL----LCKLFQFVSESCTYATVLTITALSVERYFAICFPLRAKVVVTKGRVKLVIFVIWAVAFCSAGPIF 179          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Match: GHSR (growth hormone secretagogue receptor [Source:HGNC Symbol;Acc:HGNC:4267])

HSP 1 Score: 62.3882 bits (150), Expect = 8.920e-10
Identity = 40/168 (23.81%), Postives = 85/168 (50.60%), Query Frame = 3
Query:  342 QMNETSATSNEKTLLEIRQIF-LPISYQLQLYSIPIFLTVGILGNPISFVVWVSRKLRRNNSSAVYIAMLAINDFFVVICSIIYYLR----HSWGFGIIDIRGICKFYMVIFTFLQYNSILLVFGFTIERWIAVCYPFRRERCCTENRAWIACGIIFSSVFISVFPLF 830
             ++  ++  N+    E+ Q+F  P+   +    + +F+ VGI GN ++ +V VSR      ++ +Y++ +A +D  + +C  +  +R      W FG +    +CK +  +     Y ++L +   ++ER+ A+C+P R +   T+ R  +   +I++  F S  P+F
Sbjct:   18 DLDWDASPGNDSLGDELLQLFPAPLLAGVTATCVALFV-VGIAGNLLTMLV-VSRFRELRTTTNLYLSSMAFSDLLIFLCMPLDLVRLWQYRPWNFGDL----LCKLFQFVSESCTYATVLTITALSVERYFAICFPLRAKVVVTKGRVKLVIFVIWAVAFCSAGPIF 179          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Match: F2RL2 (coagulation factor II thrombin receptor like 2 [Source:HGNC Symbol;Acc:HGNC:3539])

HSP 1 Score: 55.0694 bits (131), Expect = 1.833e-7
Identity = 41/134 (30.60%), Postives = 71/134 (52.99%), Query Frame = 3
Query:  444 IFLTVGILGNPISFV-VWVSRKLRRNNSSAVYIAMLAINDFFVVIC---SIIYYLR-HSWGFGIIDIRGICKFYMVIFTFLQYNSILLVFGFTIERWIAVCYPFRRERCCTENRAWIACGIIFSSVFISVFPLF 830
            I+L V ++G P + V +W+     R+  + V+   LAI DF   +     I Y+L  ++W FG +    +C+   VIF    Y SILL+   +I R++A+ +PF          A + CG+++++VF+ + P F
Sbjct:   78 IYLLVFVVGVPANAVTLWMLFFRTRSICTTVFYTNLAIADFLFCVTLPFKIAYHLNGNNWVFGEV----LCRATTVIFYGNMYCSILLLACISINRYLAIVHPFTYRGLPKHTYALVTCGLVWATVFLYMLPFF 207          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Match: F2RL2 (coagulation factor II thrombin receptor like 2 [Source:HGNC Symbol;Acc:HGNC:3539])

HSP 1 Score: 55.0694 bits (131), Expect = 1.936e-7
Identity = 41/134 (30.60%), Postives = 71/134 (52.99%), Query Frame = 3
Query:  444 IFLTVGILGNPISFV-VWVSRKLRRNNSSAVYIAMLAINDFFVVIC---SIIYYLR-HSWGFGIIDIRGICKFYMVIFTFLQYNSILLVFGFTIERWIAVCYPFRRERCCTENRAWIACGIIFSSVFISVFPLF 830
            I+L V ++G P + V +W+     R+  + V+   LAI DF   +     I Y+L  ++W FG +    +C+   VIF    Y SILL+   +I R++A+ +PF          A + CG+++++VF+ + P F
Sbjct:  100 IYLLVFVVGVPANAVTLWMLFFRTRSICTTVFYTNLAIADFLFCVTLPFKIAYHLNGNNWVFGEV----LCRATTVIFYGNMYCSILLLACISINRYLAIVHPFTYRGLPKHTYALVTCGLVWATVFLYMLPFF 229          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Match: LPAR6 (lysophosphatidic acid receptor 6 [Source:HGNC Symbol;Acc:HGNC:15520])

HSP 1 Score: 50.8322 bits (120), Expect = 3.978e-6
Identity = 37/146 (25.34%), Postives = 73/146 (50.00%), Query Frame = 3
Query:  414 SYQLQLYS--IPIFLTVGILGNPISFVVWVSRKLRRNNSSAVYIAMLAINDFFVVIC---SIIYYLRHSWGFGIIDIRGICKFYMVIFTFLQYNSILLVFGFTIERWIAVCYPFRRERCCTENRAWIACGIIFSSVFISVFPLFFV 836
            S++  LY     +   +G++ N ++  +++   L+  N +  Y+  LA++D   V      I Y+   +W FG +    +CK  +++F    Y SIL +   +++R++A+ YPF+ +   T+  A I C  ++ +V     P  FV
Sbjct:   14 SFKYTLYGCMFSMVFVLGLISNCVAIYIFIC-VLKVRNETTTYMINLAMSDLLFVFTLPFRIFYFTTRNWPFGDL----LCKISVMLFYTNMYGSILFLTCISVDRFLAIVYPFKSKTLRTKRNAKIVCTGVWLTVIGGSAPAVFV 154          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Match: frpr-18 (FLP-2 receptor; FMRFamide Peptide Receptor family [Source:UniProtKB/TrEMBL;Acc:G5EEB1])

HSP 1 Score: 66.6254 bits (161), Expect = 1.787e-11
Identity = 73/265 (27.55%), Postives = 123/265 (46.42%), Query Frame = 3
Query:  414 SYQLQLYSIPIFLTVGILGNPISFVVWVSRKLRRNNSSAVYIAMLAINDFFVVICSIIYYLRHSWGFGIIDIR------GICKFYMVIFTFLQYNSILLVFGFTIERWIAVCYPFRRERCCTENRAWIACGIIFSSVFISVFPLFFVWHY--QPLCSVPKHWIENT-----YFVTYSLTLEILFSALLPVITLA-VNIRVVVEMYRISETIVTFPKLSAVNQNFEIPSQKSRKHSKNTENSISFKSTTITLLLVSF-FQILTTLP 1163
            S QL   +I + + VGI GN +SF+++ SR   R++S  V +  L+  DF ++  SI  ++  +      D+        I K    I   +Q  S+ ++   T+ERW+AVC P +    CT  ++  A  +I  S F+  F  FF + +      ++ + W+ +      Y+V Y   L I+   L+P   +A  N  V+V M ++S+T     +            Q+ R+           +STT+ LL+V+F F I  TLP
Sbjct:    3 SQQLMACAILVIVLVGIFGNSLSFILF-SRPHMRSSSVNVLLCALSFFDFSLLTLSIPIFVIPNLDLWANDLSLSTYMAYILKLIYPINLMMQTCSVYIMVMITLERWVAVCRPLQVRVWCTPRKSRNAILVIIVSAFLYNFVRFFEYRFVVTESGALYEKWLRDPGKHRWYYVGYYTILYIVTHFLVPFSVMAFANGHVIVAMCKLSKTRQMLTR------------QQQRE-----------QSTTVMLLIVTFVFAICNTLP 243          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Match: frpr-18 (FLP-2 receptor; FMRFamide Peptide Receptor family [Source:UniProtKB/TrEMBL;Acc:G5EEB1])

HSP 1 Score: 65.855 bits (159), Expect = 2.940e-11
Identity = 73/265 (27.55%), Postives = 123/265 (46.42%), Query Frame = 3
Query:  414 SYQLQLYSIPIFLTVGILGNPISFVVWVSRKLRRNNSSAVYIAMLAINDFFVVICSIIYYLRHSWGFGIIDIR------GICKFYMVIFTFLQYNSILLVFGFTIERWIAVCYPFRRERCCTENRAWIACGIIFSSVFISVFPLFFVWHY--QPLCSVPKHWIENT-----YFVTYSLTLEILFSALLPVITLA-VNIRVVVEMYRISETIVTFPKLSAVNQNFEIPSQKSRKHSKNTENSISFKSTTITLLLVSF-FQILTTLP 1163
            S QL   +I + + VGI GN +SF+++ SR   R++S  V +  L+  DF ++  SI  ++  +      D+        I K    I   +Q  S+ ++   T+ERW+AVC P +    CT  ++  A  +I  S F+  F  FF + +      ++ + W+ +      Y+V Y   L I+   L+P   +A  N  V+V M ++S+T     +            Q+ R+           +STT+ LL+V+F F I  TLP
Sbjct:    3 SQQLMACAILVIVLVGIFGNSLSFILF-SRPHMRSSSVNVLLCALSFFDFSLLTLSIPIFVIPNLDLWANDLSLSTYMAYILKLIYPINLMMQTCSVYIMVMITLERWVAVCRPLQVRVWCTPRKSRNAILVIIVSAFLYNFVRFFEYRFVVTESGALYEKWLRDPGKHRWYYVGYYTILYIVTHFLVPFSVMAFANGHVIVAMCKLSKTRQMLTR------------QQQRE-----------QSTTVMLLIVTFVFAICNTLP 243          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Match: frpr-6 (FMRFamide Peptide Receptor family [Source:UniProtKB/TrEMBL;Acc:Q8I7K6])

HSP 1 Score: 62.003 bits (149), Expect = 4.062e-10
Identity = 56/207 (27.05%), Postives = 102/207 (49.28%), Query Frame = 3
Query:  438 IPIFLTVGILGNPISFVVWVSRKLRRNNSSAVYIAMLAINDFFVVICSIIYY----------LRHSWGFGIIDIRGICKFYMVIFTFLQYNSILLVFGFTIERWIAVCYPFRRERCCT-ENRAWIACGIIFSSVFISVFPLFF-----------VWHYQPLCSVPKHWIENTYFVTYSLTLEILFSALLP-VITLAVNIRVVVEMYR 989
            +PI L VG++GN +S  V+ +  +R++ + A  +  L+I D FV++ ++  Y          +  +W    + I    KF+  +    +  S+ ++   T+ERWIAVC P +    CT +N   I   II  S+ ++ FP FF            W  + +    +HW    Y+++Y + + ++F  LLP VI    N++V+ E+ +
Sbjct:   15 LPIIL-VGLVGNGLSLYVYTTPNMRKS-TVAFLLYSLSICDIFVLLFALPLYSISYLPIWDNVYGAWSMRRMFIAFSTKFFYPLCMTAKTASLYIMVVITVERWIAVCRPLQVHIWCTFKNSVRIVIAIITFSIILN-FPKFFEYQIGYSDALGYWPKRGILDAEEHW---WYYISYFIIISVIFDYLLPFVIMFIANMKVINELRK 215          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Match: frpr-18 (FLP-2 receptor; FMRFamide Peptide Receptor family [Source:UniProtKB/TrEMBL;Acc:G5EEB1])

HSP 1 Score: 61.2326 bits (147), Expect = 7.546e-10
Identity = 59/210 (28.10%), Postives = 102/210 (48.57%), Query Frame = 3
Query:  414 SYQLQLYSIPIFLTVGILGNPISFVVWVSRKLRRNNSSAVYIAMLAINDFFVVICSIIYYLRHSWGFGIIDIR------GICKFYMVIFTFLQYNSILLVFGFTIERWIAVCYPFRRERCCTENRAWIACGIIFSSVFISVFPLFFVWHY--QPLCSVPKHWIENT-----YFVTYSLTLEILFSALLPVITLA-VNIRVVVEMYRISET 1001
            S QL   +I + + VGI GN +SF+++ SR   R++S  V +  L+  DF ++  SI  ++  +      D+        I K    I   +Q  S+ ++   T+ERW+AVC P +    CT  ++  A  +I  S F+  F  FF + +      ++ + W+ +      Y+V Y   L I+   L+P   +A  N  V+V M ++S+T
Sbjct:    3 SQQLMACAILVIVLVGIFGNSLSFILF-SRPHMRSSSVNVLLCALSFFDFSLLTLSIPIFVIPNLDLWANDLSLSTYMAYILKLIYPINLMMQTCSVYIMVMITLERWVAVCRPLQVRVWCTPRKSRNAILVIIVSAFLYNFVRFFEYRFVVTESGALYEKWLRDPGKHRWYYVGYYTILYIVTHFLVPFSVMAFANGHVIVAMCKLSKT 211          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Match: frpr-3 (FMRFamide Peptide Receptor family; VRFamide receptor 1 [Source:UniProtKB/TrEMBL;Acc:G5EG36])

HSP 1 Score: 56.225 bits (134), Expect = 3.453e-8
Identity = 43/131 (32.82%), Postives = 67/131 (51.15%), Query Frame = 3
Query:  459 GILGNPISFVVWVSRKLRRNNSSAVYIAMLAINDFFVVICSIIYYLRHSWGFGII-DIRGICKFYMVIFTFL-QYNSILLVFGFTIERWIAVCYPFRRERCCTENRAWIACGIIFSSVFISVFPLFFVWHY 845
            GIL N ISF ++ +RK  R  S  V +A L+++D  V + +I  +        I   I  +   Y+   T + Q  S+ L+   TI+R++AVC+PF     CT NRA I  G++   +F   + L  +W Y
Sbjct:   20 GILTNFISFYIY-TRKTFRKKSINVLLAALSMSDLCVCVLAIPVFASTQLQQVIPPTITAMIMVYLYPVTIMFQSVSVWLLVSITIDRYLAVCHPFMVNTYCTRNRALITVGVVV--IFSVAYNLIRIWEY 147          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Match: CNMaR (gene:FBgn0053696 transcript:FBtr0091684)

HSP 1 Score: 65.4698 bits (158), Expect = 6.903e-11
Identity = 55/184 (29.89%), Postives = 88/184 (47.83%), Query Frame = 3
Query:  237 DYITNKSNCISFCLNSVEFAKLKQTLLKKKENQYYQMNETSATSNEKTLLEIRQIFLPISYQLQLYSIPIFLTVGILGNPISFVVWVSRKLRRNNSSAVYIAMLAINDFFVVICSIIYYLRHSWGFGIIDIRG---ICKFYMVIFTFLQYNSILLVFGFTIERWIAVCYPFRRERCCTENRAWI 779
            +YIT+ S  I+    +   + L ++ + +        NE SA  +E    E+ +I   I + +  Y IP+    G +GN +S  V+   KLR+  SS+ Y+A LA++D     C +         F  +DI      C+F+        + S+  V  FT+ER+IAV YP +R+  CT  RA I
Sbjct:    4 EYITSSSGNITATTEADFSSSLGESNVTEYNTTEMDANE-SAGEDE----EMLRIAFFIGHFVHQYYIPVLCCTGSIGNILSVFVFFRTKLRKL-SSSFYLAALAVSD----TCFLAGLFAQWLNFLNVDIYNQNYFCQFFTFFSYLASFCSVWFVVAFTVERFIAVIYPLKRQTMCTVRRAKI 177          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Match: Proc-R (gene:FBgn0029723 transcript:FBtr0100552)

HSP 1 Score: 58.151 bits (139), Expect = 1.653e-8
Identity = 44/158 (27.85%), Postives = 75/158 (47.47%), Query Frame = 3
Query:  345 MNETSATSNE----KTLLEIRQIFLPISYQLQLYSIPIFLTVGILGNPISFVVWVSRKLRRNNSSAVYIAMLAINDFFVVICSIIYYLRH----SWGFGIIDIRGICKFYMVIFTFL-------QYNSILLVFGFTIERWIAVCYPFRRERCCTENRA 773
            ++E +AT  E      + E+R +       +Q   +P    +G+LGN +S  V   +++R   ++ +Y+  LAI D   + C +I  L+H     + F         K Y  ++ +         Y SI +   FTIER+IA+ YP +R+  CTE+ A
Sbjct:   19 LDEANATVGEMFSDADMAEVRHV-------VQRILVPCVFVIGLLGNSVSIYVLTRKRMR--CTTNIYLTALAITDIAYLTCQLILSLQHYDYPKYHF---------KLYWQLYGYFVWLCDSFGYISIYIAVCFTIERFIAIRYPLKRQTFCTESLA 158          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Match: Proc-R (gene:FBgn0029723 transcript:FBtr0070713)

HSP 1 Score: 58.151 bits (139), Expect = 1.653e-8
Identity = 44/158 (27.85%), Postives = 75/158 (47.47%), Query Frame = 3
Query:  345 MNETSATSNE----KTLLEIRQIFLPISYQLQLYSIPIFLTVGILGNPISFVVWVSRKLRRNNSSAVYIAMLAINDFFVVICSIIYYLRH----SWGFGIIDIRGICKFYMVIFTFL-------QYNSILLVFGFTIERWIAVCYPFRRERCCTENRA 773
            ++E +AT  E      + E+R +       +Q   +P    +G+LGN +S  V   +++R   ++ +Y+  LAI D   + C +I  L+H     + F         K Y  ++ +         Y SI +   FTIER+IA+ YP +R+  CTE+ A
Sbjct:   19 LDEANATVGEMFSDADMAEVRHV-------VQRILVPCVFVIGLLGNSVSIYVLTRKRMR--CTTNIYLTALAITDIAYLTCQLILSLQHYDYPKYHF---------KLYWQLYGYFVWLCDSFGYISIYIAVCFTIERFIAIRYPLKRQTFCTESLA 158          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Match: Proc-R (gene:FBgn0029723 transcript:FBtr0100551)

HSP 1 Score: 58.151 bits (139), Expect = 1.653e-8
Identity = 44/158 (27.85%), Postives = 75/158 (47.47%), Query Frame = 3
Query:  345 MNETSATSNE----KTLLEIRQIFLPISYQLQLYSIPIFLTVGILGNPISFVVWVSRKLRRNNSSAVYIAMLAINDFFVVICSIIYYLRH----SWGFGIIDIRGICKFYMVIFTFL-------QYNSILLVFGFTIERWIAVCYPFRRERCCTENRA 773
            ++E +AT  E      + E+R +       +Q   +P    +G+LGN +S  V   +++R   ++ +Y+  LAI D   + C +I  L+H     + F         K Y  ++ +         Y SI +   FTIER+IA+ YP +R+  CTE+ A
Sbjct:   19 LDEANATVGEMFSDADMAEVRHV-------VQRILVPCVFVIGLLGNSVSIYVLTRKRMR--CTTNIYLTALAITDIAYLTCQLILSLQHYDYPKYHF---------KLYWQLYGYFVWLCDSFGYISIYIAVCFTIERFIAIRYPLKRQTFCTESLA 158          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Match: Proc-R (gene:FBgn0029723 transcript:FBtr0070714)

HSP 1 Score: 58.151 bits (139), Expect = 1.653e-8
Identity = 44/158 (27.85%), Postives = 75/158 (47.47%), Query Frame = 3
Query:  345 MNETSATSNE----KTLLEIRQIFLPISYQLQLYSIPIFLTVGILGNPISFVVWVSRKLRRNNSSAVYIAMLAINDFFVVICSIIYYLRH----SWGFGIIDIRGICKFYMVIFTFL-------QYNSILLVFGFTIERWIAVCYPFRRERCCTENRA 773
            ++E +AT  E      + E+R +       +Q   +P    +G+LGN +S  V   +++R   ++ +Y+  LAI D   + C +I  L+H     + F         K Y  ++ +         Y SI +   FTIER+IA+ YP +R+  CTE+ A
Sbjct:   19 LDEANATVGEMFSDADMAEVRHV-------VQRILVPCVFVIGLLGNSVSIYVLTRKRMR--CTTNIYLTALAITDIAYLTCQLILSLQHYDYPKYHF---------KLYWQLYGYFVWLCDSFGYISIYIAVCFTIERFIAIRYPLKRQTFCTESLA 158          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Match: oxgr1a.1 (oxoglutarate (alpha-ketoglutarate) receptor 1a, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-060421-6734])

HSP 1 Score: 59.3066 bits (142), Expect = 4.461e-9
Identity = 46/171 (26.90%), Postives = 84/171 (49.12%), Query Frame = 3
Query:  330 NQYYQMNETSATSNEKTLLEIRQIFLPISYQLQLYSIPIFLTVGILGNPISFVVWVSRKLRRNNSSAVYIAMLAIND--FFVVICSIIYY--LRHSWGFGIIDIRGICKFYMVIFTFLQYNSILLVFGFTIERWIAVCYPFRRERCCTENRAWIACGIIFSSVFISVFPLF 830
            N YY M   S  +      ++++ +LP  Y        IF+ VG++GN  + +V++  K+R   SS + +  L + D  F + +  ++YY  L  SW  GI     +C+F   IF F  Y SIL +  F+I R++A+ +P    +   +    ++C +++      + P+F
Sbjct:    4 NPYYDMTNNSLDNCTDVDDKVKRYYLPAMYG------AIFI-VGVIGNITALLVYL-LKVRPWKSSTIIMVNLVLTDLLFMISLPFLVYYYVLNDSWTLGIT----VCRFARFIFHFNLYGSILFLTCFSIFRYVAIVHPQHSHKIRRKRWGVVSCALVWVVTVAELSPIF 162          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Match: lpar6b (lysophosphatidic acid receptor 6b [Source:ZFIN;Acc:ZDB-GENE-110408-67])

HSP 1 Score: 59.3066 bits (142), Expect = 4.914e-9
Identity = 39/132 (29.55%), Postives = 67/132 (50.76%), Query Frame = 3
Query:  414 SYQLQLYS--IPIFLTVGILGNPISFVVWVSRKLRRNNSSAVYIAMLAINDFFVVIC---SIIYYLRHSWGFGIIDIRGICKFYMVIFTFLQYNSILLVFGFTIERWIAVCYPFRRERCCTENRAWIACGII 794
            S++  LYS    I   +G+L N ++  ++V R L+  N +  Y+  L ++D   V+       Y++   W FG      +CK  + +F    Y SIL +   +++R++A+ YPF      T+  A IACG+I
Sbjct:   12 SFKYVLYSSVFSIVFILGLLFNMVAMYIFVCR-LKMRNETTTYMMNLVVSDSLFVVSLPFRTFYFINRQWPFG----DALCKISVTLFYTNMYGSILFLTCISVDRFLAIVYPFASRTLRTKRNAKIACGVI 138          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Match: oxgr1a.2 (oxoglutarate (alpha-ketoglutarate) receptor 1a, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-090312-1])

HSP 1 Score: 58.5362 bits (140), Expect = 9.355e-9
Identity = 46/173 (26.59%), Postives = 86/173 (49.71%), Query Frame = 3
Query:  330 NQYYQMNETSATSNEKTLLEIRQIFLPISYQLQLYSIPIFLTVGILGNPISFVVWVSRKLRRNNSSAVYIAMLAIND--FFVVICSIIYY--LRHSWGFGIIDIRGICKFYMVIFTFLQYNSILLVFGFTIERWIAVCYPFRRERCCTENRAWIACGIIFSSVFISVFPLFFV 836
            N YY M  TS+ +      ++++ +LP  Y        IF+ VG++GN  + +V++  K+R   SS + +  L + D  F + +  ++YY  L  SW  GI     +C+F   IF F  Y SIL +   +I R++A+ +P    +   +    ++C +++      + P+ +V
Sbjct:    4 NLYYDMTNTSSDNCTDVDSKMKRYYLPAMYG------AIFI-VGVIGNITALLVYL-LKVRPWKSSTIIMVNLVLTDLLFMISLPFLVYYYVLNDSWTLGIT----VCRFARFIFHFNLYGSILFLSCVSIFRYVAIVHPQHSHKIRRKRWGVVSCVLVWVITLAELSPILYV 164          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Match: ntsr1 (neurotensin receptor 1 (high affinity) [Source:ZFIN;Acc:ZDB-GENE-090313-372])

HSP 1 Score: 56.9954 bits (136), Expect = 3.506e-8
Identity = 49/195 (25.13%), Postives = 90/195 (46.15%), Query Frame = 3
Query:  300 LKQTLLKK-KENQYYQMNETSATSNEKTLLEIR---QIFLPISYQLQLYSIPIFLTVGILGNPISFVVWVSRKLRRNNSSAVY--IAMLAINDFFV-VICSII-----YYLRHSWGFGIIDIRGICKFYMVIFTFLQYNSILLVFGFTIERWIAVCYPFRRERCCTENRAWIACGIIFSSVFISVFPLFFVWHYQ 848
            L Q LL     +Q +  NET + S E   +      ++ + + Y      + +FL +G LGN I+    +++K  +N  S V+  +A LAI+D  + V+C  I      ++ H W FG      +CK Y  +     Y +   +   ++ER++A+C+PF+ +   + +R       ++ + F    P+ F    Q
Sbjct:   17 LAQKLLSSANRSQPFLDNETESLSEEDLDVNTDIYSKVLVTVIY------VVLFL-IGCLGNSITLYTLLTKKSLQNLQSTVHYHLASLAISDLLILVLCMPIELYNFIWVHHPWAFG----EAVCKGYYFLRDGCSYATAFNIASLSVERFMAICHPFKAKSIMSRSRTKKLISAMWIASFFLATPMLFTMGQQ 200          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Match: ntsr1 (neurotensin receptor 1 (high affinity) [Source:ZFIN;Acc:ZDB-GENE-090313-372])

HSP 1 Score: 56.9954 bits (136), Expect = 3.506e-8
Identity = 49/195 (25.13%), Postives = 90/195 (46.15%), Query Frame = 3
Query:  300 LKQTLLKK-KENQYYQMNETSATSNEKTLLEIR---QIFLPISYQLQLYSIPIFLTVGILGNPISFVVWVSRKLRRNNSSAVY--IAMLAINDFFV-VICSII-----YYLRHSWGFGIIDIRGICKFYMVIFTFLQYNSILLVFGFTIERWIAVCYPFRRERCCTENRAWIACGIIFSSVFISVFPLFFVWHYQ 848
            L Q LL     +Q +  NET + S E   +      ++ + + Y      + +FL +G LGN I+    +++K  +N  S V+  +A LAI+D  + V+C  I      ++ H W FG      +CK Y  +     Y +   +   ++ER++A+C+PF+ +   + +R       ++ + F    P+ F    Q
Sbjct:   17 LAQKLLSSANRSQPFLDNETESLSEEDLDVNTDIYSKVLVTVIY------VVLFL-IGCLGNSITLYTLLTKKSLQNLQSTVHYHLASLAISDLLILVLCMPIELYNFIWVHHPWAFG----EAVCKGYYFLRDGCSYATAFNIASLSVERFMAICHPFKAKSIMSRSRTKKLISAMWIASFFLATPMLFTMGQQ 200          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Xenopus
Match: GHSR (growth hormone secretagogue receptor [Source:NCBI gene;Acc:100497774])

HSP 1 Score: 57.3806 bits (137), Expect = 2.909e-8
Identity = 39/174 (22.41%), Postives = 84/174 (48.28%), Query Frame = 3
Query:  321 KKENQYYQMNETSATSNEKTLLEIRQIFLPISYQLQLYSIPIFLTVGILGNPISFVVWVSRKLRRNNSSAVYIAMLAINDFFVVICSIIYYLR----HSWGFGIIDIRGICKFYMVIFTFLQYNSILLVFGFTIERWIAVCYPFRRERCCTENRAWIACGIIFSSVFISVFPLF 830
            +  + YY  N  S   +   L  +     P+   + +  I +F+ +GI GN ++ +V VS+      ++ +Y++ +A +D  + +C  +   R      W FG      +CK +  +     Y++IL +   ++ER+ A+C+P + +   T+ R  +   ++++  F+S  P+F
Sbjct:   15 RTMDYYYSSNNYSWPEDPVFLFPV-----PVLTGITVTCILLFI-IGISGNVMTMLV-VSKYKDMRTTTNLYLSSMAFSDLLIFLCMPLDLYRLWQYRPWNFG----SSLCKLFQFVSECCTYSTILNITALSVERYFAICFPLKAKVVITKGRVKLVISVLWAVSFVSAGPIF 177          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Xenopus
Match: p2ry4 (pyrimidinergic receptor P2Y, G-protein coupled, 4 [Source:NCBI gene;Acc:595021])

HSP 1 Score: 57.7658 bits (138), Expect = 3.742e-8
Identity = 44/153 (28.76%), Postives = 78/153 (50.98%), Query Frame = 3
Query:  399 IFLPISYQLQLYSIPIFLTVGILGNPISF-VVWV-SRKLRRNNSSAVYIAMLAINDFFVVIC--SIIYYL--RHSWGFGIIDIRGICKFYMVIFTFLQYNSILLVFGFTIERWIAVCYPFRRERCCTENRAWIACGIIFSSVFISVFP-LFFV 836
            + LPISY            V ++G P++   +W+   K+R  N + VY+  LA++D   V+   +++YY   +++W FG+     +CK    +F    Y+SIL +   ++ R+  VC+P    RC     A + C +++ SV + + P L FV
Sbjct:   40 LLLPISYS----------GVFMVGLPLNITAIWIFIAKMRPWNPTTVYMFNLALSDTLYVLSLPTLVYYYADQNNWPFGV----ALCKIVRFLFYANLYSSILFLTCISVHRYRGVCHPITTLRCMNAKHAHVICALVWLSVMLCLVPNLMFV 178          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000027496.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:2:146231200:146233060:1 gene:ENSXETG00000012873.1 transcript:ENSXETT00000027496.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.9138 bits (128), Expect = 1.608e-7
Identity = 40/139 (28.78%), Postives = 75/139 (53.96%), Query Frame = 3
Query:  444 IFLTVGILGNPISFVVWVSRKLRRNNSSAVYIAMLAINDFFVVICS--IIYYLRHS--WGFGIIDIRGICKFYMVIFTFLQYNSILLVFGFTIERWIAVCYPFRRERCCTENRAWIACGIIFSSVF--ISVFPLFFVWH 842
            I + VG++GN I+ ++ + R      ++  Y++ +A++D  +++     +Y L  S  W FG      +C+F   I     Y++IL +   +IER++A+C+P + +   T+ R  + C I+F  VF  +S  P +FV H
Sbjct:   44 IVMVVGVIGNTITILI-IRRYKEMRTTTNFYLSSMAMSDLIILLSLPFDLYRLWKSMPWIFG----GFLCRFLHFISEGCTYSTILHITALSIERYLAICFPLKSKVLITKTR--VKCVIVFLWVFALLSAGPFYFVSH 175          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Xenopus
Match: mesd (mesoderm development LRP chaperone [Source:Xenbase;Acc:XB-GENE-940834])

HSP 1 Score: 50.8322 bits (120), Expect = 3.318e-6
Identity = 35/129 (27.13%), Postives = 64/129 (49.61%), Query Frame = 3
Query:  456 VGILGNPISFVVWVSRKLRRNNSSAVYIAMLAINDFFVVIC---SIIYYLRHSWGFGIIDIRGICKFYMVIFTFLQYNSILLVFGFTIERWIAVCYPFRRERCCTENRAWIACGIIFSSVFISVFPLFF 833
            +G++ N ++  ++    L+  N +  Y+  LAI+D   V      I Y++  +W FG I    +CK  + +F    Y SIL +   +++R++A+ YPF+     T+  A I C  ++ +V     P  F
Sbjct:   30 LGLIANCVALYIF-GCTLKVRNETTTYMINLAISDLLFVFTLPFRIFYFVARNWPFGDI----LCKISVTLFYTNMYGSILFLTCISVDRFLAIVYPFQSRTIRTKKNAKIVCLAVWLTVIAGSAPASF 153          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Xenopus
Match: dab2 (Dab, mitogen-responsive phosphoprotein, homolog 2 [Source:Xenbase;Acc:XB-GENE-992286])

HSP 1 Score: 50.447 bits (119), Expect = 6.105e-6
Identity = 43/141 (30.50%), Postives = 67/141 (47.52%), Query Frame = 3
Query:  444 IFLTVGILGNPISF--VVWVSRKLRRNNSSAVYIAMLAIND-FFVVIC--SIIYYLR-HSWGFGIIDIRGICKFYMVIFTFLQYNSILLVFGFTIERWIAVCYPFRRERCCTENRAWIACGIIFSSVFISVFPLFFVWHYQ 848
            ++  V I+G P++   V+    K++    + VY+  LAI D FFV +    I Y+L  + W FG     G+C+     F    Y S+LL+   + +R++AV YP       T +RA +AC  I+     S  PL      Q
Sbjct:  104 LYTVVFIVGLPLNLLAVIIFLFKMKVRKPAVVYMLNLAIADVFFVSVLPFKIAYHLSGNDWLFG----PGMCRIVTATFYCNMYCSVLLIASISADRFLAVVYPMHSLSWRTMSRACMACAFIWVVSVASTMPLLLTEQTQ 240          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Mouse
Match: Ghsr (growth hormone secretagogue receptor [Source:MGI Symbol;Acc:MGI:2441906])

HSP 1 Score: 59.3066 bits (142), Expect = 6.028e-9
Identity = 34/129 (26.36%), Postives = 67/129 (51.94%), Query Frame = 3
Query:  456 VGILGNPISFVVWVSRKLRRNNSSAVYIAMLAINDFFVVICSIIYYLR----HSWGFGIIDIRGICKFYMVIFTFLQYNSILLVFGFTIERWIAVCYPFRRERCCTENRAWIACGIIFSSVFISVFPLF 830
            VGI GN ++ +V VSR      ++ +Y++ +A +D  + +C  +  +R      W FG +    +CK +  +     Y ++L +   ++ER+ A+C+P R +   T+ R  +   +I++  F S  P+F
Sbjct:   55 VGISGNLLTMLV-VSRFRELRTTTNLYLSSMAFSDLLIFLCMPLDLVRLWQYRPWNFGDL----LCKLFQFVSESCTYATVLTITALSVERYFAICFPLRAKVVVTKGRVKLVILVIWAVAFCSAGPIF 178          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Mouse
Match: P2ry4 (pyrimidinergic receptor P2Y, G-protein coupled, 4 [Source:MGI Symbol;Acc:MGI:1926594])

HSP 1 Score: 51.6026 bits (122), Expect = 1.615e-6
Identity = 46/168 (27.38%), Postives = 83/168 (49.40%), Query Frame = 3
Query:  348 NETSATSNEKTLLEIRQIFLPISYQLQLYSIPIFLTVGILGNPISFVVWVSRKLRRNNSSAVYIAMLAINDFFVVIC--SIIYY--LRHSWGFGIIDIRGICKFYMVIFTFLQYNSILLVFGFTIERWIAVCYPFRRERCCTENRAWIACGIIFSSVFISVFP-LFFV 836
            + +S   + K   E + I LP+SY        +   +G+  N  +  +++ R LR  +++A Y+  LA++D   V+   +++YY   R+ W FG     G CKF   +F +  Y S+L +   ++ R++ +C+P R  R      A + C  ++  V   + P LFFV
Sbjct:   15 SPSSGDGDCKFNEEFKFILLPLSYA-------VVFVLGLALNAPTLWLFLFR-LRPWDATATYMFHLALSDTLYVLSLPTLVYYYAARNHWPFGT----GFCKFVRFLFYWNLYCSVLFLTCISVHRYMGICHPLRAIRWGRPRFAGLLCLGVWLVVAGCLVPNLFFV 170          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Mouse
Match: Olfr618 (olfactory receptor 618 [Source:MGI Symbol;Acc:MGI:3030452])

HSP 1 Score: 50.0618 bits (118), Expect = 4.272e-6
Identity = 57/236 (24.15%), Postives = 112/236 (47.46%), Query Frame = 3
Query:  435 SIPI--FLTVGILGNPIS-FVVWVSRKLRRNNSSAVYIAMLAINDFFVVICSIIYYLRHSW--GFGIIDIRGICKFYMVIFTFLQYNSILLVFGFTIERWIAVCYPFRRERCCTENRAWIACGIIFSSV---FISVFPLFFVWHYQPLCSVPKHWIENTY--------FVTYSLTLEILFSALLPVITLAVNIRVVVEMYRISETIVTFPKLSAVNQNFEIPSQKSRKHSKNTENS 1094
            SIPI     V ++GN +  F+++    L  +    ++++MLA+ D  +   +    L   W    GI     + + + + F F+  ++ILL     I+R+IA+C+P R     T +   + C +  +SV   F+ +FPL F+ +    C   ++ I ++Y            S+ + I +   +P+ ++ ++I +++    IS T++       +N  F IPSQ +R+ +  T  S
Sbjct:   31 SIPICSMYIVALIGNTLLIFLIFTEHSL--HEPMYLFLSMLALADIILSTVTTPKVLAIFWFQAGGISFASCVSQMFFLHFMFVTESAILL--AMAIDRYIAICFPLRYTTILTPS---VICRMGIASVTRSFLIIFPLVFLVYRLNYCG--RNIIRHSYCEHMGIARLACDSIKVNIYYGMTVPLFSIGLDIMLII----ISYTLI-------LNTVFRIPSQNARRKALGTCGS 246          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Mouse
Match: Olfr618 (olfactory receptor 618 [Source:MGI Symbol;Acc:MGI:3030452])

HSP 1 Score: 50.0618 bits (118), Expect = 4.272e-6
Identity = 57/236 (24.15%), Postives = 112/236 (47.46%), Query Frame = 3
Query:  435 SIPI--FLTVGILGNPIS-FVVWVSRKLRRNNSSAVYIAMLAINDFFVVICSIIYYLRHSW--GFGIIDIRGICKFYMVIFTFLQYNSILLVFGFTIERWIAVCYPFRRERCCTENRAWIACGIIFSSV---FISVFPLFFVWHYQPLCSVPKHWIENTY--------FVTYSLTLEILFSALLPVITLAVNIRVVVEMYRISETIVTFPKLSAVNQNFEIPSQKSRKHSKNTENS 1094
            SIPI     V ++GN +  F+++    L  +    ++++MLA+ D  +   +    L   W    GI     + + + + F F+  ++ILL     I+R+IA+C+P R     T +   + C +  +SV   F+ +FPL F+ +    C   ++ I ++Y            S+ + I +   +P+ ++ ++I +++    IS T++       +N  F IPSQ +R+ +  T  S
Sbjct:   31 SIPICSMYIVALIGNTLLIFLIFTEHSL--HEPMYLFLSMLALADIILSTVTTPKVLAIFWFQAGGISFASCVSQMFFLHFMFVTESAILL--AMAIDRYIAICFPLRYTTILTPS---VICRMGIASVTRSFLIIFPLVFLVYRLNYCG--RNIIRHSYCEHMGIARLACDSIKVNIYYGMTVPLFSIGLDIMLII----ISYTLI-------LNTVFRIPSQNARRKALGTCGS 246          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Mouse
Match: Lpar6 (lysophosphatidic acid receptor 6 [Source:MGI Symbol;Acc:MGI:1914418])

HSP 1 Score: 50.447 bits (119), Expect = 4.287e-6
Identity = 36/145 (24.83%), Postives = 72/145 (49.66%), Query Frame = 3
Query:  414 SYQLQLYS--IPIFLTVGILGNPISFVVWVSRKLRRNNSSAVYIAMLAINDFFVVIC---SIIYYLRHSWGFGIIDIRGICKFYMVIFTFLQYNSILLVFGFTIERWIAVCYPFRRERCCTENRAWIACGIIFSSVFISVFPLFF 833
            S++  LY     +   +G++ N ++  +++   L+  N +  Y+  LA++D   V      I Y+   +W FG +    +CK  +++F    Y SIL +   +++R++A+ YPF+ +   T+  A I C  ++ +V     P  F
Sbjct:   14 SFKYTLYGCMFSMVFVLGLISNCVAIYIFIC-ALKVRNETTTYMINLAMSDLLFVFTLPFRIFYFATRNWPFGDL----LCKISVMLFYTNMYGSILFLTCISVDRFLAIVYPFKSKTLRTKRNAKIVCIAVWFTVMGGSAPAVF 153          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Match: sp|A5A4K9|GHSR_RABIT (Growth hormone secretagogue receptor type 1 OS=Oryctolagus cuniculus OX=9986 GN=GHSR PE=2 SV=1)

HSP 1 Score: 62.3882 bits (150), Expect = 4.097e-9
Identity = 40/168 (23.81%), Postives = 84/168 (50.00%), Query Frame = 3
Query:  342 QMNETSATSNEKTLLEIRQIF-LPISYQLQLYSIPIFLTVGILGNPISFVVWVSRKLRRNNSSAVYIAMLAINDFFVVICSIIYYLR----HSWGFGIIDIRGICKFYMVIFTFLQYNSILLVFGFTIERWIAVCYPFRRERCCTENRAWIACGIIFSSVFISVFPLF 830
            ++   +   N+    E+ Q+F  P+   +    + +F+ VGI GN ++ +V VSR      ++ +Y++ +A +D  + +C  +  +R      W FG +    +CK +  +     Y ++L +   ++ER+ A+C+P R +   T+ R  +   +I++  F S  P+F
Sbjct:   18 ELGWDAPPGNDSLADELLQLFPAPLLAGVTATCVALFV-VGIAGNLLTMLV-VSRFRELRTTTNLYLSSMAFSDLLIFLCMPLDLVRLWQYRPWNFGDL----LCKLFQFVSESCTYATVLTITALSVERYFAICFPLRAKVVVTKGRVKLVILVIWALAFCSAGPIF 179          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q92847|GHSR_HUMAN (Growth hormone secretagogue receptor type 1 OS=Homo sapiens OX=9606 GN=GHSR PE=1 SV=1)

HSP 1 Score: 62.3882 bits (150), Expect = 4.284e-9
Identity = 40/168 (23.81%), Postives = 85/168 (50.60%), Query Frame = 3
Query:  342 QMNETSATSNEKTLLEIRQIF-LPISYQLQLYSIPIFLTVGILGNPISFVVWVSRKLRRNNSSAVYIAMLAINDFFVVICSIIYYLR----HSWGFGIIDIRGICKFYMVIFTFLQYNSILLVFGFTIERWIAVCYPFRRERCCTENRAWIACGIIFSSVFISVFPLF 830
             ++  ++  N+    E+ Q+F  P+   +    + +F+ VGI GN ++ +V VSR      ++ +Y++ +A +D  + +C  +  +R      W FG +    +CK +  +     Y ++L +   ++ER+ A+C+P R +   T+ R  +   +I++  F S  P+F
Sbjct:   18 DLDWDASPGNDSLGDELLQLFPAPLLAGVTATCVALFV-VGIAGNLLTMLV-VSRFRELRTTTNLYLSSMAFSDLLIFLCMPLDLVRLWQYRPWNFGDL----LCKLFQFVSESCTYATVLTITALSVERYFAICFPLRAKVVVTKGRVKLVIFVIWAVAFCSAGPIF 179          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Match: sp|A5A4L1|GHSR_MUSPF (Growth hormone secretagogue receptor type 1 OS=Mustela putorius furo OX=9669 GN=GHSR PE=2 SV=1)

HSP 1 Score: 59.6918 bits (143), Expect = 2.852e-8
Identity = 34/129 (26.36%), Postives = 67/129 (51.94%), Query Frame = 3
Query:  456 VGILGNPISFVVWVSRKLRRNNSSAVYIAMLAINDFFVVICSIIYYLR----HSWGFGIIDIRGICKFYMVIFTFLQYNSILLVFGFTIERWIAVCYPFRRERCCTENRAWIACGIIFSSVFISVFPLF 830
            VGI GN ++ +V VSR      ++ +Y++ +A +D  + +C  +  +R      W FG +    +CK +  +     Y ++L +   ++ER+ A+C+P R +   T+ R  +   +I++  F S  P+F
Sbjct:   56 VGIAGNLLTMLV-VSRFRELRTTTNLYLSSMAFSDLLIFLCMPLDLVRLWQYRPWNFGDL----LCKLFQFVSESCTYATVLTITALSVERYFAICFPLRAKVVVTKGRVKLVILVIWAVAFCSAGPIF 179          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Match: sp|O08725|GHSR_RAT (Growth hormone secretagogue receptor type 1 OS=Rattus norvegicus OX=10116 GN=Ghsr PE=2 SV=1)

HSP 1 Score: 59.3066 bits (142), Expect = 4.216e-8
Identity = 34/129 (26.36%), Postives = 67/129 (51.94%), Query Frame = 3
Query:  456 VGILGNPISFVVWVSRKLRRNNSSAVYIAMLAINDFFVVICSIIYYLR----HSWGFGIIDIRGICKFYMVIFTFLQYNSILLVFGFTIERWIAVCYPFRRERCCTENRAWIACGIIFSSVFISVFPLF 830
            VGI GN ++ +V VSR      ++ +Y++ +A +D  + +C  +  +R      W FG +    +CK +  +     Y ++L +   ++ER+ A+C+P R +   T+ R  +   +I++  F S  P+F
Sbjct:   55 VGISGNLLTMLV-VSRFRELRTTTNLYLSSMAFSDLLIFLCMPLDLVRLWQYRPWNFGDL----LCKLFQFVSESCTYATVLTITALSVERYFAICFPLRAKVVVTKGRVKLVILVIWAVAFCSAGPIF 178          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q99P50|GHSR_MOUSE (Growth hormone secretagogue receptor type 1 OS=Mus musculus OX=10090 GN=Ghsr PE=2 SV=3)

HSP 1 Score: 59.3066 bits (142), Expect = 4.216e-8
Identity = 34/129 (26.36%), Postives = 67/129 (51.94%), Query Frame = 3
Query:  456 VGILGNPISFVVWVSRKLRRNNSSAVYIAMLAINDFFVVICSIIYYLR----HSWGFGIIDIRGICKFYMVIFTFLQYNSILLVFGFTIERWIAVCYPFRRERCCTENRAWIACGIIFSSVFISVFPLF 830
            VGI GN ++ +V VSR      ++ +Y++ +A +D  + +C  +  +R      W FG +    +CK +  +     Y ++L +   ++ER+ A+C+P R +   T+ R  +   +I++  F S  P+F
Sbjct:   55 VGISGNLLTMLV-VSRFRELRTTTNLYLSSMAFSDLLIFLCMPLDLVRLWQYRPWNFGDL----LCKLFQFVSESCTYATVLTITALSVERYFAICFPLRAKVVVTKGRVKLVILVIWAVAFCSAGPIF 178          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A0R3UN11 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS9156 PE=4 SV=1)

HSP 1 Score: 223.016 bits (567), Expect = 1.127e-62
Identity = 126/343 (36.73%), Postives = 198/343 (57.73%), Query Frame = 3
Query:  402 FLPISYQLQLYSIPIFLTVGILGNPISFVVWVSRKLRRNNSSAVYIAMLAINDFFVVICSIIYYLR-HSWGFGIIDIRGICKFYMVIFTFLQYNSILLVFGFTIERWIAVCYPFRRERCCTENRAWIACGIIFSSVFISVFPLFFV--WHY-QPLCSVPKHWIENTYFVTYSLTLEILFSALLPVITLAVNIRVVVEMYRI--SETIVTFPKL------------SAVNQNFEIPSQKSRKHSK---NTENSISFKSTTITLLLVSFFQILTTLPLGAVYICQI-FYPEGNATSVKQMQNDPIWKKHFQMHGAKDIIDLLSLSHYCFNIVIYLASSHLFRNHL 1364
            F+P  ++L+LY+ PI+  VGI+GN ISF++WVSR+ R  NSSAVY+A LA+ DF + IC    YLR + +    + + GIC+ +  +F FLQY SI+L FGFT+ERWIA+CYPF+R++ C+  RA +   ++  ++ +S F +FF   W   Q  C +   W E+  F  Y    E +FS ++P+ TL  NI V+ E+  +  S+  V+   L            +  NQ    P     KHS    + +   +F++ T+ L+++SF+ IL TLP+G V++ Q+ F    +    +++  +P W ++ Q   AK+IID +  SHY  N +IY+ +   FR HL
Sbjct:   23 FIPDVFKLKLYASPIWFIVGIIGNLISFLIWVSRRQRGKNSSAVYLATLALTDFLLTICLFTEYLRIYFFLSSPLSVNGICQLFQGVFLFLQYYSIVLTFGFTLERWIAICYPFKRQKLCSTTRALVGVSVL--AIIVSGFSMFFAATWEVNQGACILADRWQEDRAFAIYLSATECIFSLIVPIATLVFNILVLREISNVVKSKMFVSHADLLSRRTNQAPVPRAEANQTAGAPLVIGAKHSSVHASAKEQANFQAVTLMLVVLSFYLILCTLPVGIVFVVQMRFTGIPDDLDDEEILANPAWLQYLQFMKAKEIIDFVCSSHYACNFIIYILTGKSFRQHL 363          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A0V0JBK0 (FMRFamide receptor OS=Schistocephalus solidus OX=70667 GN=FMAR PE=4 SV=1)

HSP 1 Score: 214.542 bits (545), Expect = 2.087e-59
Identity = 123/343 (35.86%), Postives = 203/343 (59.18%), Query Frame = 3
Query:  402 FLPISYQLQLYSIPIFLTVGILGNPISFVVWVSRKLRRNNSSAVYIAMLAINDFFVVICSIIYYLRHSWGF-GIIDIRGICKFYMVIFTFLQYNSILLVFGFTIERWIAVCYPFRRERCCTENRAWIACGIIFSSVFISVFPLFFVWHYQPL---CSVPKHWIENTYFVTYSLTLEILFSALLPVITLAVNIRVVVEMYRI--SETIVTFPKLSAVNQ-----NFEIPSQ------KSRKHSKNTENSISFKSTTITLLLVSFFQILTTLPLGAVYICQI-FYPEGNATSVKQMQNDPIWKKHFQMHGAKDIIDLLSLSHYCFNIVIYLASSHLFRNHLMGFV 1376
            F+P +Y L+LY+ P +  VG++GN ISF++WVS K R  NSSA+Y+A LA++DFF+++     Y+R    F   I + G+C+ +  +F FLQY SI L FGFT+ERWIA+CYPF+R + C+  RA I  G+   ++ +  F +F+   ++ +   C +   W +++ F  Y  T+E +FS L+P+ TL  N+ V+ E+ ++  S+ +V     S + Q     +  +P Q      K   HS +T+   +F + T+ L+++SF+ IL TLP+G V++ Q+ F       + +++  +P W ++F    AK+I+D L  SHY  N +IYL +   FR+ L+  V
Sbjct:   26 FVPDAYYLKLYASPAWFFVGLIGNAISFLIWVSYKQRGKNSSAIYLAALALSDFFLILLLFSDYMRRFLFFESPITVNGLCQLFQGVFLFLQYYSIALTFGFTLERWIAICYPFKRHKLCSSRRALI--GVSALALIVISFNVFYAAAWEIVDGECVLASRWQDDSSFYIYLSTVECVFSLLVPLATLVFNVLVLREIGKLVRSKIVVKSRNSSLLRQRDSRSSVHVPDQQLILGSKHSGHSASTKEQSNFHAATLMLVILSFYLILCTLPVGIVFVVQMRFISFSEYLTDEEVLRNPQWGEYFGFLRAKEIVDFLCSSHYACNFIIYLITGKSFRSQLLDTV 366          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A3P7L2X2 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Dibothriocephalus latus OX=60516 GN=DILT_LOCUS7516 PE=4 SV=1)

HSP 1 Score: 212.231 bits (539), Expect = 1.248e-58
Identity = 122/340 (35.88%), Postives = 202/340 (59.41%), Query Frame = 3
Query:  402 FLPISYQLQLYSIPIFLTVGILGNPISFVVWVSRKLRRNNSSAVYIAMLAINDFFVVICSIIYYLRHSWGF-GIIDIRGICKFYMVIFTFLQYNSILLVFGFTIERWIAVCYPFRRERCCTENRAWIACGIIFSSVFISVFPLFFVWHYQPL---CSVPKHWIENTYFVTYSLTLEILFSALLPVITLAVNIRVVVEMYRI--SETIV-----------TFPKLSAVNQNFEIPSQKSRKHSKNTENSISFKSTTITLLLVSFFQILTTLPLGAVYICQI-FYPEGNATSVKQMQNDPIWKKHFQMHGAKDIIDLLSLSHYCFNIVIYLASSHLFRNHLM 1367
            F+P ++ L+LY+ P++  VG++GN ISF++WVS + R  NSSA+Y+A LA++DFF+++     YLR    F   I + G+C+ +  +F FLQY SI L FGFT+ERWIA+CYPF+R + C+  RA I  G+   +V +  F +F+   ++ +   C +   W +++ F  Y  T+E +FS L+P+ TL  NI V+ E+ ++  S+ IV           +  K + V ++  I   K   HS + +   +F + T+ L+++SF+ IL TLP+G V++ Q+ F       + +++   P W+++F    AK+I+D L  SHY  N +IYL +   FR+ L+
Sbjct:   26 FVPDAFYLKLYASPVWFFVGLIGNAISFLIWVSHRQRGKNSSAIYLAALALSDFFLILLLFSDYLRRFLFFESPITVNGLCQLFQGVFLFLQYYSIALTFGFTLERWIAICYPFKRHKLCSSRRALI--GVSALAVIVISFNVFYAAAWEIVDHECVLAARWQDDSSFYIYLSTVECVFSLLVPLATLVFNILVLREIGKLVRSKIIVKGQNSSLFRQRSSTKSAHVPEHQLILGAKHSGHSASAKEQSNFHAATVMLVILSFYLILCTLPVGIVFVVQMRFTSFSEFLTDEEVLQHPQWREYFGFLRAKEIVDFLCSSHYACNFIIYLITGKSFRSQLL 363          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A0R3T0T7 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS456 PE=4 SV=1)

HSP 1 Score: 205.297 bits (521), Expect = 5.074e-56
Identity = 121/358 (33.80%), Postives = 197/358 (55.03%), Query Frame = 3
Query:  405 LPISYQLQLYSIPIFLTVGILGNPISFVVWVSRKLRRNNSSAVYIAMLAINDFFVVICSIIYYLR-HSWGFGIIDIRGICKFYMVIFTFLQYNSILLVFGFTIERWIAVCYPFRRERCCTENRAWIACGIIFSSVFISVFPLFFVWHYQ---PLCSVPKHWIENTYFVTYSLTLEILFSALLPVITLAVNIRVVVEMYRISETIVTFPKLSA------------VNQNFEIPSQKSR------------------KHSK---NTENSISFKSTTITLLLVSFFQILTTLPLGAVYICQIFYPEGNATSV-KQMQNDPIWKKHFQMHGAKDIIDLLSLSHYCFNIVIYLASSHLFRNHL 1364
            LP  Y L+LY+ PI+  VG +GN I+F +WVS + R  NSSA+Y+A LA+ D  +++C    YLR + +    + + GIC+ +  IF FLQY SI+L FGFT+ERWIA+CYPF+R+  C+  RA I   ++  ++ ++ F +FF   ++    +C+V   W  + Y   Y  T E +FS ++P+ TL +N  V+ E+  + ++ +   + S+             NQN ++  QK R                  KHS    + +   +F++ T+ L+++SF+ I+ TLP+G VY+ Q+ Y   N  +  K+    P  +++ +   AK+IID L  SHY  N +IY+ +   FR  L
Sbjct:   18 LPEVYALKLYASPIWFVVGFIGNLIAFFIWVSPRQRGKNSSAIYLATLAMTDLLLIVCLFTEYLRLYLFISSFLTLNGICQLFQGIFLFLQYYSIVLTFGFTLERWIAICYPFKRQELCSTKRALIGVSVL--AMIVACFSIFFASTWEVTDGVCNVATRWQMDAYLTIYLSTTECIFSLIIPIATLVLNCLVLREIGHLVKSKILVSRGSSHNSQRNISMARRSNQN-QVAQQKKRPTGDRSIEASTEPLVLGAKHSSAHASAKEQANFQAITLMLVILSFYLIICTLPVGIVYVVQMRYASVNVENADKEDPLSPELQQYLRFLTAKEIIDFLCSSHYACNFIIYVLTGKSFRQQL 372          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A068Y8V4 (Rhodopsin orphan GPCR OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000884900 PE=4 SV=1)

HSP 1 Score: 195.667 bits (496), Expect = 1.958e-52
Identity = 121/358 (33.80%), Postives = 200/358 (55.87%), Query Frame = 3
Query:  402 FLPISYQLQLYSIPIFLTVGILGNPISFVVWVSRKLRRNNSSAVYIAMLAINDFFVVICSII-YYLRHSWGFGIIDIRGICKFYMVIFTFLQYNSILLVFGFTIERWIAVCYPFRRERCCTENRAWIACGIIFSSVFISVFPLFFVWHYQPL---CSVPKHWIENTYFVTYSLTLEILFSALLPVITLAVNIRVVVEMYRISETIV----------------------------TFPKLSAVNQNFE---IPSQKSRKHSKNTENSISFKSTTITLLLVSFFQILTTLPLGAVYICQIFYPE--GNATSVKQMQNDPIWKKHFQMHGAKDIIDLLSLSHYCFNIVIYLASSHLFRNHL 1364
            FLP  ++L+LY  PI+  VG++GN ISF +WVS++ R  NSSAVY+A LA+ D  ++IC    Y   + +    + + GIC+ +  +F FLQY SI+L FGFT+ERWIA+CYPF+R++ C+  RA +  G+   +V ++ F +FF   ++ +   C +   W  +T F  Y  T E +FS ++P+ TL  NI V+ E+  + ++ +                               +   + Q+ E   + ++ S  H+   E + +F++ TI L+++SF+ IL TLP+G V++ Q+ + +   N T  + + N P W+++ +   AK+IID L  SHY  N +IY+ +   FR HL
Sbjct:   24 FLPEVFELKLYVSPIWFVVGLIGNAISFFIWVSKRQRGKNSSAVYLATLALTDLLLIICLFTEYLRLYLFLSSSLSVNGICQLFQAVFLFLQYYSIVLTFGFTLERWIAICYPFKRQKLCSTTRALV--GVSLLAVIVACFSIFFASTWEVVDGACILANQWQNDTTFSIYLSTTECIFSLIVPIATLVFNILVLREIGHLVKSKILISRDNSSTHHVSIVRRLHHNHNSQHHQQVARTGTIKQSSEPLVLGAKHSSAHASAKEQA-NFQAVTIMLVILSFYLILCTLPVGIVFVVQMRFTDIPDNITDEEILAN-PAWQQYLRFLTAKEIIDFLCSSHYACNFIIYVLTGKSFRQHL 377          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Match: ntsr1 (neurotensin receptor 1 [Source:NCBI gene;Acc:103043318])

HSP 1 Score: 62.003 bits (149), Expect = 8.316e-10
Identity = 56/264 (21.21%), Postives = 118/264 (44.70%), Query Frame = 3
Query:  288 EFAKLK---QTLLKKKENQYYQMNETSATSNEKTLLEIRQIFLPISYQLQLYSIPIFLTVGILGNPISFVVWVSRKLRRNNSSAVY--IAMLAINDFFVVICSI------IYYLRHSWGFGIIDIRGICKFYMVIFTFLQYNSILLVFGFTIERWIAVCYPFRRERCCTENRAWIACGIIFSSVFISVFPLFFVWHYQPLCSVPK-HWIENTYFVTYSLTLEILFSALLPVITLAV-NIRVVVEMYRISETIVTFPKLSAVNQN 1040
             F+KL+   Q L+      ++     S T++++ L     ++   S  L      +   VG LGN I+    +++K  +N  S V+  +A LA++D  +++ S+        ++ H W FG      +C+ Y  +     Y +   +   + ER++A+C+PF+ +   + +R       ++++ F+   P+ F    + + +VP    I +T      L +  L S + P++ ++V N  +  ++ R+        +L  V  N
Sbjct:   11 NFSKLRALTQQLIINHSAPFHANGSGSGTASQEDLDVNTDVY---SKVLVTVIYVLLFAVGCLGNSITLYTLLTKKSLQNLQSTVHYHLASLAVSDLLILVLSMPLELYNFIWVHHPWAFG----DAVCRGYYFLRDGCSYATAFNIASLSAERYMAICHPFKAKSAMSRSRTKKLISGMWAAAFLLATPMLFTMGQRTVDAVPICTTIVSTGTAKTVLQVNALLSFIAPMVVISVLNGIIASQLLRMFREAAQDNRLCVVGGN 267          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Match: ntsr1 (neurotensin receptor 1 [Source:NCBI gene;Acc:103043318])

HSP 1 Score: 61.6178 bits (148), Expect = 1.195e-9
Identity = 46/209 (22.01%), Postives = 97/209 (46.41%), Query Frame = 3
Query:  444 IFLTVGILGNPISFVVWVSRKLRRNNSSAVY--IAMLAINDFFVVICSI------IYYLRHSWGFGIIDIRGICKFYMVIFTFLQYNSILLVFGFTIERWIAVCYPFRRERCCTENRAWIACGIIFSSVFISVFPLFFVWHYQPLCSVPK-HWIENTYFVTYSLTLEILFSALLPVITLAV-NIRVVVEMYRISETIVTFPKLSAVNQN 1040
            +   VG LGN I+    +++K  +N  S V+  +A LA++D  +++ S+        ++ H W FG      +C+ Y  +     Y +   +   + ER++A+C+PF+ +   + +R       ++++ F+   P+ F    + + +VP    I +T      L +  L S + P++ ++V N  +  ++ R+        +L  V  N
Sbjct:   76 LLFAVGCLGNSITLYTLLTKKSLQNLQSTVHYHLASLAVSDLLILVLSMPLELYNFIWVHHPWAFG----DAVCRGYYFLRDGCSYATAFNIASLSAERYMAICHPFKAKSAMSRSRTKKLISGMWAAAFLLATPMLFTMGQRTVDAVPICTTIVSTGTAKTVLQVNALLSFIAPMVVISVLNGIIASQLLRMFREAAQDNRLCVVGGN 280          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Match: P2RY4 (P2Y purinoceptor 4-like [Source:NCBI gene;Acc:103034498])

HSP 1 Score: 59.3066 bits (142), Expect = 4.668e-9
Identity = 45/155 (29.03%), Postives = 82/155 (52.90%), Query Frame = 3
Query:  387 EIRQIFLPISYQLQLYSIPIFLTVGILGNPISFVVWVSRKLRRNNSSAVYIAMLAINDFFVVIC--SIIYYL--RHSWGFGIIDIRGICKFYMVIFTFLQYNSILLVFGFTIERWIAVCYPFRRERCCTENRAWIACGIIFSSVFISVFP-LFFV 836
            E + I LP+SY L      +F+ +G+  N ++  ++++ K+R  N+S VY+  LA++D   V+   ++IYY   R  W FG+     +CK    +F    Y SIL +   ++ R++ +C+P R         A + C +++++V   + P L FV
Sbjct:   37 EFKYILLPVSYSL------VFI-LGLALNSVALWMFLT-KMRPWNTSTVYMFHLALSDTLYVLSLPTLIYYYANRSHWPFGV----ALCKIVRFLFYANLYCSILFLTCISVHRYLGICHPIRSLTLVKPRHAHMVCALVWATVTACLIPNLVFV 179          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Match: lpar6a (lysophosphatidic acid receptor 6a [Source:ZFIN;Acc:ZDB-GENE-061013-343])

HSP 1 Score: 57.3806 bits (137), Expect = 1.852e-8
Identity = 42/163 (25.77%), Postives = 75/163 (46.01%), Query Frame = 3
Query:  363 TSNEKTLLEIRQIFLPISYQLQLYSI--PIFLTVGILGNPISFVVWVSRKLRRNNSSAVYIAMLAINDFFVVIC---SIIYYLRHSWGFGIIDIRGICKFYMVIFTFLQYNSILLVFGFTIERWIAVCYPFRRERCCTENRAWIACGIIFSSVFISVFPLFFV 836
            T N   L  +       +++ QLYSI   I   VG++ N  +  ++    L+  N +  Y+  L ++D   V+     + Y++R  W FG +    +CK  + +F    Y SIL +   +++R++A+ YP R     T+  A I C  ++  V     P  F+
Sbjct:    4 TPNSGNLNSVEDCPKNDNFKYQLYSIVFSIVFVVGLIMNIAAMYIFTC-TLKLRNETTTYMMNLVVSDLLFVLTLPLRVFYFIRQDWPFGGL----LCKISVSLFYTNMYGSILFLTCISVDRFLAIVYPLRSRELRTKRNAKIVCAAVWVLVLSGSIPTGFL 161          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Match: gpr39 (G protein-coupled receptor 39 [Source:NCBI gene;Acc:103046228])

HSP 1 Score: 54.299 bits (129), Expect = 2.364e-7
Identity = 44/158 (27.85%), Postives = 78/158 (49.37%), Query Frame = 3
Query:  375 KTLLEIRQIFLPISYQLQLYSIPIFLTVGILGNPISFVVWVSRKLRRNN----SSAVYIAMLAINDFFVVICSIIYYLRHSWGFGIIDIRG--ICKFYMVIFTFLQYNSILLVFGFTIERWIAVCYPFRRERCCTENRAWIACGIIFSSVFISVFPLF 830
            +T  E++ +FL + Y L        L +GI+GN I+  + V++ L++N     +   ++  LA +D  V++  +   L  +  F      G   CK Y  +F    Y +IL V   + ER++A+C+PFR +       A +  G+  +SV ++V PL 
Sbjct:   14 ETFFEVK-VFLTVLYSL-------ILVLGIVGNSIT--IHVTQVLQKNGYLQKNVTDHMVSLACSDLLVLLIGMPVELYSAIWFPFTSASGNTSCKIYNFLFEACSYATILNVATLSFERYMAICHPFRYKSLARARTAHLIIGVWLTSVLVAV-PLL 160          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001343.1 (pep scaffold:Pmarinus_7.0:GL480096:18103:20287:1 gene:ENSPMAG00000001212.1 transcript:ENSPMAT00000001343.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 61.2326 bits (147), Expect = 2.274e-10
Identity = 41/130 (31.54%), Postives = 68/130 (52.31%), Query Frame = 3
Query:  414 SYQLQLYSI--PIFLTVGILGNPISFVVWVSRKLRRNNSSAVYIAMLAINDFFVVIC---SIIYYLRHS-WGFGIIDIRGICKFYMVIFTFLQYNSILLVFGFTIERWIAVCYPFRRERCCTENRAWIAC 785
            SY+  +YS    I   +G++GN I+  V++    R  ++S +Y+  LA+ D F V+     ++YY+R   W FG      +C+     F    Y+SI  + G ++ R++AV +P R  +  T  RA IAC
Sbjct:   34 SYKYPIYSAIYGIVCIIGMMGNAIALYVFLCLT-RTKSASTIYLINLALADMFFVLTLPLRVVYYVRDGDWPFG----DAMCRISSFTFYANLYSSIFFLTGLSVTRYLAVVHPVRSLKAVTARRAVIAC 158          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000867.1 (pep scaffold:Pmarinus_7.0:GL477415:83128:85299:-1 gene:ENSPMAG00000000792.1 transcript:ENSPMAT00000000867.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.8474 bits (146), Expect = 2.352e-10
Identity = 41/130 (31.54%), Postives = 68/130 (52.31%), Query Frame = 3
Query:  414 SYQLQLYSI--PIFLTVGILGNPISFVVWVSRKLRRNNSSAVYIAMLAINDFFVVIC---SIIYYLRHS-WGFGIIDIRGICKFYMVIFTFLQYNSILLVFGFTIERWIAVCYPFRRERCCTENRAWIAC 785
            SY+  +YS    I   +G++GN I+  V++    R  ++S +Y+  LA+ D F V+     ++YY+R   W FG      +C+     F    Y+SI  + G ++ R++AV +P R  +  T  RA IAC
Sbjct:   18 SYKYPIYSAVYGIVCIIGMMGNTIALYVFLCLT-RTKSASTIYLINLALADMFFVLTLPLRVVYYVREGDWPFG----DAMCRISSFAFYANLYSSIFFLTGLSVTRYLAVVHPVRSLKAITARRAVIAC 142          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002724.1 (pep scaffold:Pmarinus_7.0:GL489282:5596:6337:1 gene:ENSPMAG00000002490.1 transcript:ENSPMAT00000002724.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.151 bits (139), Expect = 7.229e-10
Identity = 43/130 (33.08%), Postives = 63/130 (48.46%), Query Frame = 3
Query:  414 SYQLQLYSI--PIFLTVGILGNPISFVVWVSRKLRRNNSSAVYIAMLAINDFFVVI---CSIIYYLRHS-WGFGIIDIRGICKFYMVIFTFLQYNSILLVFGFTIERWIAVCYPFRRERCCTENRAWIAC 785
            SY+  +YS    I   +GI GN I+  V++    R   +S VY   LA  D F V+     ++YY+R   W FG      +C+     F    Y SI  + G ++ R++AV +P R  +  T  RA IAC
Sbjct:   36 SYKYPVYSAVYGIVFIIGITGNSIALYVFLHLT-RTKLASTVYFINLAFADMFFVLILPLRVVYYVRDGDWPFG----DAMCRISSFAFYVNLYGSIFFLTGLSVTRYLAVVHPVRSLKAVTARRAVIAC 160          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001342.1 (pep scaffold:Pmarinus_7.0:GL480096:9441:11970:1 gene:ENSPMAG00000001210.1 transcript:ENSPMAT00000001342.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.5362 bits (140), Expect = 1.477e-9
Identity = 40/130 (30.77%), Postives = 67/130 (51.54%), Query Frame = 3
Query:  414 SYQLQLYSI--PIFLTVGILGNPISFVVWVSRKLRRNNSSAVYIAMLAINDFFVVIC---SIIYYLRHS-WGFGIIDIRGICKFYMVIFTFLQYNSILLVFGFTIERWIAVCYPFRRERCCTENRAWIAC 785
            SY+  +YS    I   +G++GN I+  V++    R  ++S +Y+  LA+ D F V+     ++YY+R   W FG      +C+     F    Y+SI  + G ++ R++AV +P R  +  T   A IAC
Sbjct:   25 SYKYPIYSAIYGIVCIIGMMGNAIALYVFLCLT-RTKSASTIYLINLALADMFFVLTLPLRVVYYVREGDWPFG----DAMCRISSFAFYANLYSSIFFLTGLSVTRYLAVVHPVRSLKAVTARHAVIAC 149          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011145.1 (pep scaffold:Pmarinus_7.0:GL480128:19975:20922:-1 gene:ENSPMAG00000010118.1 transcript:ENSPMAT00000011145.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 52.373 bits (124), Expect = 1.186e-7
Identity = 37/134 (27.61%), Postives = 69/134 (51.49%), Query Frame = 3
Query:  438 IPIFLTVGILGNPISFVV-WVSRKLRRNNSSAVYIAMLAINDFFVVICSIIYYLRHSWGFGIIDIRGICKFYMVIFTFLQYNSILLVFGFTIERWIAVCYPFRRERCCTENRAWIACGIIFSSVFISVFPLFFV 836
            +PI+++   +G P++ VV WV    ++N S ++Y+  LAI D F ++   +  +  S G   I    +C+   +IF    Y SI+++   +++R+ AV +P    R      AWI C +I+      + P+ +V
Sbjct:   16 LPIYVSTVAIGLPLNMVVCWVLGPTKKN-SMSIYVVNLAIADLFYLMVLPMKIVYISNGGNWIFPSFLCRVTTLIFFTNIYASIMILAAISVDRYKAVVHPLEVSRWREPRTAWIVCAVIWVITVAEIAPINYV 148          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Nematostella
Match: EDO44000 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXB4])

HSP 1 Score: 50.0618 bits (118), Expect = 1.290e-6
Identity = 64/273 (23.44%), Postives = 117/273 (42.86%), Query Frame = 3
Query:  408 PISYQLQLYSIPIFLTVGILGNPISFVVWVSRKLRRNNSSAVYIAMLAINDFFVVICSIIYYLR-----HSWGFGIIDIRGICKFYMVIFTFLQYNSILLVFGFTIERWIAVCYPFRRERCCTENRAWIACGIIFSSVFISVFPLFFVWHYQPLCSVPKH------WIENTYFVTYSLTLEILFSALLPVITLAVNIRVVVEMYRISETIVTFPKLSAVNQNFEIPSQKSRKHSKNTENSISFKSTTITLLLVSFFQILTTLPLGAVYICQIF 1193
            P+ + L+L  I +FL VG +GN +  +  + RK R   S+ ++   LA++D   V+  +   +      H+W FG      +C+   VI       SI  +   T +R+ A+ YP R        RA +    I++   I+  PL FV   + +   P+       W E  Y   Y + + ++   L   +  A+ + + +++ R S        L  + ++  + +   R+  K T      K T + + LV  + I   LP   VY+C ++
Sbjct:   11 PLRWTLRLIFIIVFL-VGSVGNLVVCMAVIRRK-RSRTSNNIFTFNLALSDLLTVLIYVPTQMAAFENDHNWPFG----NFVCQLAYVIIPVCLSASIATLLAITTDRYRAIAYPMRPRLSGKHVRAILVA--IWTVSIITALPLMFV--AREVRPAPRQVYCDEVWPEGPYSRVYWIAIFVIQYILPLGMICALAMLIALKVRRNS--------LKMIEKSSHVLAAAVRQRMKQTS-----KITNMLIALVILYAI-CMLPQHVVYLCMVY 259          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Match: P2RY4 (pyrimidinergic receptor P2Y4 [Source:NCBI gene;Acc:101168051])

HSP 1 Score: 65.0846 bits (157), Expect = 6.834e-11
Identity = 45/150 (30.00%), Postives = 75/150 (50.00%), Query Frame = 3
Query:  387 EIRQIFLPISYQLQLYSIPIFLTVGILGNPISFVVWVSRKLRRNNSSAVYIAMLAINDFFVVIC--SIIYYLRHS--WGFGIIDIRGICKFYMVIFTFLQYNSILLVFGFTIERWIAVCYPFRRERCCTENRAWIACGIIFSSVFISVFP 824
            E + I LP+SY L          VG L N  +  +W+  K+R  N S V++  L+++DF  V+   ++IYY  H   W FG+     +CK    +F    Y SILL+   ++ R++ +C+P +         A I C  +++ V +S+ P
Sbjct:   30 EFKYILLPVSYSL-------VFVVGFLLNATA--LWMFLKMRPWNPSMVFMFHLSLSDFLYVLSLPTLIYYYAHRNHWPFGV----AVCKIVRFLFYANLYCSILLLTCISVHRYLGICHPIKALTLVKSRHAHIVCASVWAVVTVSLIP 166          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Match: sstr5 (somatostatin receptor type 5 [Source:NCBI gene;Acc:101171493])

HSP 1 Score: 60.4622 bits (145), Expect = 2.321e-9
Identity = 46/140 (32.86%), Postives = 69/140 (49.29%), Query Frame = 3
Query:  441 PIFLTVGILGNPISFVVWVSRKLRRNNSSAVYIAMLAINDFFVVICSIIYYLRHS----WGFGIIDIRGICKFYMVIFTFLQYNSILLVFGFTIERWIAVCYPFRRERCCTENRAWIACGIIFSSVFISVFPLFFVWHYQ 848
            PI   VG LGN ++  V V R  + NN + +YI  LAI D   V+  I + L ++    W FG       CK +M      Q+ S   +   +I+R++AV YP R  +  T  +A I  GI++   F++V P+    H Q
Sbjct:   41 PIVFIVGFLGNTLAIYV-VGRYGKLNNVTNIYIINLAIADELYVL-GIPFILTNNVFSYWPFGDF----FCKMFMTTDAMCQFASTFCLTLMSIDRFMAVVYPMRSAKWRTPPKAKIFSGIVWIMSFLTVLPVTIYSHVQ 174          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Match: sstr5 (somatostatin receptor type 5 [Source:NCBI gene;Acc:101171493])

HSP 1 Score: 60.4622 bits (145), Expect = 2.435e-9
Identity = 46/140 (32.86%), Postives = 69/140 (49.29%), Query Frame = 3
Query:  441 PIFLTVGILGNPISFVVWVSRKLRRNNSSAVYIAMLAINDFFVVICSIIYYLRHS----WGFGIIDIRGICKFYMVIFTFLQYNSILLVFGFTIERWIAVCYPFRRERCCTENRAWIACGIIFSSVFISVFPLFFVWHYQ 848
            PI   VG LGN ++  V V R  + NN + +YI  LAI D   V+  I + L ++    W FG       CK +M      Q+ S   +   +I+R++AV YP R  +  T  +A I  GI++   F++V P+    H Q
Sbjct:   75 PIVFIVGFLGNTLAIYV-VGRYGKLNNVTNIYIINLAIADELYVL-GIPFILTNNVFSYWPFGDF----FCKMFMTTDAMCQFASTFCLTLMSIDRFMAVVYPMRSAKWRTPPKAKIFSGIVWIMSFLTVLPVTIYSHVQ 208          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Match: ntsr1 (neurotensin receptor 1 [Source:NCBI gene;Acc:105354415])

HSP 1 Score: 58.5362 bits (140), Expect = 9.455e-9
Identity = 37/136 (27.21%), Postives = 70/136 (51.47%), Query Frame = 3
Query:  453 TVGILGNPISFVVWVSRKLRRNNSSAVY--IAMLAINDFFVVICSI---IY---YLRHSWGFGIIDIRGICKFYMVIFTFLQYNSILLVFGFTIERWIAVCYPFRRERCCTENRAWIACGIIFSSVFISVFPLFFV 836
             VG LGN I+    +S+K  +N  S V+  +A LA++D  ++I S+   IY   ++ H W FG      +C+ Y  +     Y + L +   ++ER++A+C+PF+ +   + +R       ++ + F    P+ F+
Sbjct:   62 AVGSLGNSITLYTLLSKKSLQNLQSTVHYHLASLAVSDLLILIISMPIEIYNFIWVHHPWVFG----DAVCRGYFFLRDSCSYATALNIASLSVERYMAICHPFKAKSIMSRSRTKKLISAMWLASFALSTPMLFI 193          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Match: ghsrb (growth hormone secretagogue receptor type 1 [Source:NCBI gene;Acc:101167158])

HSP 1 Score: 54.299 bits (129), Expect = 2.371e-7
Identity = 39/172 (22.67%), Postives = 77/172 (44.77%), Query Frame = 3
Query:  423 LQLYSIPIFLT----------VGILGNPISFVVWVSRKLRRNNSSAVYIAMLAINDFFVVICSIIYYLR----HSWGFGIIDIRGICKFYMVIFTFLQYNSILLVFGFTIERWIAVCYPFRRERCCTENRAWIACGIIFSSVFISVFPLFFVWHYQPLCSVPKH---WIENT 887
            L  YSIP+             VG+ GN ++ +V V R      ++ +Y+  +A++D  + +C  +   R      W  G      +CK +  +     Y++IL +   ++ER++A+C+P R +   T+ R       +++   +S  P+F +   +   + P +   WI  T
Sbjct:   59 LNYYSIPLLAAITVACTLLFLVGVTGNVMTILV-VGRYRDMRTTTNLYLCSMAVSDLLIFLCMPLDLYRMWRYRPWRLG----DALCKLFQFVSESCTYSTILSITALSVERYLAICFPLRAKALVTKRRVRALICFLWTVSLLSAGPVFVMVGVERDITEPPNFSSWINET 225          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000018637.1 (SMESG000018637.1)

HSP 1 Score: 863.988 bits (2231), Expect = 0.000e+0
Identity = 441/441 (100.00%), Postives = 441/441 (100.00%), Query Frame = 3
Query:  210 MRIPIILLGDYITNKSNCISFCLNSVEFAKLKQTLLKKKENQYYQMNETSATSNEKTLLEIRQIFLPISYQLQLYSIPIFLTVGILGNPISFVVWVSRKLRRNNSSAVYIAMLAINDFFVVICSIIYYLRHSWGFGIIDIRGICKFYMVIFTFLQYNSILLVFGFTIERWIAVCYPFRRERCCTENRAWIACGIIFSSVFISVFPLFFVWHYQPLCSVPKHWIENTYFVTYSLTLEILFSALLPVITLAVNIRVVVEMYRISETIVTFPKLSAVNQNFEIPSQKSRKHSKNTENSISFKSTTITLLLVSFFQILTTLPLGAVYICQIFYPEGNATSVKQMQNDPIWKKHFQMHGAKDIIDLLSLSHYCFNIVIYLASSHLFRNHLMGFVKLYLMXXXXXXXXXXXXXXXXQSQDTHKTEMSIRRKLVESKVPLPLEVSLAT 1532
            MRIPIILLGDYITNKSNCISFCLNSVEFAKLKQTLLKKKENQYYQMNETSATSNEKTLLEIRQIFLPISYQLQLYSIPIFLTVGILGNPISFVVWVSRKLRRNNSSAVYIAMLAINDFFVVICSIIYYLRHSWGFGIIDIRGICKFYMVIFTFLQYNSILLVFGFTIERWIAVCYPFRRERCCTENRAWIACGIIFSSVFISVFPLFFVWHYQPLCSVPKHWIENTYFVTYSLTLEILFSALLPVITLAVNIRVVVEMYRISETIVTFPKLSAVNQNFEIPSQKSRKHSKNTENSISFKSTTITLLLVSFFQILTTLPLGAVYICQIFYPEGNATSVKQMQNDPIWKKHFQMHGAKDIIDLLSLSHYCFNIVIYLASSHLFRNHLMGFVKLYLMRKENNNSLNNSYYKLRQSQDTHKTEMSIRRKLVESKVPLPLEVSLAT
Sbjct:    1 MRIPIILLGDYITNKSNCISFCLNSVEFAKLKQTLLKKKENQYYQMNETSATSNEKTLLEIRQIFLPISYQLQLYSIPIFLTVGILGNPISFVVWVSRKLRRNNSSAVYIAMLAINDFFVVICSIIYYLRHSWGFGIIDIRGICKFYMVIFTFLQYNSILLVFGFTIERWIAVCYPFRRERCCTENRAWIACGIIFSSVFISVFPLFFVWHYQPLCSVPKHWIENTYFVTYSLTLEILFSALLPVITLAVNIRVVVEMYRISETIVTFPKLSAVNQNFEIPSQKSRKHSKNTENSISFKSTTITLLLVSFFQILTTLPLGAVYICQIFYPEGNATSVKQMQNDPIWKKHFQMHGAKDIIDLLSLSHYCFNIVIYLASSHLFRNHLMGFVKLYLMRKENNNSLNNSYYKLRQSQDTHKTEMSIRRKLVESKVPLPLEVSLAT 441          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000018637.1 (SMESG000018637.1)

HSP 1 Score: 772.696 bits (1994), Expect = 0.000e+0
Identity = 396/396 (100.00%), Postives = 396/396 (100.00%), Query Frame = 3
Query:  345 MNETSATSNEKTLLEIRQIFLPISYQLQLYSIPIFLTVGILGNPISFVVWVSRKLRRNNSSAVYIAMLAINDFFVVICSIIYYLRHSWGFGIIDIRGICKFYMVIFTFLQYNSILLVFGFTIERWIAVCYPFRRERCCTENRAWIACGIIFSSVFISVFPLFFVWHYQPLCSVPKHWIENTYFVTYSLTLEILFSALLPVITLAVNIRVVVEMYRISETIVTFPKLSAVNQNFEIPSQKSRKHSKNTENSISFKSTTITLLLVSFFQILTTLPLGAVYICQIFYPEGNATSVKQMQNDPIWKKHFQMHGAKDIIDLLSLSHYCFNIVIYLASSHLFRNHLMGFVKLYLMXXXXXXXXXXXXXXXXQSQDTHKTEMSIRRKLVESKVPLPLEVSLAT 1532
            MNETSATSNEKTLLEIRQIFLPISYQLQLYSIPIFLTVGILGNPISFVVWVSRKLRRNNSSAVYIAMLAINDFFVVICSIIYYLRHSWGFGIIDIRGICKFYMVIFTFLQYNSILLVFGFTIERWIAVCYPFRRERCCTENRAWIACGIIFSSVFISVFPLFFVWHYQPLCSVPKHWIENTYFVTYSLTLEILFSALLPVITLAVNIRVVVEMYRISETIVTFPKLSAVNQNFEIPSQKSRKHSKNTENSISFKSTTITLLLVSFFQILTTLPLGAVYICQIFYPEGNATSVKQMQNDPIWKKHFQMHGAKDIIDLLSLSHYCFNIVIYLASSHLFRNHLMGFVKLYLMRKENNNSLNNSYYKLRQSQDTHKTEMSIRRKLVESKVPLPLEVSLAT
Sbjct:    1 MNETSATSNEKTLLEIRQIFLPISYQLQLYSIPIFLTVGILGNPISFVVWVSRKLRRNNSSAVYIAMLAINDFFVVICSIIYYLRHSWGFGIIDIRGICKFYMVIFTFLQYNSILLVFGFTIERWIAVCYPFRRERCCTENRAWIACGIIFSSVFISVFPLFFVWHYQPLCSVPKHWIENTYFVTYSLTLEILFSALLPVITLAVNIRVVVEMYRISETIVTFPKLSAVNQNFEIPSQKSRKHSKNTENSISFKSTTITLLLVSFFQILTTLPLGAVYICQIFYPEGNATSVKQMQNDPIWKKHFQMHGAKDIIDLLSLSHYCFNIVIYLASSHLFRNHLMGFVKLYLMRKENNNSLNNSYYKLRQSQDTHKTEMSIRRKLVESKVPLPLEVSLAT 396          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000007702.1 (SMESG000007702.1)

HSP 1 Score: 222.246 bits (565), Expect = 7.496e-66
Identity = 130/386 (33.68%), Postives = 206/386 (53.37%), Query Frame = 3
Query:  378 TLLEIRQIFLPISYQLQLYSIPIFLTVGILGNPISFVVWVSRKLRRNNSSAVYIAMLAINDFFVVICSIIYYLRHSWGFGIIDIRGICKFYMVIFTFLQYNSILLVFGFTIERWIAVCYPFRRERCCTENRAWIACGIIFSSVFISVFPLFFVW---HYQPLCSVPKHWIENTYFVTYSLTLEILFSALLPVITLAVNIRVVVEMYRI-------------------------SETIVTFPKLSAVNQNFEIPSQKSRKHSK----------------------NTENSISFKSTTITLLLVSFFQILTTLPLGAVYICQIFYPEGNA-TSVKQMQNDPIWKKHFQMHGAKDIIDLLSLSHYCFNIVIYLASSHLFRNHLMGFVKL 1382
            T +E R  FL ++     +  P+ L  G++GN +SF++W + ++RRNNSSA Y++ L+++D  +++   ++YL+ +W   + D  G+C+ + +I+   QYNS  LV  FT+ERWIAVCYPF+RER CT  RA++A  +IF  + +      F W   + Q +C     W  +     ++ T+E L S  +P+ TL  NI V+ E+  I                         SE I    K     ++F++ ++ S   S+                       +   ++F+STTI LL VSF+QI+TTLP GAVY+ Q F   GN   S  +++NDP W+  F+    K+ +DL SL+HYCFN++IYL +   FR +L+  +KL
Sbjct:   11 TNIEFRLKFLVLASLCHRWITPVLLFTGLIGNSVSFIIWTNPRIRRNNSSATYLSALSLSDLILLLTHFMHYLKFAWRIKVFDYAGVCEMFQMIYLMFQYNSTPLVLAFTLERWIAVCYPFKRERWCTSKRAYLAITLIFIIMLLIGVVQAFAWSTNNEQRVCKFRDSWQRSMLNQGFTTTVEFLMSGGVPICTLIFNILVIYELRSIVLNPLKQDPNKVNKKNRENKSQLSVSEKISFSSKNEKGLESFDVNAENSNLLSQPVGKSVIKRYTFVNNAHKMQRFQSSGGVNFRSTTIMLLTVSFYQIITTLPSGAVYVSQFFISGGNEFLSDDEIENDPNWRTFFRHQTMKEFVDLFSLTHYCFNVLIYLLTGRQFRKYLLQILKL 396          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000031888.1 (SMESG000031888.1)

HSP 1 Score: 186.808 bits (473), Expect = 4.112e-53
Identity = 122/347 (35.16%), Postives = 189/347 (54.47%), Query Frame = 3
Query:  363 TSNEKTLLEIRQIFLPISYQLQLYSIPIFLTVGILGNPISFVVWVSRKLRRNNSSAVYIAMLAINDFFVVICSIIYYLRHSWGFGIIDIRGICKFYMVIFTFLQYNSILLVFGFTIERWIAVCYPFRRERCCTENRAWIACGIIFSSVFISVFPLF--FVWHYQPL---CSVPKHWIENTYFVT-YSLTLEILFSALLPVITLAVNIRVVVEMYRISETIVTFPKLSAVNQNFEIPSQKSRKHSKNTENSISFKSTTITLLLVSFFQILTTLPLGAVYICQ--IFYPEGNATSVKQMQNDPIWKKHFQMHGAKDIIDLLSLSHYCFNIVIYLASSHLFRNHLMGFVK 1379
            T+   + +E+  +F P    +  Y   I+L +G +GN  SF++W+  K+RR NSSA+Y+A L++NDF V++  +I  L++SW   ++     C  YMV+ T  Q  S +LV  FTIERW+A+CYPF+R+  CT  RA I    ++  +F+  + ++  F+W Y      C   +     T F   Y    EI+FS  +P++ L  NI V+ EMYRI++   T  K       F  P+Q+         N  SF  TTI LL VSF+   TTLP G ++  Q  I  P+ N  ++ ++ +DP W+ +F++   K +ID L +SHY  N VIYL +   FR   +  ++
Sbjct:    5 TAQSLSSIELNLMFSPNRIYIDRYMTLIWLLIGYIGNIFSFIIWIEPKMRRENSSAIYLAALSLNDFLVLVFVMIQDLQYSWNKNVLRY-SFCSIYMVLSTCSQLFSPVLVLAFTIERWVAICYPFKRQSLCTPKRAIIVSFTLY--LFVLCYNIYNGFMWIYNERFDSCVFNQLETNGTDFQKQYIFATEIVFSGCVPLLILGFNILVIKEMYRITKCNRT--KSMGNCPQFHDPNQR-------FNNERSFLFTTIMLLAVSFYLFFTTLPGGIMFALQQVITMPDENM-NLSKIPSDPKWQFYFRVSIIKAVIDELCISHYALNFVIYLVTGKAFRKQFIDKIR 338          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000014330.1 (SMESG000014330.1)

HSP 1 Score: 186.037 bits (471), Expect = 1.333e-52
Identity = 126/364 (34.62%), Postives = 194/364 (53.30%), Query Frame = 3
Query:  342 QMNETSATSNEKTLLEIRQIFLPISYQLQLYSIPIFLTVGILGNPISFVVWVSRKLRRNNSSAVYIAMLAINDFFVVICSIIYYLRHSWGFGIIDIRGICKFYMVIFTFLQYNSILLVFGFTIERWIAVCYPFRRERCCTENRAW---IACGIIFSSVFISVFPLFFVWHYQPL---CSVPKHWIENTYFVTYSLTLEILFSALLPVITLAVNIRVVVEMYRI-SETIVTFPKLSA--------VNQNFEIPSQKS-------RKHS---KNTENSISFKSTTITLLLVSFFQILTTLPLGAVYICQIFYPEGNAT-SVKQMQNDPIWKKHFQMHGAKDIIDLLSLSHYCFNIVIYLASSHLFR 1355
            ++N T    N  TL  IR+     ++ L  Y   ++L  G++ N ++F++W   +LRR+N+SA Y+A +A++D    +  I++Y++ SW   + DI   C+ +  +F   QY S+ LV  F++ER+IAVC+PF+RE+ CT  +A    I CG+   +  I          Y  +   C +    +    +  ++   EIL SALLP  TL VNI V++E+  I S+T +  P ++A          Q+ +I   +        +KHS   +N E S +FKS+TI LL VSF  I+TTLP G VY  Q   P GN T SV+QM+ DP W K       K+++D  S+ H+  N VIY  +   FR
Sbjct:    4 EINRTENLQNNLTLFLIRKYLWSSTFYLHRYGSLLWLMSGLVLNTLAFIIWTRPRLRRSNTSANYLAGIAMSDTIFWLLYILHYMQTSWDICVQDIPVWCEMFQGLFISSQYFSVPLVLIFSLERYIAVCHPFKREKLCTHRKALVNTIVCGV---TALILGCSQSISREYNDVSKKCDIRGSVVNTRNWFIFATGTEILISALLPFATLIVNILVIIELKSITSKTTLIKPSVTAPLTSSTSTSEQHLQIQRNQGSTEKLNIKKHSISQQNKEKS-AFKSSTILLLSVSFLLIVTTLPTGFVYALQFVCPVGNETLSVEQMKVDPDWIKFINYQILKEVVDFFSMIHFSINFVIYYITGESFR 363          
The following BLAST results are available for this feature:
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GHSR4.405e-1023.81growth hormone secretagogue receptor [Source:HGNC ... [more]
GHSR8.920e-1023.81growth hormone secretagogue receptor [Source:HGNC ... [more]
F2RL21.833e-730.60coagulation factor II thrombin receptor like 2 [So... [more]
F2RL21.936e-730.60coagulation factor II thrombin receptor like 2 [So... [more]
LPAR63.978e-625.34lysophosphatidic acid receptor 6 [Source:HGNC Symb... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
frpr-181.787e-1127.55FLP-2 receptor; FMRFamide Peptide Receptor family ... [more]
frpr-182.940e-1127.55FLP-2 receptor; FMRFamide Peptide Receptor family ... [more]
frpr-64.062e-1027.05FMRFamide Peptide Receptor family [Source:UniProt... [more]
frpr-187.546e-1028.10FLP-2 receptor; FMRFamide Peptide Receptor family ... [more]
frpr-33.453e-832.82FMRFamide Peptide Receptor family; VRFamide recept... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CNMaR6.903e-1129.89gene:FBgn0053696 transcript:FBtr0091684[more]
Proc-R1.653e-827.85gene:FBgn0029723 transcript:FBtr0100552[more]
Proc-R1.653e-827.85gene:FBgn0029723 transcript:FBtr0070713[more]
Proc-R1.653e-827.85gene:FBgn0029723 transcript:FBtr0100551[more]
Proc-R1.653e-827.85gene:FBgn0029723 transcript:FBtr0070714[more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
oxgr1a.14.461e-926.90oxoglutarate (alpha-ketoglutarate) receptor 1a, ta... [more]
lpar6b4.914e-929.55lysophosphatidic acid receptor 6b [Source:ZFIN;Acc... [more]
oxgr1a.29.355e-926.59oxoglutarate (alpha-ketoglutarate) receptor 1a, ta... [more]
ntsr13.506e-825.13neurotensin receptor 1 (high affinity) [Source:ZFI... [more]
ntsr13.506e-825.13neurotensin receptor 1 (high affinity) [Source:ZFI... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GHSR2.909e-822.41growth hormone secretagogue receptor [Source:NCBI ... [more]
p2ry43.742e-828.76pyrimidinergic receptor P2Y, G-protein coupled, 4 ... [more]
ENSXETT00000027496.11.608e-728.78pep primary_assembly:Xenopus_tropicalis_v9.1:2:146... [more]
mesd3.318e-627.13mesoderm development LRP chaperone [Source:Xenbase... [more]
dab26.105e-630.50Dab, mitogen-responsive phosphoprotein, homolog 2 ... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ghsr6.028e-926.36growth hormone secretagogue receptor [Source:MGI S... [more]
P2ry41.615e-627.38pyrimidinergic receptor P2Y, G-protein coupled, 4 ... [more]
Olfr6184.272e-624.15olfactory receptor 618 [Source:MGI Symbol;Acc:MGI:... [more]
Olfr6184.272e-624.15olfactory receptor 618 [Source:MGI Symbol;Acc:MGI:... [more]
Lpar64.287e-624.83lysophosphatidic acid receptor 6 [Source:MGI Symbo... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A5A4K9|GHSR_RABIT4.097e-923.81Growth hormone secretagogue receptor type 1 OS=Ory... [more]
sp|Q92847|GHSR_HUMAN4.284e-923.81Growth hormone secretagogue receptor type 1 OS=Hom... [more]
sp|A5A4L1|GHSR_MUSPF2.852e-826.36Growth hormone secretagogue receptor type 1 OS=Mus... [more]
sp|O08725|GHSR_RAT4.216e-826.36Growth hormone secretagogue receptor type 1 OS=Rat... [more]
sp|Q99P50|GHSR_MOUSE4.216e-826.36Growth hormone secretagogue receptor type 1 OS=Mus... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0R3UN111.127e-6236.73G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A0V0JBK02.087e-5935.86FMRFamide receptor OS=Schistocephalus solidus OX=7... [more]
A0A3P7L2X21.248e-5835.88G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A0R3T0T75.074e-5633.80G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A068Y8V41.958e-5233.80Rhodopsin orphan GPCR OS=Echinococcus multilocular... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ntsr18.316e-1021.21neurotensin receptor 1 [Source:NCBI gene;Acc:10304... [more]
ntsr11.195e-922.01neurotensin receptor 1 [Source:NCBI gene;Acc:10304... [more]
P2RY44.668e-929.03P2Y purinoceptor 4-like [Source:NCBI gene;Acc:1030... [more]
lpar6a1.852e-825.77lysophosphatidic acid receptor 6a [Source:ZFIN;Acc... [more]
gpr392.364e-727.85G protein-coupled receptor 39 [Source:NCBI gene;Ac... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000001343.12.274e-1031.54pep scaffold:Pmarinus_7.0:GL480096:18103:20287:1 g... [more]
ENSPMAT00000000867.12.352e-1031.54pep scaffold:Pmarinus_7.0:GL477415:83128:85299:-1 ... [more]
ENSPMAT00000002724.17.229e-1033.08pep scaffold:Pmarinus_7.0:GL489282:5596:6337:1 gen... [more]
ENSPMAT00000001342.11.477e-930.77pep scaffold:Pmarinus_7.0:GL480096:9441:11970:1 ge... [more]
ENSPMAT00000011145.11.186e-727.61pep scaffold:Pmarinus_7.0:GL480128:19975:20922:-1 ... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO440001.290e-623.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
P2RY46.834e-1130.00pyrimidinergic receptor P2Y4 [Source:NCBI gene;Acc... [more]
sstr52.321e-932.86somatostatin receptor type 5 [Source:NCBI gene;Acc... [more]
sstr52.435e-932.86somatostatin receptor type 5 [Source:NCBI gene;Acc... [more]
ntsr19.455e-927.21neurotensin receptor 1 [Source:NCBI gene;Acc:10535... [more]
ghsrb2.371e-722.67growth hormone secretagogue receptor type 1 [Sourc... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000018637.10.000e+0100.00SMESG000018637.1[more]
SMESG000018637.10.000e+0100.00SMESG000018637.1[more]
SMESG000007702.17.496e-6633.68SMESG000007702.1[more]
SMESG000031888.14.112e-5335.16SMESG000031888.1[more]
SMESG000014330.11.333e-5234.62SMESG000014330.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012077 ID=SMED30012077|Name=G_PROTEIN_RECEP_F1_2 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1815bp
TATCGGTAACTGTCGCTGATTTTCAAACATTTATTATTCATAAAGTCATC
GATTTTTTTGTTTTAATTAGTTTCTCTATTTTAATTAAATTTTTGTTTTG
GAAATTTTGATTTTTAATATCTAATGAATAATAATGGTAAAGCAATTATA
AATCATAGATTTGAACAATGTAGACAAATTTATTTTTCCAACGTAACAAT
TCTTTGGCGATGAGAATACCGATAATCTTGCTTGGCGATTATATTACAAA
TAAAAGTAATTGCATTTCATTTTGTCTTAACTCTGTGGAATTTGCAAAAT
TAAAACAAACTTTATTAAAAAAAAAAGAAAATCAATATTATCAAATGAAT
GAAACTTCAGCGACTTCGAACGAAAAAACTCTGCTAGAGATCCGACAGAT
ATTTTTACCAATTTCTTATCAATTACAATTGTATTCTATTCCAATCTTTC
TGACCGTTGGAATACTTGGCAATCCGATTTCCTTTGTTGTGTGGGTTTCA
AGAAAACTTCGACGAAATAATTCTTCTGCAGTTTACATAGCGATGCTTGC
CATTAATGACTTTTTCGTTGTTATTTGTAGCATTATTTATTATTTGAGAC
ATTCATGGGGTTTCGGTATAATAGATATTAGAGGAATTTGTAAATTCTAT
ATGGTTATTTTCACGTTTTTGCAGTATAACTCTATATTACTAGTGTTTGG
ATTTACTATCGAAAGATGGATAGCTGTATGTTATCCTTTTCGACGTGAAA
GATGTTGCACTGAAAATCGAGCCTGGATAGCTTGTGGAATAATTTTTTCA
AGTGTGTTCATATCAGTATTTCCTTTGTTCTTCGTTTGGCATTATCAACC
ACTTTGCAGTGTTCCTAAACACTGGATTGAGAATACATATTTCGTTACCT
ATTCTTTAACATTGGAAATTTTATTTAGTGCCTTATTACCTGTAATAACG
TTAGCAGTTAATATTCGGGTTGTCGTAGAGATGTACCGAATATCCGAAAC
AATAGTGACATTTCCGAAACTATCAGCAGTAAATCAGAATTTTGAAATTC
CCAGTCAAAAGTCGAGAAAACACAGCAAAAACACAGAGAATAGTATTTCT
TTCAAATCAACAACAATCACATTGTTATTAGTTTCATTTTTTCAGATTTT
AACCACTCTACCACTAGGAGCGGTTTATATTTGTCAAATATTCTATCCGG
AAGGCAATGCAACGTCAGTTAAACAAATGCAAAACGATCCAATTTGGAAA
AAACATTTTCAAATGCACGGTGCAAAAGATATAATAGATTTACTAAGTCT
CTCTCATTATTGTTTCAACATTGTCATTTATTTGGCTTCTAGTCATTTAT
TTCGGAATCACTTGATGGGTTTTGTAAAATTATATTTAATGAGAAAAGAA
AACAATAATTCTTTAAACAATTCTTACTATAAACTAAGACAAAGTCAAGA
CACCCACAAAACCGAAATGAGCATTCGACGAAAACTTGTCGAGTCCAAAG
TCCCTCTACCATTGGAGGTTTCTCTCGCAACTTAGACATTATTCTATCGA
ACTTTTCCAGTTGATTTTTAATCCAATAATTTTTCCGAACGATTTAAGTT
CAGAATTTTAATTTTTAAAATCAAATTTAAAAAATTTTAGAATGTAATTT
TAATTCATTTATCAATTGTGATGATTTTCTTTCATATCAAAAATGATTGA
TAAAAAATTTATTTCTCATTTAATGGTAAAATGGACTGAAATGGTAAAAA
TATTTCAAAATGATTTCAAGTTTCAATGAAAACTAAAAATTCATCAATTA
AAAATAATTCCAGAA
back to top

protein sequence of SMED30012077-orf-1

>SMED30012077-orf-1 ID=SMED30012077-orf-1|Name=SMED30012077-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=442bp
MRIPIILLGDYITNKSNCISFCLNSVEFAKLKQTLLKKKENQYYQMNETS
ATSNEKTLLEIRQIFLPISYQLQLYSIPIFLTVGILGNPISFVVWVSRKL
RRNNSSAVYIAMLAINDFFVVICSIIYYLRHSWGFGIIDIRGICKFYMVI
FTFLQYNSILLVFGFTIERWIAVCYPFRRERCCTENRAWIACGIIFSSVF
ISVFPLFFVWHYQPLCSVPKHWIENTYFVTYSLTLEILFSALLPVITLAV
NIRVVVEMYRISETIVTFPKLSAVNQNFEIPSQKSRKHSKNTENSISFKS
TTITLLLVSFFQILTTLPLGAVYICQIFYPEGNATSVKQMQNDPIWKKHF
QMHGAKDIIDLLSLSHYCFNIVIYLASSHLFRNHLMGFVKLYLMRKENNN
SLNNSYYKLRQSQDTHKTEMSIRRKLVESKVPLPLEVSLAT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR000276GPCR_Rhodpsn
IPR017452GPCR_Rhodpsn_7TM
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000276G protein-coupled receptor, rhodopsin-likePRINTSPR00237GPCRRHODOPSNcoord: 106..127
score: 21.95
coord: 151..173
score: 20.92
coord: 356..382
score: 24.05
IPR000276G protein-coupled receptor, rhodopsin-likePFAMPF000017tm_1coord: 92..337
e-value: 2.1E-17
score: 63.3
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 67..400
e-value: 9.0E-40
score: 138.5
NoneNo IPR availablePANTHERPTHR24243G-PROTEIN COUPLED RECEPTORcoord: 48..424
NoneNo IPR availablePANTHERPTHR24243:SF208ETHR, ISOFORM Acoord: 48..424
NoneNo IPR availableCDDcd149787tmA_FMRFamide_R-likecoord: 72..383
e-value: 3.67933E-31
score: 119.275
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 47..396
NoneNo IPR availableTMHMMTMhelixcoord: 230..252
NoneNo IPR availableTMHMMTMhelixcoord: 358..380
NoneNo IPR availableTMHMMTMhelixcoord: 188..210
NoneNo IPR availableTMHMMTMhelixcoord: 305..327
NoneNo IPR availableTMHMMTMhelixcoord: 108..130
NoneNo IPR availableTMHMMTMhelixcoord: 74..96
NoneNo IPR availableTMHMMTMhelixcoord: 145..167
IPR017452GPCR, rhodopsin-like, 7TMPROSITEPS50262G_PROTEIN_RECEP_F1_2coord: 87..374
score: 18.807