Protocadherin-9

Overview
NameProtocadherin-9
Smed IDSMED30012056
Length (bp)3995
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protocadherin-9 (SMED30012056) t-SNE clustered cells

Violin plots show distribution of expression levels for Protocadherin-9 (SMED30012056) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protocadherin-9 (SMED30012056) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protocadherin-9 (SMED30012056) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012056

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30012056SMESG000079318.1 dd_Smed_v4_5383_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30012056SMESG000079318.1 dd_Smed_v4_5383_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30012056SMESG000079318.1 dd_Smed_v4_5383_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30012056SMESG000079318.1 dd_Smed_v4_5383_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30012056SMESG000079318.1 dd_Smed_v4_5383_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30012056SMESG000079318.1 dd_Smed_v4_9894_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30012056SMESG000079318.1 dd_Smed_v4_9894_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012056SMESG000079318.1 Contig43323uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012056SMESG000079318.1 Contig43323newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pigment cellSMED30012056SMESG000079318.1 dd_Smed_v6_5383_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protocadherin-9 vs. Ensembl Human
Match: PCDH11Y (protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:HGNC:15813])

HSP 1 Score: 229.95 bits (585), Expect = 1.636e-60
Identity = 215/809 (26.58%), Postives = 373/809 (46.11%), Query Frame = 1
Query:  478 IWFIVIFCVNTVLALSDKISIQMHEEIPPNSEIGSIL-----SAIPHNLRSTSLEFITESDFFIVTEEGKI-LVR------KLIDLETLCSQYKLCCGEPV---CILKANILLNNKEKEVVSSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNSFILDISQLPS----IFLKVSKKLDFEEKKQYHAKLKACD---EDNCTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKP--EIRIIADL--SSLKIQEEIP-SKLITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDK--SAVLKYQIDNYGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILN--ITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQ---MLHSGTVILLFRASDYGQPAKYSDHKLVINIFGDES 2802
            I+ +++ CV       +K +  + EEIP N  IG++L     S IP+   +T+++F       +V + G + L+R      ++        + KLC G P    C  +  + +     E+   V+I+  I D ND+ P+F      I I E S I    +L +A D D      +QNY+L +  N F LD+ + P       L V K+LD EEK  Y  K+K  D       +T  L + + D NDN P+F+     ++I E+  +G+ + Q+ A D D G    I +S         +  F++   +G I +K+ L       +   ++A D   + P +++  V + V DVND+ P  +IR I +    ++ + E IP +  I  + + D+D   NG V C  D   E  F L+    + + L +    D+E  ++    ++  D G+P L    ++ I + D N+  P F     ++   + EN+  G ++M V A D D   +A + Y +       F +D+ +G++     L DRE+     FT+   D+   P T++V V ++++D NDNSP+F+ N  +F + EN      VG I  TD D  +N+ ++ S+        +  +D++     TG I   +  DRE  + Y   + A D  +   +  +S   +T+ V+D ND  P +  P  N     +  +  PG  + Q+ A D D G N +VR+ I+    ++             F ++  TG + + +   +   G   +L +A+D GQP       +++N+F +ES
Sbjct:   41 IFAVLLVCVVFHSGAQEK-NYTIREEIPENVLIGNLLKDLNLSLIPNKSLTTTMQFK------LVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAI--LPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGIN-GVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGG-LMPARAM--VLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTD--HEIPFRLRPVFSNQFLLENAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFT--QSFVTVSIPENNSPGIQLMKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVKKL-DREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYKFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSI--------LDENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGR---VSRSSSAKVTINVVDVNDNKPVFIVPPYNYSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRD------------LFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSLFS-VVIVNLFVNES 807          
BLAST of Protocadherin-9 vs. Ensembl Human
Match: PCDH9 (protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661])

HSP 1 Score: 227.254 bits (578), Expect = 4.209e-60
Identity = 218/811 (26.88%), Postives = 372/811 (45.87%), Query Frame = 1
Query:  490 VIFCVNTVLALSDKISIQMHEEIPPNSEIGSILSAIPHNLRSTSLEFITESD----FFIVTEEGKILVRKL-------------IDLETLCSQYKLCCGEPVCILKANILLNNKEKEVVSSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNSFILDISQLPSIF----LKVSKKLDFEEKKQYHAKLKACDEDNCTTQN-----LIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIADLS----SLKIQEEIP-SKLITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQD--KSAVLKYQIDNYGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNN--ILNITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQM---LHSGTVILLFRASDYGQPAKYSDHKLVINIFGDESGN 2808
            +I C+    A++ ++   + EE+P N  IG+I    P +L  + +   T +     + +V++ G   + K+             ID E LC+       E  C  +  +++     +    ++I++ + D ND+ P+F +P   I I E + I     + SATD D +    +Q+Y+L    + F LDI + P       L V + LD E+K  Y  K+K   ED  T Q      L + + D NDN+P+F+     + I E+  +G+ + Q+ A D D G    I+Y          +  F +   +G I +++ L     + +   ++A D    +   +  +VTI V DVND+ P I +   +S    ++ + E+ P +  I  + + D+D   NG V C ++   E  F L+    + Y L +    D+E  ++    ++  D G+PSL    ++ + + D N+  P F      L   V EN+  G  + T+ A D+D  K+A + YQ+    A +F++D+ +G++  +  + DRE      FTV   D+ T P  +   V +TVLD NDNSP F+ N  QF + EN      VG I  TDAD  EN  ++ S+ N         +DN+     +G I++ +  DRE    Y  ++ A+D  + P+   +S   +T+ V+D ND SP    P +N     +  +  PG  + ++ A D D G N ++++ I+         S  N+G    F ++  TG + + +       G   L+   SD G P       LV     D +GN
Sbjct:   12 LIACLRLDSAIAQELIYTIREELPENVPIGNI----PKDLNISHINAATGTSASLVYRLVSKAGDAPLVKVSSSTGEIFTTSNRIDREKLCAGASYA-EENECFFELEVVI--LPNDFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPD-TGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKV--EDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDG---SSTPARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIE--REVPFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIEL--SVSENNRRGLYLTTISATDEDSGKNADIVYQL-GPNASFFDLDRKTGVLTASR-VFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENKAVTLSILND--------NDNFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPR---SSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAIPGSVVAEVFAVDVDTGMNAELKYTIV---------SGNNKG---LFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYPKSLHTLVLVFLYVNDTAGN 780          
BLAST of Protocadherin-9 vs. Ensembl Human
Match: PCDH11Y (protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:HGNC:15813])

HSP 1 Score: 227.254 bits (578), Expect = 4.310e-60
Identity = 215/809 (26.58%), Postives = 373/809 (46.11%), Query Frame = 1
Query:  478 IWFIVIFCVNTVLALSDKISIQMHEEIPPNSEIGSIL-----SAIPHNLRSTSLEFITESDFFIVTEEGKI-LVR------KLIDLETLCSQYKLCCGEPV---CILKANILLNNKEKEVVSSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNSFILDISQLPS----IFLKVSKKLDFEEKKQYHAKLKACD---EDNCTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKP--EIRIIADL--SSLKIQEEIP-SKLITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDK--SAVLKYQIDNYGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILN--ITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQ---MLHSGTVILLFRASDYGQPAKYSDHKLVINIFGDES 2802
            I+ +++ CV       +K +  + EEIP N  IG++L     S IP+   +T+++F       +V + G + L+R      ++        + KLC G P    C  +  + +     E+   V+I+  I D ND+ P+F      I I E S I    +L +A D D      +QNY+L +  N F LD+ + P       L V K+LD EEK  Y  K+K  D       +T  L + + D NDN P+F+     ++I E+  +G+ + Q+ A D D G    I +S         +  F++   +G I +K+ L       +   ++A D   + P +++  V + V DVND+ P  +IR I +    ++ + E IP +  I  + + D+D   NG V C  D   E  F L+    + + L +    D+E  ++    ++  D G+P L    ++ I + D N+  P F     ++   + EN+  G ++M V A D D   +A + Y +       F +D+ +G++     L DRE+     FT+   D+   P T++V V ++++D NDNSP+F+ N  +F + EN      VG I  TD D  +N+ ++ S+        +  +D++     TG I   +  DRE  + Y   + A D  +   +  +S   +T+ V+D ND  P +  P  N     +  +  PG  + Q+ A D D G N +VR+ I+    ++             F ++  TG + + +   +   G   +L +A+D GQP       +++N+F +ES
Sbjct:   41 IFAVLLVCVVFHSGAQEK-NYTIREEIPENVLIGNLLKDLNLSLIPNKSLTTTMQFK------LVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAI--LPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGIN-GVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGG-LMPARAM--VLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTD--HEIPFRLRPVFSNQFLLENAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFT--QSFVTVSIPENNSPGIQLMKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVKKL-DREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYKFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSI--------LDENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGR---VSRSSSAKVTINVVDVNDNKPVFIVPPYNYSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRD------------LFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSLF-SVVIVNLFVNES 807          
BLAST of Protocadherin-9 vs. Ensembl Human
Match: PCDH11Y (protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:HGNC:15813])

HSP 1 Score: 226.868 bits (577), Expect = 5.537e-60
Identity = 215/809 (26.58%), Postives = 373/809 (46.11%), Query Frame = 1
Query:  478 IWFIVIFCVNTVLALSDKISIQMHEEIPPNSEIGSIL-----SAIPHNLRSTSLEFITESDFFIVTEEGKI-LVR------KLIDLETLCSQYKLCCGEPV---CILKANILLNNKEKEVVSSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNSFILDISQLPS----IFLKVSKKLDFEEKKQYHAKLKACD---EDNCTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKP--EIRIIADL--SSLKIQEEIP-SKLITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDK--SAVLKYQIDNYGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILN--ITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQ---MLHSGTVILLFRASDYGQPAKYSDHKLVINIFGDES 2802
            I+ +++ CV       +K +  + EEIP N  IG++L     S IP+   +T+++F       +V + G + L+R      ++        + KLC G P    C  +  + +     E+   V+I+  I D ND+ P+F      I I E S I    +L +A D D      +QNY+L +  N F LD+ + P       L V K+LD EEK  Y  K+K  D       +T  L + + D NDN P+F+     ++I E+  +G+ + Q+ A D D G    I +S         +  F++   +G I +K+ L       +   ++A D   + P +++  V + V DVND+ P  +IR I +    ++ + E IP +  I  + + D+D   NG V C  D   E  F L+    + + L +    D+E  ++    ++  D G+P L    ++ I + D N+  P F     ++   + EN+  G ++M V A D D   +A + Y +       F +D+ +G++     L DRE+     FT+   D+   P T++V V ++++D NDNSP+F+ N  +F + EN      VG I  TD D  +N+ ++ S+        +  +D++     TG I   +  DRE  + Y   + A D  +   +  +S   +T+ V+D ND  P +  P  N     +  +  PG  + Q+ A D D G N +VR+ I+    ++             F ++  TG + + +   +   G   +L +A+D GQP       +++N+F +ES
Sbjct:   30 IFAVLLVCVVFHSGAQEK-NYTIREEIPENVLIGNLLKDLNLSLIPNKSLTTTMQFK------LVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAI--LPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGIN-GVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGG-LMPARAM--VLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTD--HEIPFRLRPVFSNQFLLENAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFT--QSFVTVSIPENNSPGIQLMKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVKKL-DREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYKFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSI--------LDENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGR---VSRSSSAKVTINVVDVNDNKPVFIVPPYNYSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRD------------LFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSLF-SVVIVNLFVNES 796          
BLAST of Protocadherin-9 vs. Ensembl Human
Match: PCDH11Y (protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:HGNC:15813])

HSP 1 Score: 226.868 bits (577), Expect = 5.537e-60
Identity = 215/809 (26.58%), Postives = 373/809 (46.11%), Query Frame = 1
Query:  478 IWFIVIFCVNTVLALSDKISIQMHEEIPPNSEIGSIL-----SAIPHNLRSTSLEFITESDFFIVTEEGKI-LVR------KLIDLETLCSQYKLCCGEPV---CILKANILLNNKEKEVVSSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNSFILDISQLPS----IFLKVSKKLDFEEKKQYHAKLKACD---EDNCTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKP--EIRIIADL--SSLKIQEEIP-SKLITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDK--SAVLKYQIDNYGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILN--ITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQ---MLHSGTVILLFRASDYGQPAKYSDHKLVINIFGDES 2802
            I+ +++ CV       +K +  + EEIP N  IG++L     S IP+   +T+++F       +V + G + L+R      ++        + KLC G P    C  +  + +     E+   V+I+  I D ND+ P+F      I I E S I    +L +A D D      +QNY+L +  N F LD+ + P       L V K+LD EEK  Y  K+K  D       +T  L + + D NDN P+F+     ++I E+  +G+ + Q+ A D D G    I +S         +  F++   +G I +K+ L       +   ++A D   + P +++  V + V DVND+ P  +IR I +    ++ + E IP +  I  + + D+D   NG V C  D   E  F L+    + + L +    D+E  ++    ++  D G+P L    ++ I + D N+  P F     ++   + EN+  G ++M V A D D   +A + Y +       F +D+ +G++     L DRE+     FT+   D+   P T++V V ++++D NDNSP+F+ N  +F + EN      VG I  TD D  +N+ ++ S+        +  +D++     TG I   +  DRE  + Y   + A D  +   +  +S   +T+ V+D ND  P +  P  N     +  +  PG  + Q+ A D D G N +VR+ I+    ++             F ++  TG + + +   +   G   +L +A+D GQP       +++N+F +ES
Sbjct:   30 IFAVLLVCVVFHSGAQEK-NYTIREEIPENVLIGNLLKDLNLSLIPNKSLTTTMQFK------LVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAI--LPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGIN-GVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGG-LMPARAM--VLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTD--HEIPFRLRPVFSNQFLLENAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFT--QSFVTVSIPENNSPGIQLMKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVKKL-DREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYKFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSI--------LDENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGR---VSRSSSAKVTINVVDVNDNKPVFIVPPYNYSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRD------------LFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSLF-SVVIVNLFVNES 796          
BLAST of Protocadherin-9 vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 177.178 bits (448), Expect = 2.952e-44
Identity = 201/775 (25.94%), Postives = 348/775 (44.90%), Query Frame = 1
Query:  550 EEIPPNSEIGSILSAI----------------PHNLRSTSLEFITESDFFIVTEEGKILVRKLIDLETLCSQYKLCCGEPVCILKANILLNNKEKEVVSSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNSFILDISQLPSIFLKVSKKLDFEEKKQYHAKLKACDEDNC---TTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPK-QSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIP-SKLITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKSAVLKYQIDNYGAEYFEI----DQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLP-TGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQML---HSGTVILLFRASDYGQPAKYSDHKLVINI 2787
            +E+P ++ I +I++++                P + RS +L       F + T  G+I + K +D E L             ILK        +  + +S  + V +LD  D++PIFE       I E + IG ++    A D D      I+ Y L E     +L I+    + ++ +  LD E        + A D+      +T  + I + D NDN P+F +++YN+TI E++ I ++I  VKA D D G  G + YS+ +           ++  +G + L++++        P   V R  D   P   S   +TI V D+NDH P   +IA    + ++E +   + +  +  +D+D GPNGI+   +    EGS +     +D   +++ +  D E   +    V  +D G PSL +   I +++ D+N+  PTF DK +Y +  + E    G++++T+KA D D+   + Y+I+    E F I    DQ  G I   +  + R+        V +  +D         V + + D N ++P F+ +     I E++     V  + A D D+ +NA I +S+ +S           +F + P +G I     LDRE    + + + ASD A SP  PL +   I + + D ND SP +T   +    I++ +  G   LQ+ A D D+G NG     I+  +  E  SS     S Q F ++ ++G L +S  L       ++L   A D G P+  +  ++ + +
Sbjct:  172 KELPEDTPIETIIASVKASHASSQPLYYSMVAPQDSRSQNL-------FTLDTMSGEIRLAKSMDREVLDKH----------ILKVTAY-ERVDPTISASTTVVVHVLDVQDNSPIFEKDSYFGEIREDAPIGTTVLSVFARDLDSGENGEIE-YSLGEGNGKNLLAINAKSGV-IQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGI---GGLTIDYSTGEVTLRERIDA---KNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPT--LIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSM----EGSEDFI-IDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTF-DKKEYNVT-ISEEMPRGSQIITLKAVDNDEDQKITYRIEEADREVFSILDIGDQ--GAILSVSGELKRQ---DHKVRVEISATDQGGLQGRCVVNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSS----------QFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHA-SP--PLNTSTQIEVILDDINDNSPQFT-SSSYAATISEDIPVGTSFLQVSAIDADIGPNG-----IVDYFLNESSSSP----SIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTL 882          

HSP 2 Score: 168.703 bits (426), Expect = 1.180e-41
Identity = 175/644 (27.17%), Postives = 310/644 (48.14%), Query Frame = 1
Query:  736 EPVCILKANILLNNK---EKEVVSSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNSFILDISQLPSIFLKVSKKLDFEEKKQYHAKLKACDEDN---CTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIP-SKLITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNRSKDIYSLRSV-------------RKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKS--AVLKYQIDNYGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQ--RHDNYFNVLPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQLQATDRDVGANGKVRFEII 2595
            E + +++ +++ ++K   ++E  + VEI V  +D ND+ P+F +    + I E   I   I+   ATD+D  +  ++  Y +   +    L I    +  + + +++D  +     A ++A D       +T  L I++ D ND+ P        +T++E+V IG  +G+V A D DSG  G IKYS+    D      F ++  SG IK  K L   T +RY  ++ ARD    +   S  ++ ++++D+ND+ P         ++ I EE+P    I TL+ VD D+              + ++ ++   ++++S+  +             ++ DH+V  +I A     DQG   L+ R ++ + I D+N   P F D    +   + E+S  G  V+T+KA+D D+   A + Y ID+  +++F ID +SG I  +++L DRE  ++ S  V   D  + P   S ++++ + D NDNSP F+++    +I E+        Q++A DAD   N ++ + L  S +  ++Q  R D       +G +    KLDRE   + +L I A D   +P   L++   ITL + D ND +PT+     + L I +    G  +  + A D D G N  + F I 
Sbjct:  336 ETLSLIRLDVIASDKGTPKRESTAMVEITV--VDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVH-YSMASSSGIGGLTI-DYSTGEVTLRERID-AKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSED------FIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTST-TIAVVLKDINDNAPTFD--KKEYNVTISEEMPRGSQIITLKAVDNDEDQ------------KITYRIEEADREVFSILDIGDQGAILSVSGELKRQDHKVRVEISA----TDQG--GLQGRCVVNVFIDDVNS-APYFNDHPFSV--KIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDS--SQFFRIDPSSGDISVSSDL-DREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDR-----TSGTLRVSSKLDREQFAVIVLPIFARDRG-TPS--LSAASEITLTLSDVNDNAPTFEQLSYD-LYIAENSPVGSTVGTIVARDADEGDNADISFRIF 932          

HSP 3 Score: 151.754 bits (382), Expect = 1.512e-36
Identity = 163/580 (28.10%), Postives = 254/580 (43.79%), Query Frame = 1
Query:  796 SSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNSFILDISQLPSIFLKVSKKLDFEEKKQYHAKLKACDEDN---CTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKA--NDRDSGLFGTIKYSIRTDFDT-DIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVN------DHKPEIRIIADLSSLKIQEEIPSKL-ITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQD--KSAVLKYQIDNYGA----EYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLPTGHIETLLK--LDREI-CDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPT 2469
            S+V + + ++D NDH P     +  I + E   IG  +    A D+D S    I  Y + E +  FI+D     S  +K +K LD E   +Y  K+ A D       T+  + + +KD NDN P F+ + YN+TI E++  GS I  +KA  ND D  +   I+ + R  F   DI     + ++SG +K         R  +  R+    +D     Q  C V + ++DVN      DH           S+KI E  P    + TL+  D D+G N  +   +D      F +   S DI S+ S    D E       IV   D   P L +   I +I+ D+N+  P F   S      + E+   GT  + V A D D   + ++ Y ++   +    + F +D+ SG +R ++ L DRE+ + I   +   D  T   +A+ E+ +T+ D NDN+P F        I EN+     VG I A DAD+ +NA ISF +   + G   +  D   +    G +  L +   D E   + +  E+ AS    S  +P      + + V D ND  P 
Sbjct:  461 STVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDED-SGPNGIIKYSM-EGSEDFIIDED---SGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIEEADREVFSILDIGDQGAILSVSGELK---------RQDHKVRVEISATDQ-GGLQGRCVVNVFIDDVNSAPYFNDHP---------FSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDS--SQFFRIDPSSGDI-SVSS--DLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSS--YAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKL-DREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRI---FGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQASSGQLSSTVP------VRIHVSDVNDNKPA 999          

HSP 4 Score: 133.65 bits (335), Expect = 5.664e-31
Identity = 160/588 (27.21%), Postives = 270/588 (45.92%), Query Frame = 1
Query:  538 IQMHEEIPPNSEIGSILS----AIPHNLRSTSLEFITESDFFIVTEEGKILVRKLIDLETLCSQYKLCCGEPVCILKANILLNNKEKEVVSSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQ--YRIQNYKLDEPTNSFILDISQLPSIFLKVSKKLDFEEKKQYHAKLKACDEDNCTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARD--SDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIPSKLITTLQI--VDQDKGPNGIVYCHLDPVCEG-SFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKS--AVLKYQI-DNYGAEYFEIDQNS---GLIR-CTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSL 2247
            I + E +    E+G + +    + P+ +   S+E     DF I  + G I   KL+D ET  ++Y L               +     + +S  I V + D ND+ P F+  E  + ISE    G  I    A D D   +  YRI+  + D    S ILDI    +I L VS +L  ++ K    ++ A D+     + ++    D+ ++ P F    +++ I E   IG  +  +KA D D G    I YSI      D    F ++  SG I +   L    R+ +   + A D  S P+N       + ++++D+ND+ P+    +   +  I E+IP    + LQ+  +D D GPNGIV   L+      S +L    +   +LR   K D E    I   +  +D+G PSL +   I + ++D+N+  PTF+  S  L  ++ ENS  G+ V T+ A+D D+   A + ++I     A+ F+I++++   G++R  T    D E  ++  F    + + +   +++V V+I V D NDN P     +   +  +N   ++ +G I A D DQ  NA + + L
Sbjct:  486 ITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSME--GSEDFIIDEDSGLIKTTKLLDRETT-ARYSL----------KVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIE--EADREVFS-ILDIGDQGAI-LSVSGELKRQDHK-VRVEISATDQGGLQGRCVVNVFIDDVNSAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSI------DSSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQ---IEVILDDINDNSPQF--TSSSYAATISEDIPVG-TSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDL--YIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFF--FELQASSGQLSSTVPVRIHVSDVNDNKPALKDFVILMNRFDNVQMARQIGFIPAFDPDQ--NATLEYFL 1037          
BLAST of Protocadherin-9 vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 166.007 bits (419), Expect = 6.389e-41
Identity = 168/617 (27.23%), Postives = 295/617 (47.81%), Query Frame = 1
Query:  808 IQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNSFILDISQLPSIFLKVSKKLDFEEKKQYHAKLKACDEDN---CTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIP-SKLITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNRSKDIYSLRSV-------------RKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKS--AVLKYQIDNYGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQ--RHDNYFNVLPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQLQATDRDVGANGKVRFEII 2595
            +++ ++D ND+ P+F +    + I E   I   I+   ATD+D  +  ++  Y +   +    L I    +  + + +++D  +     A ++A D       +T  L I++ D ND+ P        +T++E+V IG  +G+V A D DSG  G IKYS+    D      F ++  SG IK  K L   T +RY  ++ ARD    +   S  ++ ++++D+ND+ P         ++ I EE+P    I TL+ VD D+              + ++ ++   ++++S+  +             ++ DH+V  +I A     DQG   L+ R ++ + I D+N   P F D    +   + E+S  G  V+T+KA+D D+   A + Y ID+  +++F ID +SG I  +++L DRE  ++ S  V   D  + P   S ++++ + D NDNSP F+++    +I E+        Q++A DAD   N ++ + L  S +  ++Q  R D       +G +    KLDRE   + +L I A D   +P   L++   ITL + D ND +PT+     + L I +    G  +  + A D D G N  + F I 
Sbjct:    2 VEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVH-YSMASSSGIGGLTI-DYSTGEVTLRERID-AKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSED------FIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTST-TIAVVLKDINDNAPTFD--KKEYNVTISEEMPRGSQIITLKAVDNDEDQ------------KITYRIEEADREVFSILDIGDQGAILSVSGELKRQDHKVRVEISA----TDQG--GLQGRCVVNVFIDDVNS-APYFNDHPFSV--KIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDS--SQFFRIDPSSGDISVSSDL-DREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDR-----TSGTLRVSSKLDREQFAVIVLPIFARDRG-TPS--LSAASEITLTLSDVNDNAPTFEQLSYD-LYIAENSPVGSTVGTIVARDADEGDNADISFRIF 573          

HSP 2 Score: 157.532 bits (397), Expect = 2.867e-38
Identity = 154/564 (27.30%), Postives = 265/564 (46.99%), Query Frame = 1
Query: 1126 IHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPK-QSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIP-SKLITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKSAVLKYQIDNYGAEYFEI----DQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLP-TGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQML---HSGTVILLFRASDYGQPAKYSDHKLVINI 2787
            I + D NDN P+F +++YN+TI E++ I ++I  VKA D D G  G + YS+ +           ++  +G + L++++        P   V R  D   P   S   +TI V D+NDH P   +IA    + ++E +   + +  +  +D+D GPNGI+   +    EGS +     +D   +++ +  D E   +    V  +D G PSL +   I +++ D+N+  PTF DK +Y +  + E    G++++T+KA D D+   + Y+I+    E F I    DQ  G I   +  + R+        V +  +D         V + + D N ++P F+ +     I E++     V  + A D D+ +NA I +S+ +S           +F + P +G I     LDRE    + + + ASD A SP  PL +   I + + D ND SP +T   +    I++ +  G   LQ+ A D D+G NG     I+  +  E  SS     S Q F ++ ++G L +S  L       ++L   A D G P+  +  ++ + +
Sbjct:    4 ITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGI---GGLTIDYSTGEVTLRERIDA---KNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPT--LIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSM----EGSEDFI-IDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTF-DKKEYNV-TISEEMPRGSQIITLKAVDNDEDQKITYRIEEADREVFSILDIGDQ--GAILSVSGELKRQ---DHKVRVEISATDQGGLQGRCVVNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSS----------QFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHA-SP--PLNTSTQIEVILDDINDNSPQFT-SSSYAATISEDIPVGTSFLQVSAIDADIGPNG-----IVDYFLNESSSSP----SIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTL 523          

HSP 3 Score: 151.369 bits (381), Expect = 2.392e-36
Identity = 163/580 (28.10%), Postives = 254/580 (43.79%), Query Frame = 1
Query:  796 SSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNSFILDISQLPSIFLKVSKKLDFEEKKQYHAKLKACDEDN---CTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKA--NDRDSGLFGTIKYSIRTDFDT-DIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVN------DHKPEIRIIADLSSLKIQEEIPSKL-ITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQD--KSAVLKYQIDNYGA----EYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLPTGHIETLLK--LDREI-CDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPT 2469
            S+V + + ++D NDH P     +  I + E   IG  +    A D+D S    I  Y + E +  FI+D     S  +K +K LD E   +Y  K+ A D       T+  + + +KD NDN P F+ + YN+TI E++  GS I  +KA  ND D  +   I+ + R  F   DI     + ++SG +K         R  +  R+    +D     Q  C V + ++DVN      DH           S+KI E  P    + TL+  D D+G N  +   +D      F +   S DI S+ S    D E       IV   D   P L +   I +I+ D+N+  P F   S      + E+   GT  + V A D D   + ++ Y ++   +    + F +D+ SG +R ++ L DRE+ + I   +   D  T   +A+ E+ +T+ D NDN+P F        I EN+     VG I A DAD+ +NA ISF +   + G   +  D   +    G +  L +   D E   + +  E+ AS    S  +P      + + V D ND  P 
Sbjct:  102 STVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDED-SGPNGIIKYSM-EGSEDFIIDED---SGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIEEADREVFSILDIGDQGAILSVSGELK---------RQDHKVRVEISATDQ-GGLQGRCVVNVFIDDVNSAPYFNDHP---------FSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDS--SQFFRIDPSSGDI-SVSS--DLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSS--YAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKL-DREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRI---FGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQASSGQLSSTVP------VRIHVSDVNDNKPA 640          

HSP 4 Score: 132.88 bits (333), Expect = 8.308e-31
Identity = 160/588 (27.21%), Postives = 270/588 (45.92%), Query Frame = 1
Query:  538 IQMHEEIPPNSEIGSILS----AIPHNLRSTSLEFITESDFFIVTEEGKILVRKLIDLETLCSQYKLCCGEPVCILKANILLNNKEKEVVSSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQ--YRIQNYKLDEPTNSFILDISQLPSIFLKVSKKLDFEEKKQYHAKLKACDEDNCTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARD--SDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIPSKLITTLQI--VDQDKGPNGIVYCHLDPVCEG-SFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKS--AVLKYQI-DNYGAEYFEIDQNS---GLIR-CTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSL 2247
            I + E +    E+G + +    + P+ +   S+E     DF I  + G I   KL+D ET  ++Y L               +     + +S  I V + D ND+ P F+  E  + ISE    G  I    A D D   +  YRI+  + D    S ILDI    +I L VS +L  ++ K    ++ A D+     + ++    D+ ++ P F    +++ I E   IG  +  +KA D D G    I YSI      D    F ++  SG I +   L    R+ +   + A D  S P+N       + ++++D+ND+ P+    +   +  I E+IP    + LQ+  +D D GPNGIV   L+      S +L    +   +LR   K D E    I   +  +D+G PSL +   I + ++D+N+  PTF+  S  L  ++ ENS  G+ V T+ A+D D+   A + ++I     A+ F+I++++   G++R  T    D E  ++  F    + + +   +++V V+I V D NDN P     +   +  +N   ++ +G I A D DQ  NA + + L
Sbjct:  127 ITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSME--GSEDFIIDEDSGLIKTTKLLDRETT-ARYSL----------KVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIE--EADREVFS-ILDIGDQGAI-LSVSGELKRQDHK-VRVEISATDQGGLQGRCVVNVFIDDVNSAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSI------DSSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQ---IEVILDDINDNSPQF--TSSSYAATISEDIPVG-TSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDL--YIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFF--FELQASSGQLSSTVPVRIHVSDVNDNKPALKDFVILMNRFDNVQMARQIGFIPAFDPDQ--NATLEYFL 678          

HSP 5 Score: 66.2402 bits (160), Expect = 1.958e-10
Identity = 59/228 (25.88%), Postives = 109/228 (47.81%), Query Frame = 1
Query: 2086 VKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNS--WNGNTMQRHDNYFNVLPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQMLHSGTVI---LLFRASDYGQPA 2754
            V+ITV+D NDN+P+F+++    +I+EN     ++  + ATD D   N  + +S+ +S    G T+           TG +    ++D +   +  + I A D A   Q  L+S V +T+ V+D ND +PT       ++ + + +  G+ + ++ A D D G NG +++ +              +GS   FI++  +G +  +++L   T     L   A D G P+
Sbjct:    2 VEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTID--------YSTGEVTLRERIDAKNSPITAV-IRAKDGA---QPALSSTVPLTINVIDINDHAPTLIAA-QKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSM--------------EGSED-FIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPS 201          
BLAST of Protocadherin-9 vs. Ensembl Celegans
Match: cdh-1 (CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4W0])

HSP 1 Score: 144.436 bits (363), Expect = 2.911e-34
Identity = 160/613 (26.10%), Postives = 272/613 (44.37%), Query Frame = 1
Query:  802 VEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNSFILDISQLPSIFLKVSKKLDFEEKKQYHAKLKACDEDNCTTQNLI-IHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKP-------EIRIIADLSSLKIQEEIPSKLITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKI-IPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDK--SAVLKYQI-DNYGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNV-LPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQ-----LQATDRDVGANGKVRF 2586
            +++   +LD     P FE    ++ I E + IG  +    A +    +  RI+ Y L        +D     S  + + K  DFE++K Y   + A + ++ T+ +LI I +KD NDN PIF    Y+LT++E  +    +  V A+D DSG FG + Y I ++      S+F +  ++G +  +K L+   R R+   + A+D    + + S  ++ I V D +   P       EIR   D+        +P   I ++  + + K      Y       + +F +   +  IY     R  D +V    D +++      PS ES +  + I I D N+  P F   S  +   + E+ +       V+A D+DK  +  ++Y I  ++     EIDQ +G +  T +L+D E   +    V   D    P+++++ + I VLD NDN+P F  +     ++EN+ P  +VG++ A D D  EN  I + + N            YF +    G++ T   +DRE+     + I+A D    P+   +S  +  + VLD ND  P+        L+IT  + P    L      + A D D G NG V +
Sbjct:  524 LQVVADLLDTESKPPQFEKALWQVEIPEDTPIGTCLVKVVANNSQCGNSKRIR-YSLQNQDEHLTVDTM---SGTVCIQKTFDFEKQKSYQTTVIATNANSETSTSLISIRLKDVNDNWPIFYPNEYHLTVREGPKPEEPLLVVSASDMDSGTFGEVSYHILSE-----SSSFSINPVTGEVFAQKPLA---RGRFHLVVSAKDGGGQSSENS-ANIHITVIDKDTKTPQFSRSKYEIRTTEDI--------LPGIAIGSVGAMSKVK------YSIYSGDQDHNFSIDEDTGKIYV---TRYLDADVH---DTVLLNIQATLPSGESNQTQVVIFIEDHNDNPPQFS--SSLVEISIREDLKLHEPFYVVQASDKDKKKNGEVRYSIISSHPGSSIEIDQFTGQL-STGSLLDYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENSPPKTIVGKVVARDKDSLENGQIVYRITNG---------SEYFGIDEKLGNVYTKRSIDREVISHVDISIVAEDKGVPPR---SSTASARISVLDVNDNPPS-------CLSITPIVVPAGSPLSTAIGTIVAMDPDKGLNGSVLY 1081          

HSP 2 Score: 114.005 bits (284), Expect = 5.320e-25
Identity = 155/666 (23.27%), Postives = 281/666 (42.19%), Query Frame = 1
Query:  778 KEKEVVSSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEP--TNSFIL---DISQLPSIFLKVSKKLDFEEKKQYHAKLKACDEDNCTTQNLI---IHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARD-SDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIPSKLITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKSAVLKYQIDNYGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNV-LPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQMLHSGTVILLFRASDYG 2745
            K +E   +++I V++ D+ND+ P F     K+ ISEF+Q+G S +L + TD D   ++ +  + + +    N F L    +++     L V+ +LD E + +Y   ++A D         +   I I D NDN P+F    Y  ++  ++ IGS +  V+A D D G    I Y I+        S F + + SG I     L     S +   +VA D   P     ++ ++T+L   ++    +I  + + +S  + E      I     + Q      +       +C      Q     +Y L      D E   +     + +  G+  +E  ++  + I D+N+  P +     ++       ++ G++ +T K  D  ++  ++Y +     E   ID+ +G I   N  ID    S I F V   D  +   +  ++V   +LD     P F   L Q  I E+T     + ++ A ++    +  I +SL+N          D +  V   +G +      D E    Y   ++A+++        TS   I++R+ D ND  P + +P+   L + +  +P + LL + A+D D G  G+V + I+ +      SSSF+        +N  TG ++  + L  G   L+  A D G
Sbjct:   98 KVEESGETIDILVEVDDENDNAPSFADQVVKLEISEFAQLGTSFALPTVTDGD-GPKFDVHRFVILQGNVNNVFKLASRKVNEQLQADLVVNGQLDREFRDKYELLIEAQDGGKPAKIGQLRCSIEIIDANDNAPVFSRSRYTASVSANISIGSHLITVQATDADIGENSRISYDIKKT-SAPSNSNFAI-SQSGVITTTASL--LPASTHDVIVVASDHGSPSLSSSAVVTITVLGSTLSSPPLDIIWLVESNSAHLMENSTLGSIVARVSIAQQYRDTKLRLIGSSALCPQ----QTDQAHVYLLLLCGILDRETASEHHLKFLLEKDGQIIIEHPQL--LTIGDINDNAPQWHSSQIHI---SLNRTQGGSRTLTAKDPDLGQNGWIRYSV--LDTELVSIDKETGRIFVPNT-IDCNIGSEIKFRVRAEDGGSPALSTDLQVVADLLDTESKPPQFEKALWQVEIPEDTPIGTCLVKVVANNSQCGNSKRIRYSLQN---------QDEHLTVDTMSGTVCIQKTFDFEKQKSYQTTVIATNANSE-----TSTSLISIRLKDVNDNWPIF-YPNEYHLTVREGPKPEEPLLVVSASDMDSGTFGEVSYHILSE------SSSFS--------INPVTGEVFAQKPLARGRFHLVVSAKDGG 717          

HSP 3 Score: 86.2705 bits (212), Expect = 1.418e-16
Identity = 107/447 (23.94%), Postives = 206/447 (46.09%), Query Frame = 1
Query:  844 PIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNSFILDISQLPSIFLKVSKKLDFEEKKQYHAKLKACDEDNCTTQNLI----IHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKK----KLSTFTRSRYPFRIVARD-SDPINPKQSLCSVTILVEDVNDHKP-------EIRIIADLSSLKIQEEIPSKLITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIP--IIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKS--AVLKYQIDNYGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSP 2124
            P FE  E +  + E S+IG+ I   S  ++     YRIQ     +P  S I  I +   +F  V+  +D E++  +  +++  D +  T+Q +     + + DENDN P+F +  Y L++K+ +  G  IGQ+ A+D+DSG  G + Y I +  D +I +   +   +G I+L +    +L  F  + +   + ARD   P         V++ +   +   P       E+ ++ D S   + ++I +     ++        +G++Y   +   +G   +  ++ ++ +L++    D E E  I   +   D    S     ++P  I++  ++EF P F  KS Y L  +  ++  G  V  ++A D+D     V+KY I +  +   +I++++G+IR    L+ R  ++    TV    S T+    +V ++I   D   + P
Sbjct: 2129 PGFEKAEFRFEVMENSKIGLQIGNLSG-EESREFHYRIQ-----DPEASKIFSIDKFGRLF--VAGPIDREQRATHEFQVE-IDNEMMTSQKVQCKCHVIVLDENDNLPVFTSVAYYLSLKDSMAHGQKIGQIMASDQDSGENGRVSYRILSGNDLNIVT---LNPDTGSIQLNEWNDAQLDEFPNATWQILVEARDHGHPARAAVGKVQVSLKMSSWSGSAPFFVLPVYEVHVLEDTSVGTVLQKIRASNRLGMR-------NDGLLYSLKE--HQGKLGIDVKTGEL-TLKT--HLDWESEPIISMYLSVSDGNGRS----AVVPLKIVVEPVDEFAPVFT-KSSYTL-QIPISTPAGESVGQMQAIDEDGGVHGVVKYSISDRQST-VKIEEHTGIIRLQKPLVSRRNLTIEQITVVAYSSPTKQSKTTVYLEIGPFDVQPSLP 2544          

HSP 4 Score: 82.4185 bits (202), Expect = 2.290e-15
Identity = 92/411 (22.38%), Postives = 172/411 (41.85%), Query Frame = 1
Query: 1027 LKVSKKLDFEEKKQYHAKLKACDEDNCTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIPSKLITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFK---DKSQYLLGHVWENSEFGTKVMTVKAQDQDKSAVLKYQI-DNYGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSL 2247
            ++ + +LD E  ++Y  K+            + + + + NDN P F        + E++++GS +  V A D D+     ++Y + +D      + F ++  +G I L   L       +   I A D        +  ++TI V D+ND+ P        +++      P +    ++  D D    G +   L       F +   S  ++      K      ++    V   D G PS  +   + +II    E  PT K   +K+++    V ENS+ G ++  +  ++   S    Y+I D   ++ F ID+   L       IDRE+ ++  F V + +     +    +  + VLD NDN P+F++     S+ ++    Q +GQI A+D D  EN  +S+ +
Sbjct: 1882 IRTNLELDREILERYSLKVIGTGSGQQIGTRVDVRVNNLNDNVPSFPMSKPR-RVPENLRVGSYVATVGAKDVDN--LAPLRYFLVSDSSGQTPTHFNIDQFTGTIHLTAPLDFEVLPEHTLTIKATDGS----FDTFTNLTIFVSDINDNAPTFSKPLYQTTVSPATFSPGQPFAKIEAHDLDA--RGALTYSLGQGSSSIFRVAPESGALF-----MKVLPPAGERYLVTVTATDNGVPSFSTSVPVSVII---GEAEPTDKPGFEKAEFRF-EVMENSKIGLQIGNLSGEE---SREFHYRIQDPEASKIFSIDKFGRLFVA--GPIDREQRATHEFQVEIDNEMMTSQKVQCKCHVIVLDENDNLPVFTSVAYYLSLKDSMAHGQKIGQIMASDQDSGENGRVSYRI 2269          

HSP 5 Score: 79.337 bits (194), Expect = 2.066e-14
Identity = 129/525 (24.57%), Postives = 225/525 (42.86%), Query Frame = 1
Query:  922 ATDKDHSSQYRIQNYKLDEPTNSFILDISQLPSIFLKVSKKLDFEEKKQYHAKLKACD----EDNCTTQNLIIHIKDENDNQPIFETET-YNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLK------IQEEIP-SKLITTLQIVDQDKGPN--GIVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKSAVLKYQI--DNYGA--EYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENT-GPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLP-TGHIETLLKLDREICDLYILEIMASDSAK---SPQIPLTSIVN 2427
            AT     S++R Q        NS    IS LP         LD E  +++   +   D     D+CT +   + + D+NDN+P  +  T   L I E  ++G ++ + +A+D D G  G   + +  D    +      ET  G + L ++LS+    +   R+V      +  +++L        ++++  P+    A L  LK      I E +P  + I  LQ       P   G+ Y  ++   + +F + +       +R+  + D E+ ++    VI    G+  + +R  + + + +LN+  P+F          V EN   G+ V TV A+D D  A L+Y +  D+ G    +F IDQ +G I  T  L D E +   + T+   D   +  T    + I V D NDN+P FS  L Q ++   T  P Q   +I A D D      +++SL         Q   + F V P +G +   +K+     + Y++ + A+D+     S  +P++ I+ 
Sbjct: 1655 ATGMTEESRFRFQGNAPKFSINSTTGSISVLP---------LDREASQEHLLIIILTDGGSRNDSCTVR---VTVADQNDNKPQLDASTPSELEIAESSRVGDVLHRFRASDMDIGQNGKFSFELLEDSSGSLD--LVPET--GDLVL-RRLSSLQSWKIKLRVVDHGVPGLYVEKNL--------EISNRNPQTEAKAPLEFLKQTYLSTIDEGLPRGQFIAKLQ-------PELAGLTYSIVEGNIDSAFSVDSEG----VIRTNLELDREILERYSLKVIGTGSGQ-QIGTR--VDVRVNNLNDNVPSFPMSKPR---RVPENLRVGSYVATVGAKDVDNLAPLRYFLVSDSSGQTPTHFNIDQFTGTIHLTAPL-DFEVLPEHTLTIKATDGSFDTFT---NLTIFVSDINDNAPTFSKPLYQTTVSPATFSPGQPFAKIEAHDLDA--RGALTYSLG--------QGSSSIFRVAPESGAL--FMKVLPPAGERYLVTVTATDNGVPSFSTSVPVSVIIG 2121          

HSP 6 Score: 76.6406 bits (187), Expect = 1.308e-13
Identity = 121/445 (27.19%), Postives = 188/445 (42.25%), Query Frame = 1
Query: 1441 CSVTILVEDVNDHKPEIRIIADLSSLKIQEEIP-SKLITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLN---EFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKSAVLKYQIDNYGAE-YFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLP-TGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQMLHSGTVILL-FRASDYGQPA 2754
            C+V + V D ND+KP++   +  S L+I E      ++   +  D D G NG     L     GS +L   + D+     +R+       KI   V+  D G P L   K +   I++ N   E +   +   Q  L  + E    G  +    A+ Q + A L Y I     +  F +D + G+IR TN  +DRE +   S  V    S  +  T    V + V + NDN P F  + P+  + EN      V  + A D D    A + + L +  +G T      +FN+   TG I     LD E+   + L I A+D +        +  N+T+ V D ND +PT++ P         T  PG    +++A D D  A G + +             S  QGSS  F V   +GAL++  +  +G   L+   A+D G P+
Sbjct: 1711 CTVRVTVADQNDNKPQLD-ASTPSELEIAESSRVGDVLHRFRASDMDIGQNGKFSFELLEDSSGSLDLVPETGDLV----LRRLSSLQSWKIKLRVV--DHGVPGLYVEKNLE--ISNRNPQTEAKAPLEFLKQTYLSTIDEGLPRGQFI----AKLQPELAGLTYSIVEGNIDSAFSVD-SEGVIR-TNLELDREILERYSLKVIGTGSGQQIGT---RVDVRVNNLNDNVPSFPMSKPR-RVPENLRVGSYVATVGAKDVDN--LAPLRYFLVSDSSGQT----PTHFNIDQFTGTIHLTAPLDFEVLPEHTLTIKATDGS------FDTFTNLTIFVSDINDNAPTFSKPLYQTTVSPATFSPGQPFAKIEAHDLD--ARGALTY-------------SLGQGSSSIFRVAPESGALFMKVLPPAGERYLVTVTATDNGVPS 2109          

HSP 7 Score: 64.3142 bits (155), Expect = 6.706e-10
Identity = 145/667 (21.74%), Postives = 253/667 (37.93%), Query Frame = 1
Query:  862 ETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNSFILDISQLPSIFLKVS--KKLDFEEKKQYHAKLKACDEDNCTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIPSKLITTLQIVDQDKGPN---GIVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSL-ESRKIIPIIITDLNEFRPTFKDKSQYLLG------HVWENSEFGTKVMTVKAQDQDKSAVLKYQIDNY-------GAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLF-------STNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQMLHSGTVILLFRASDYGQPAKYSDHKLVIN 2784
            E  I IS+ + IG  I        D S  YR  + +      S  L++ Q   +       ++ D      +  K    D  +     + + I     ++P F+T    + I+ED   GSII  V A   D      I Y      D      F ++  +G I L   L       Y   + A  S P     +   VT+ V+DVNDH P   I++  + L         ++  +  +D DK P     + Y   + V +  F++  +S +I+ + S             +  +    G   L E+  I    + DL +F     D+ + LL         W   +   K +T+ +     S +L+ +            + +FE+  +  + +  +     +R     FT+ V   D E   +++++ +         P+F       ST+    +I EN G      +I AT   ++         R  + GN  +     F++  T    ++L LDRE    ++L I+ +D              + + V D+ND  P       + L I ++ R GD L + +A+D D+G NGK  FE++     ED S S +        +   TG L + ++    +  +  R  D+G P  Y +  L I+
Sbjct: 1236 EETIRISDSNSIGTKIGRLGEKSADGSFFYRFSSEE------SCPLELDQTGGLLYLADGLRRGDTHNFSCFFEKFNTTD-GSAEEMRVDLEISRTKSDKPRFDTGHLRVNIREDTPTGSIITTVNATVSDDSA-SPISYRFPLLIDN-----FSIDQFTGDITLIDTLHWHVTPTYNLIVEAFTSGP----GTTLLVTVNVDDVNDHTP--FIVSQPTVLLPSSYRKGGMVHRVVAIDLDKDPEIRYSLKYAGSE-VAKEFFKIDEKSGEIFVVES-------------SSALSTSFGGAGLPETLTIRATDLQDLTKF-----DEQKVLLKASNASRSTWHFFDEQHKDVTILSTSPQGSQILQLKFQEGVDLQLIPSSPHFELKSSKIVQKSASVATGTQR-----FTI-VAQKDDELDYSTLKIHV--------EPVFTEPPKISSTSCGVVTIEENVGIEDF-KRILATGMTEES--------RFRFQGNAPK-----FSINSTTGSISVLPLDREASQEHLLIIILTDGGSR-----NDSCTVRVTVADQNDNKPQLDASTPSELEIAESSRVGDVLHRFRASDMDIGQNGKFSFELL-----EDSSGSLD--------LVPETGDLVLRRLSSLQSWKIKLRVVDHGVPGLYVEKNLEIS 1818          

HSP 8 Score: 60.077 bits (144), Expect = 1.300e-8
Identity = 140/665 (21.05%), Postives = 267/665 (40.15%), Query Frame = 1
Query:  649 FIVTEEGKILVRKLIDLETLCSQYKLCCGEPVCILKANILLNNKEKEVVSSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYR---IQNYKLDEPTNSFILDISQLPSIFLKVSKKLDFEEKKQYHAKLKACDEDNCTTQNLIIHIKDENDNQPIFETETYNLTIK-EDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIPSKLITTLQIVD-QDKGPNGIVYCHLDPVCEGSFELQNRSKDIYS--LRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQD--KSAVLKYQI-DNYGAEYFEIDQNSGLIRC---TNNLIDRERVSSISFTVHVMDSDTEPKTA--SVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNV-LPTGHIETLLKLDREICDLYILEIMASDS-AKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQLQATDRDVGANGKVRFEI 2592
            F V  EG I     +D E L  +Y L            ++     +++ + V+++V  L  ND+ P F   + + V  E  ++G  ++   A D D+ +  R   + +     PT+    +I Q     + ++  LDFE   ++   +KA D    T  NL I + D NDN P F    Y  T+       G    +++A+D D+   G + YS+         S F V   SG + +  K+      RY   + A D+   +   S+    I+ E     KP           + + E+       LQI +   +      Y   DP     F +    +   +  +   ++  HE + +ID  ++   + +          +I+ D N+  P F   + YL   + ++   G K+  + A DQD  ++  + Y+I          ++ ++G I+     +  +D    ++    V   D     + A   V+V + +   + ++P F   + +  ++E+T    ++ +I A++            +RN     +++ H     + + TG +     LD E   +  + +  SD   +S  +PL     I +  +DE   +P +T   +  L I  +   G+ + Q+QA D D G +G V++ I
Sbjct: 1874 FSVDSEGVIRTNLELDREIL-ERYSL-----------KVIGTGSGQQIGTRVDVRVNNL--NDNVPSFPMSKPRRV-PENLRVGSYVATVGAKDVDNLAPLRYFLVSDSSGQTPTH---FNIDQFTGT-IHLTAPLDFEVLPEHTLTIKATDGSFDTFTNLTIFVSDINDNAPTFSKPLYQTTVSPATFSPGQPFAKIEAHDLDAR--GALTYSL----GQGSSSIFRVAPESGALFM--KVLPPAGERYLVTVTATDNGVPSFSTSVPVSVIIGEAEPTDKP------GFEKAEFRFEVMENSKIGLQIGNLSGEESREFHYRIQDPEASKIFSIDKFGRLFVAGPIDREQRATHEFQVEIDNEMMTSQKVQCKCH------VIVLDENDNLPVFTSVAYYL--SLKDSMAHGQKIGQIMASDQDSGENGRVSYRILSGNDLNIVTLNPDTGSIQLNEWNDAQLDEFPNATWQILVEARDHGHPARAAVGKVQVSLKMSSWSGSAPFFVLPVYEVHVLEDTSVGTVLQKIRASN---------RLGMRNDGLLYSLKEHQGKLGIDVKTGELTLKTHLDWESEPIISMYLSVSDGNGRSAVVPL----KIVVEPVDEF--APVFTK-SSYTLQIPISTPAGESVGQMQAIDEDGGVHGVVKYSI 2481          

HSP 9 Score: 60.077 bits (144), Expect = 1.552e-8
Identity = 144/692 (20.81%), Postives = 269/692 (38.87%), Query Frame = 1
Query:  799 SVEIQVQILDKNDHNPIFE--TPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNSFILDISQLPSIFLKVSKKLDFEEKKQYHAKLKACDEDN---CTTQNLIIHIKD--ENDNQPI-FETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIPSKL-----ITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEF--GTKVMTVKAQDQDKSAVLKYQIDNYGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDAN-DNSPLFSTNLPQFSIIENTGPSQLVGQINATDAD------QDENALISFSLRNSWNGNTMQRHDNYFNVLPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQM-------LHSGTVILLFRASDYGQPAKYSDHKLVINI 2787
            S  ++V + D+ND+ P  +  TP +++ I+E S++G  +    A+D D     +     L++ + S  L + +   + L+    L     + +  KL+  D         +NL I  ++       P+ F  +TY  TI E +  G  I +++           + YSI    + +I S F V++  G I+   +L      RY  +++   S     +Q    V + V ++ND+ P          +     +P  L     + T+   D D       +   D   +      N  +   ++      D EV  +    +   D    S ++   + I ++D+N+  PTF   S+ L       + F  G     ++A D D    L Y +    +  F +   SG +         ER      TV   D+     + SV V + + +A   + P F     +F ++EN+     +G ++  ++       QD  A   FS+            D +  +   G I+   +   E       E+M S   +             + VLDEND  P +T      L++ D+M  G  + Q+ A+D+D G NG+V + I+         +  N        +N  TG++ +++          + T  +L  A D+G PA+ +  K+ +++
Sbjct: 1710 SCTVRVTVADQNDNKPQLDASTP-SELEIAESSRVGDVLHRFRASDMDIGQNGKFSFELLEDSSGSLDL-VPETGDLVLRRLSSL-----QSWKIKLRVVDHGVPGLYVEKNLEISNRNPQTEAKAPLEFLKQTYLSTIDEGLPRGQFIAKLQPE------LAGLTYSI---VEGNIDSAFSVDS-EGVIRTNLELDREILERYSLKVIGTGSG----QQIGTRVDVRVNNLNDNVPSF-------PMSKPRRVPENLRVGSYVATVGAKDVDNLAPLRYFLVSDSSGQTPTHF-NIDQFTGTIHLTAPLDFEVLPEHTLTIKATDG---SFDTFTNLTIFVSDINDNAPTF---SKPLYQTTVSPATFSPGQPFAKIEAHDLDARGALTYSLGQGSSSIFRVAPESGALFMKVLPPAGERYL---VTVTATDNGVPSFSTSVPVSVIIGEAEPTDKPGFEKAEFRFEVMENSKIGLQIGNLSGEESREFHYRIQDPEASKIFSI------------DKFGRLFVAGPIDREQRATHEFQVEIDNEMMTSQKVQ---------CKCHVIVLDENDNLPVFTSV-AYYLSLKDSMAHGQKIGQIMASDQDSGENGRVSYRILS-------GNDLN-----IVTLNPDTGSIQLNEWNDAQLDEFPNATWQILVEARDHGHPARAAVGKVQVSL 2329          

HSP 10 Score: 59.6918 bits (143), Expect = 2.031e-8
Identity = 107/502 (21.31%), Postives = 214/502 (42.63%), Query Frame = 1
Query:  820 ILDKNDHNPIFETP--ETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNSFILDISQLPSIFLKVSKKLDFEEKKQYHAKLKACDED----NCTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIPSKLITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDA----IVICKDQGEPSLES--RKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQ--DKSAVLKYQIDNYGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRH 2283
            + D ND+ P F  P  +T +  + FS  G   +   A D D         Y L + ++S      +  ++F+KV         ++Y   + A D      + +    +I  + E  ++P FE   +   + E+ +IG  IG +   +          Y I+   D +    F ++   GR+ +   +    R+ + F+ V  D++ +  ++  C   ++V D ND+ P    +A   SLK       K I  +   DQD G NG V   +  +      +   + D  S++     D ++++  +A    +V  +D G P+  +  +  + + ++  +   P F      +  HV E++  GT +  ++A ++   ++  L Y +  +  +   ID  +G +    +L D E    IS  + V  SD   ++A V +KI V   ++ +P+F+ +     I  +T   + VGQ+ A D D   + ++ +S+ +  +   ++ H
Sbjct: 2019 VSDINDNAPTFSKPLYQTTVSPATFSP-GQPFAKIEAHDLDARGAL---TYSLGQGSSSIFRVAPESGALFMKVLPP----AGERYLVTVTATDNGVPSFSTSVPVSVIIGEAEPTDKPGFEKAEFRFEVMENSKIGLQIGNLSGEESRE-----FHYRIQ---DPEASKIFSIDKF-GRLFVAGPIDREQRATHEFQ-VEIDNEMMTSQKVQCKCHVIVLDENDNLPVFTSVAYYLSLKDSMAHGQK-IGQIMASDQDSGENGRVSYRI--LSGNDLNIVTLNPDTGSIQLNEWNDAQLDEFPNATWQILVEARDHGHPARAAVGKVQVSLKMSSWSGSAPFFVLPVYEV--HVLEDTSVGTVLQKIRASNRLGMRNDGLLYSLKEHQGK-LGIDVKTGELTLKTHL-DWESEPIISMYLSV--SDGNGRSAVVPLKIVVEPVDEFAPVFTKSSYTLQIPISTPAGESVGQMQAIDEDGGVHGVVKYSISDRQSTVKIEEH 2493          

HSP 11 Score: 57.3806 bits (137), Expect = 8.942e-8
Identity = 61/276 (22.10%), Postives = 120/276 (43.48%), Query Frame = 1
Query: 1633 FELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQD-------KSAVLKYQIDN-YGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITL 2436
             ++  RS +I    ++   D+E   K D + +  ++   +++    I + + D N+  P+F D+   L   + E ++ GT        D D       +  +L+  ++N +     ++++        N  +DRE        +   D     K   +   I ++DANDN+P+FS +    S+  N      +  + ATDAD  EN+ IS+ ++      T    ++ F +  +G I T   L       + + ++ASD   SP +  +++V IT+
Sbjct:   69 LKVDERSGEI---STIAHLDYEKRSKFDIVAVKVEESGETID----ILVEVDDENDNAPSFADQVVKL--EISEFAQLGTSFALPTVTDGDGPKFDVHRFVILQGNVNNVFKLASRKVNEQLQADLVVNGQLDREFRDKYELLIEAQDGGKPAKIGQLRCSIEIIDANDNAPVFSRSRYTASVSANISIGSHLITVQATDADIGENSRISYDIK-----KTSAPSNSNFAISQSGVITTTASL--LPASTHDVIVVASDHG-SPSLSSSAVVTITV 327          

HSP 12 Score: 54.299 bits (129), Expect = 8.120e-7
Identity = 49/198 (24.75%), Postives = 88/198 (44.44%), Query Frame = 1
Query:  784 KEVVSSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQN----YKLDEPTNSFILDISQLPSIFLKVSKKLDFEEKKQYHAKLKACDEDN-CTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKL 1362
            +  V  V++ +++   +   P F  P  ++ + E + +G  +    A     S++  ++N    Y L E      +D+       L +   LD+E +      L   D +       L I ++  ++  P+F   +Y L I      G  +GQ++A D D G+ G +KYSI     +D QST  +E  +G I+L+K L
Sbjct: 2319 RAAVGKVQVSLKMSSWSGSAPFFVLPVYEVHVLEDTSVGTVLQKIRA-----SNRLGMRNDGLLYSLKEHQGKLGIDVKTGE---LTLKTHLDWESEPIISMYLSVSDGNGRSAVVPLKIVVEPVDEFAPVFTKSSYTLQIPISTPAGESVGQMQAIDEDGGVHGVVKYSI-----SDRQSTVKIEEHTGIIRLQKPL 2503          
BLAST of Protocadherin-9 vs. Ensembl Celegans
Match: cdh-4 (Cadherin-4 [Source:UniProtKB/TrEMBL;Acc:A0A1C3NSI5])

HSP 1 Score: 142.51 bits (358), Expect = 1.414e-33
Identity = 178/675 (26.37%), Postives = 323/675 (47.85%), Query Frame = 1
Query:  829 KNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSS----QYRIQN--------YKLDEPTNSFIL--DISQLPSIFLKVSKKLDFEEKKQYHAKLKACDEDNCTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIP-SKLITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDL--NEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQD-----KSAVLKYQ-IDNYGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDT----EPKTASV-EVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNV-LPTGHIET--LLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQMLHSG-TVILLFRASDYGQPAK 2757
            +N H+P+F +    + ++E + IG  ++   A D+D       +Y I +          +DE +    +  D+S+L      + +KL+  + +   + + A      + + + + IKD N++ P F+  +Y L I E+ + G  I +V AND D G  G IK+S+    + +  S   ++  +G +KL K L    +  + F I+A D +    + S+ ++TI VEDVND+ P  + +   S  +I E++P    ++ +   D+D G N  +   L+   +  F + + S  I+        D+      +  +   D G+P L +   + + + D+  N     F D ++     V+ENSE GT+V+ ++A++       K+  L+Y+ I   G  +F IDQ  G +R T +L+DRE  S+   TV   DS T    +P+   V  V I +LD ND+ P+    +   S+ EN+  + ++ ++ ATDAD  +N   +  +     G+      ++F + L +G+I T  + +LDRE    + L +   D  + PQ  L S V + + VLDEND SPT+T     I + +   +    L ++ A D D G N ++ + I              +G +++ I N+  G +  S+ +H   +  L  +A+D+G P +
Sbjct:  601 ENKHSPVFSSFPEIVEVTEDAPIGTVVAKLQANDEDTGYNGFIRYVIHDIAGSSHEVLTVDEQSGEITVASDLSKL------MKEKLEVLDVQLKVSAIDAGTPVKSSVKTMKLRIKDVNNHSPQFDEVSYYLRISENEKPGKDIFKVTANDFDGGNNGKIKFSLGN--NQEKSSVISIDAKTGIVKLLKSLDREDQDVHTFAIIASD-EGFPMRVSVTNLTISVEDVNDNPP--KCVVQHSRARIPEDLPHGAFVSCMAAFDEDIGQNSKLKFLLNSE-KVPFRIDHHSGCIFIHAPEYPLDYHKTPFFNLSIEVADHGDPILSTSCHLHVELVDIAHNHLAIEFDDVAKE--ASVYENSEIGTEVIMIEAKETGDEQKVKAENLEYRIIGGDGWPHFSIDQK-GTVRTT-HLLDRETKSAYWITVEARDSKTDLYKDPRRRDVLHVFIRILDRNDHRPVAKKPMYIASVAENSPANVVIVKVEATDADDVDNDAAAPLMFKIERGDPQ----SFFRIDLTSGYITTSGIRRLDREKQSEHELWVSICDGGE-PQ--LCSNVIVIVNVLDENDNSPTFTQA---IHHYSVRSKFAGKLCRIFAVDADEGENARLTYNI-------------TEGDARFSIDNN--GNIIASEAIHGDESYALTVQATDHGTPGQ 1234          

HSP 2 Score: 101.679 bits (252), Expect = 3.616e-21
Identity = 147/609 (24.14%), Postives = 261/609 (42.86%), Query Frame = 1
Query:  964 YKL-DEPTNSFILDISQLPSIFLKVSKKLDFEEKKQ--YHAKLKACDEDNCTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGS----IIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQE-EIPSKLITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKS--AVLKYQIDNYGAEY-------FEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLPTGHIETLLKLDREICDLYILEIMASD-SAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQLQATDRDV-GANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALW----ISQMLHSGTVIL 2721
            +KL D   N F+++      + +K S ++D+E+ +Q  +H +L   D      + + + I++ NDN+P    +   ++I E++         I ++ A D D   F  IK+ +  DF       F ++ ++G + + K L +     +   +VA D +     +   ++ + V D ND+ P         S+K+ E E     +   +    D+  N  +  +L P    SF   N    I +L   +  D E    +   V+ KD G P LE+   + I + D N+  P F +K +Y+ G V ENS+ G KV+TVKA D D      + Y+++             F I+ N  ++   +  ID E++   +  V   D    P  +   ++I V D ND++P F        + E       + + + +D D  +N    F++    +G         F V     + T  KL+    D Y+L ++A D   K+   PLT  +  T R       +PT   P    +N      P   + +L+A+D D    NG +RF +++   +   +      S+  F V+ +TG +W    I+Q LH+  V +
Sbjct: 2944 FKLSDNDGNVFVVNFRN-GIVKVKESDQIDYEKNQQLEFH-RLTIQDNSEVCKELITVVIENLNDNRPKIIEKLLKVSIDENLPTSEDARQYITRIVAEDAD---FDEIKFRMVDDFG----GLFQIDDINGVVTVVKPLDSEILGFFNLTVVASDGE----FEDKATILVTVIDQNDNAPTFE--KSTYSMKVMESESIGYELAHFRASGGDQ--NETIEYYLKPSDVTSFVNLNAQTGILTL--AKPLDFETLSALKLTVVAKDSGVPPLETEAQVEISVMDENDNAPKF-EKEKYV-GKVKENSKSGEKVLTVKALDVDSEHFGAVSYELEIVSETTTDTPVLPFAINSNGDVL--ISQSIDYEKIKKYNLKVIAKDGGRPPLRSEALLEIHVEDENDHAPTFDDCNMTALVQEGEAIGHRLLKFSVSDLDGPKNGA-PFTVEIQGDGA------KSFKVNEKLELLTAKKLEYRKKDKYLLTVIAKDVKGKTTDCPLTIFIRQTSR------HAPTM-KPMKIQINTLQNELPEGIIGRLKASDEDEEDQNGLLRFGLVEGSIQSPRAQVQESRSTHLFRVDPNTGDIWSDHSITQGLHTFNVTV 3515          

HSP 3 Score: 100.908 bits (250), Expect = 5.797e-21
Identity = 149/608 (24.51%), Postives = 263/608 (43.26%), Query Frame = 1
Query:  787 EVVSSVEIQVQILDKNDHNPIFETP---ETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNSFILDISQLPS--IFLKVSKKLDFEEKKQYHAKLKACDE----DNCTTQNL---------------IIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYP-----FRIVARDSD-PINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQE-EIPSKLITTLQIVDQDKGPNGIVYCHLDPVCEGS--FELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQD--KSAVLKYQIDNYGAEYFEIDQNSG--LIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDN--SPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLPTGHIETLLKLDREICDLYILEIMASDSA----KSPQIPLTSIVNITLRVLDENDESPTWTHP 2481
            E ++  ++ ++ILD NDH P+F      +T IVI +   + + +    ATD+D     +I  YK    T+   L+I+        ++V KK        + A + A D        +  NL               II  + EN + P+F +    + + ED  IG+++ +++AND D+G  G I+Y I  D          V+  SG I +   LS   + +        ++ A D+  P+  K S+ ++ + ++DVN+H P+   ++    L+I E E P K I  +   D D G NG +   L    E S    +  ++  +  L+S+ + D +V       +I  D+G P   S   + I + D+N+  P  K   Q+    + E+   G  V  + A D+D  +++ LK+ +++     F ID +SG   I      +D  +    + ++ V D      + S  + + ++D   N  +  F     + S+ EN+     V  I A +   DE  + + +L     G     H   F++   G + T   LDRE    Y + + A DS     K P+     ++++ +R+LD ND  P    P
Sbjct:  471 EKLAEKDVSIEILDSNDHAPVFSAKWMRQTPIVIGKPGDVLVKVD---ATDQDEGENGKIV-YKF---TSELPLEINANTGEITLVEVPKK-----GNSWPATVWAIDLGLPLSRMSALNLMFYKNGTKIPAKPKPIIIQESENKHSPVFSSFPEIVEVTEDAPIGTVVAKLQANDEDTGYNGFIRYVIH-DIAGSSHEVLTVDEQSGEITVASDLSKLMKEKLEVLDVQLKVSAIDAGTPV--KSSVKTMKLRIKDVNNHSPQFDEVS--YYLRISENEKPGKDIFKVTANDFDGGNNGKIKFSLGNNQEKSSVISIDAKTGIVKLLKSLDREDQDVHT---FAIIASDEGFPMRVSVTNLTISVEDVNDNPP--KCVVQHSRARIPEDLPHGAFVSCMAAFDEDIGQNSKLKFLLNSEKVP-FRIDHHSGCIFIHAPEYPLDYHKTPFFNLSIEVADHGDPILSTSCHLHVELVDIAHNHLAIEFDDVAKEASVYENSEIGTEVIMIEAKETG-DEQKVKAENLEYRIIGGDGWPH---FSIDQKGTVRTTHLLDRETKSAYWITVEARDSKTDLYKDPR--RRDVLHVFIRILDRNDHRPVAKKP 1049          

HSP 4 Score: 97.0561 bits (240), Expect = 8.811e-20
Identity = 126/506 (24.90%), Postives = 220/506 (43.48%), Query Frame = 1
Query: 1159 IFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQST---FYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIPSKLITTLQIVDQDKGPNG-IVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEP--SLESRKII-------------PIIITDL-NEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKS--AVLKYQIDNYGA---EYFEIDQNSGLIRCTNNLI----DRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPL-TSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQLQATDRDVGANGKVRF 2586
              + E   L   E   IG I+ ++  N  +      I+YS+     +D+ +    F + + +G +++  K++   R  Y F+++A     IN K +   V+I + D NDH P +     +    I    P  ++  +   DQD+G NG IVY       E   E+   + +I  +   +K +        A V   D G P   + +  ++             PIII +  N+  P F    + +   V E++  GT V  ++A D+D      ++Y I +      E   +D+ SG I   ++L     ++  V  +   V  +D+ T  K++   +K+ + D N++SP F        I EN  P + + ++ A D D   N  I FSL N+   +++   D       TG ++ L  LDRE  D++   I+ASD       P+  S+ N+T+ V D ND  P      ++   I + +  G  +  + A D D+G N K++F
Sbjct:  382 FLDNEKLTLKTDEMAPIGRILYRMNVNVENPDDVSLIRYSLEYS-KSDLPNATLPFAIGSKNGILRVSAKINRSERV-YNFKVIA-SLHGINEKLAEKDVSIEILDSNDHAP-VFSAKWMRQTPIVIGKPGDVLVKVDATDQDEGENGKIVYKF---TSELPLEINANTGEITLVEVPKKGN-----SWPATVWAIDLGLPLSRMSALNLMFYKNGTKIPAKPKPIIIQESENKHSPVFSSFPEIV--EVTEDAPIGTVVAKLQANDEDTGYNGFIRYVIHDIAGSSHEVLTVDEQSGEITVASDLSKLMKEKLEVLDVQLKVSAIDAGTPVKSSVKTMKLRIKDVNNHSPQFDEVSYYLRISENEKPGKDIFKVTANDFDGGNNGKIKFSLGNNQEKSSVISID-----AKTGIVKLLKSLDREDQDVHTFAIIASDEG----FPMRVSVTNLTISVEDVNDNPPKCV-VQHSRARIPEDLPHGAFVSCMAAFDEDIGQNSKLKF 863          

HSP 5 Score: 96.2857 bits (238), Expect = 1.485e-19
Identity = 137/542 (25.28%), Postives = 243/542 (44.83%), Query Frame = 1
Query: 1054 EEKKQYHAKLKACDEDNCTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFG---TIKYSIRTDFDTDIQSTFYVETLSGRIKLKK--KLSTFTRSRYPF-RIVARDSDPINPKQSLCS--VTILVEDVNDHKPEIRIIADLSSLKIQEEIPS-----KLITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNRSKDIYSLRSVRK-FDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKSAVLKYQIDNYGAEYF-EIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQLQATDRDVGANGK-VRFEIIKQYRKEDGSSSF 2631
            E K QY  K+ A D    T+  + I++K   D+          + + E+ + G+++        +S L G   T K S   D D ++   F V   +G +K+K+  ++      +  F R+  +D+  +      C   +T+++E++ND++P  +II  L  + I E +P+     + IT  +IV +D   + I +  +D    G F++     DI  + +V K  D E+    +  V+  D GE   E +  I + + D N+  PTF +KS Y +  V E+   G ++   +A   D++  ++Y +       F  ++  +G++     L D E +S++  TV   DS   P     +V+I+V+D NDN+P F        + EN+   + V  + A D D +    +S+ L    +  T       F +   G +     +D E    Y L+++A D  +    PL S   + + V DEND +PT+   +   L + +    G  LL+   +D D   NG     EI     + DG+ SF
Sbjct: 2876 ENKMQYQLKVTAFDGVFETSTKVKINLKSSKDSDIRCPEANKTVILAENSKKGTVVLG------ESSLLGPNVTFKLS---DNDGNV---FVVNFRNGIVKVKESDQIDYEKNQQLEFHRLTIQDNSEV------CKELITVVIENLNDNRP--KIIEKLLKVSIDENLPTSEDARQYIT--RIVAEDADFDEIKFRMVDDFG-GLFQID----DINGVVTVVKPLDSEILGFFNLTVVASD-GE--FEDKATILVTVIDQNDNAPTF-EKSTYSM-KVMESESIGYELAHFRASGGDQNETIEYYLKPSDVTSFVNLNAQTGILTLAKPL-DFETLSALKLTVVAKDSGVPPLETEAQVEISVMDENDNAPKFEKEKYVGKVKENSKSGEKVLTVKALDVDSEHFGAVSYELE-IVSETTTDTPVLPFAINSNGDVLISQSIDYEKIKKYNLKVIAKDGGRP---PLRSEALLEIHVEDENDHAPTFDDCNMTAL-VQEGEAIGHRLLKFSVSDLDGPKNGAPFTVEI-----QGDGAKSF 3374          

HSP 6 Score: 87.0409 bits (214), Expect = 9.412e-17
Identity = 129/588 (21.94%), Postives = 254/588 (43.20%), Query Frame = 1
Query:  871 IVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNSFILDISQLPSIFLKVSKKLDFEEKKQYHAKLKACDEDNCTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQE-EIPSKLITTLQIVDQDKGPNGIV-YCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICK--DQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKSAVLKYQIDNYGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIEN--TGPSQLVGQ-----INATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQ 2601
            I IS+  Q+G+++    A+D D    +    + +       + D+ Q     L ++KK++  ++ +    +   D        +II +  +   +P F    Y   + E V +G+ I  +KA+    G    + +++ +  D  ++    VE  SG + + + L      R    +  + ++     +S  + ++ + D ND+ P    +   +   + E +    ++ T+   D+D+G NGIV Y  +    E  F++  +S ++   R  +  D E+ Q +++I+  +  D    SL+    + + I + NE   T K   +     +++++  GT V+ + A        + Y+++     +FE+   SG +     L   +   S+  T  V  ++ +   A V  KI  +  N +SP+F   + + +I EN  TG S L        ++A D D   N L+ + +  S     M   D Y     +G I T +  D E    Y   + A D  + P+  L   + I + V+DENDE P +  P N+ L+I+  +   + +     T +D+ + G +R+ I  Q
Sbjct: 1271 IPISDADQVGLTVGKLEASDADGDELW----WSISSGDPDSVFDVRQDTGQLL-LAKKVELLKRGELRLNISVTDGQAWDHSTVIIQVSRQISQRPKFSASHYQTDVSERVAVGTQIYTLKASGESLGT-KPLVFNLFSVDDVAMEDKIRVEPSSGNVIVMEPLDYEAARRIRAVVQVQQAN----MKSFATFSVNINDENDNSP--YFVGHTAFAFVDESDTVDDVLATVTAFDKDRGENGIVTYSIVSGNEESLFKIDAKSGEV---RLAKPLDPEL-QHVESILRIRAIDSAANSLKDE--MSLHIRNSNEAPETAKFDRKVYQTTLYDSTRPGTPVLVLNALHH---GTVSYKLEP-NCTFFEVHTLSGAVHLATWLTKLKHRKSVECTAIVESTEGQQDIAKVIAKI--IRTNQHSPIFRRQVYRGTIRENMPTGSSVLSKSLLPLVVSAIDEDPGSNGLVGYRML-SPKDEQMFSVDQY-----SGAIRTQMSFDFEKMKEYSFYVQAFDMGQPPRRSLMPSL-IVVTVIDENDEPPRF--PSNS-LDISMILPTANGVSVGGQTAQDMDSVGSLRYFIKDQ 1824          

HSP 7 Score: 85.5001 bits (210), Expect = 2.719e-16
Identity = 131/541 (24.21%), Postives = 230/541 (42.51%), Query Frame = 1
Query:  637 ESDFFIVTEEGKILVRKLIDLETLCSQYKLCCGEPVCILKANILLNNKEKEVVSSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQN-YKLDEPTNSFILDISQLPSIFLKVSKKLDFEEKKQYHAKLKACDEDNCTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLS-TFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEI-PSKLITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMT-------VKAQDQD--KSAVLKYQIDNYGAE-YFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVE--VKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDAD 2214
            +S F +  + G++L+ K ++L        L  GE    L+ NI + + +    S+V IQV    +    P F     +  +SE   +G  I    A+ +   ++  + N + +D+      + + +  S  + V + LD+E  ++  A ++    +  +     ++I DENDN P F   T    + E   +  ++  V A D+D G  G + YSI +  +   +S F ++  SG ++L K L           RI A DS   + K  +   ++ + + N+     +    +    + +   P   +  L  +      +G V   L+P C   FE+   S  ++    + K  H    +  AIV   +  E   +  K+I  II   N+  P F  + Q   G + EN   G+ V++       V A D+D   + ++ Y++ +   E  F +DQ SG IR T    D E++   SF V   D    P+ + +   + +TV+D ND  P F +N    S+I  T     VG   A D D
Sbjct: 1306 DSVFDVRQDTGQLLLAKKVEL--------LKRGE----LRLNISVTDGQAWDHSTVIIQVS--RQISQRPKFSASHYQTDVSERVAVGTQIYTLKASGESLGTKPLVFNLFSVDDVAMEDKIRV-EPSSGNVIVMEPLDYEAARRIRAVVQVQQANMKSFATFSVNINDENDNSPYFVGHTAFAFVDESDTVDDVLATVTAFDKDRGENGIVTYSIVSGNE---ESLFKIDAKSGEVRLAKPLDPELQHVESILRIRAIDSAANSLKDEM---SLHIRNSNEAPETAKFDRKVYQTTLYDSTRPGTPVLVLNALH-----HGTVSYKLEPNCT-FFEVHTLSGAVHLATWLTKLKHRKSVECTAIV---ESTEGQQDIAKVIAKIIR-TNQHSPIF--RRQVYRGTIRENMPTGSSVLSKSLLPLVVSAIDEDPGSNGLVGYRMLSPKDEQMFSVDQYSGAIR-TQMSFDFEKMKEYSFYVQAFDMGQPPRRSLMPSLIVVTVIDENDEPPRFPSNSLDISMILPTANGVSVGGQTAQDMD 1812          

HSP 8 Score: 83.5741 bits (205), Expect = 1.217e-15
Identity = 152/624 (24.36%), Postives = 266/624 (42.63%), Query Frame = 1
Query:  790 VVSSVE-IQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNSFILDISQLPSIFLKVSKKLDFEEKKQYHAKLKACDED---NCTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFR----IVARDSDPINPKQSLCSVTI-LVEDVNDHKP-EIRIIADLSSLKIQEEIPSK--LITTLQIVDQDK-GPNGIVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQ-----GEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKSAV-----LKYQIDNYGAE-YFEIDQNSGLIRCTN-NLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQ---INATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPD------NNILNITDTMRPGDHLLQLQATDRD 2559
            V SSV+ ++++I D N+H+P F+     + ISE  + G  I   +A D D  +  +I+    +    S ++ I     I +K+ K LD E++  +   + A DE      +  NL I ++D NDN P    +     I ED+  G+ +  + A D D G    +K+ + ++     +  F ++  SG I +          + PF      VA   DPI    + C + + LV+  ++H   E   +A  +S+    EI ++  +I   +  D+ K     + Y  +       F +  +     ++R+    D E +      V  +D       +P       + I I D N+ RP  K K  Y +  V ENS     ++ V+A D D         L ++I+    + +F ID  SG I  +    +DRE+ S     V + D       ++V V + VLD NDNSP F+  +  +S+      S+  G+   I A DAD+ ENA +++   N   G+     DN  N++ +  I           + Y L + A+D     Q    + V +T     +       + P+      + ++ I+D  + G  + +L+A+D D
Sbjct:  699 VKSSVKTMKLRIKDVNNHSPQFDEVSYYLRISENEKPGKDIFKVTANDFDGGNNGKIKFSLGNNQEKSSVISIDAKTGI-VKLLKSLDREDQDVHTFAIIASDEGFPMRVSVTNLTISVEDVNDNPPKCVVQHSRARIPEDLPHGAFVSCMAAFDEDIGQNSKLKFLLNSE-----KVPFRIDHHSGCIFIHAPEYPLDYHKTPFFNLSIEVADHGDPI--LSTSCHLHVELVDIAHNHLAIEFDDVAKEASVYENSEIGTEVIMIEAKETGDEQKVKAENLEYRIIGGDGWPHFSIDQKG----TVRTTHLLDRETKSAYWITVEARDSKTDLYKDPRRRDVLHVFIRILDRNDHRPVAK-KPMY-IASVAENSPANVVIVKVEATDADDVDNDAAAPLMFKIERGDPQSFFRIDLTSGYITTSGIRRLDREKQSEHELWVSICDGGEPQLCSNVIVIVNVLDENDNSPTFTQAIHHYSV-----RSKFAGKLCRIFAVDADEGENARLTY---NITEGDARFSIDNNGNIIASEAIHG--------DESYALTVQATDHGTPGQQFAATRVVLTANSAGQKPRKSKNSPPEISGKKSDYVIPISDADQVGLTVGKLEASDAD 1292          

HSP 9 Score: 80.8777 bits (198), Expect = 6.556e-15
Identity = 112/466 (24.03%), Postives = 196/466 (42.06%), Query Frame = 1
Query:  946 QYRIQNYKLDEPTNSFILDISQLPSIFLKVSKKLDFEEKK---QYHAKLKACDEDNCTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRI---VARDSD------------PINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIP-SKLITTLQIVDQDKGPNGIVYCHLDPVCEGSFE---LQNRSKDIYSLRSVRKFDHE------VEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQD--KSAVLKYQIDN--YGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSL 2247
            +Y ++  K D P  +    I     I L+VS K++  E+    +  A L   +E     +++ I I D ND+ P+F  +    T     + G ++ +V A D+D G  G I Y   ++   +I +     TL   +++ KK +++  + +   +   ++R S             P  PK       I+ E  N H P      ++  +++ E+ P   ++  LQ  D+D G NG +   +  +   S E   +  +S +I     + K   E      V+ K+ AI    D G P   S K + + I D+N   P F + S YL   + EN + G  +  V A D D   +  +K+ + N    +    ID  +G+++   +L DRE     +F +   D     + +   + I+V D NDN P       +  I E+      V  + A D D  +N+ + F L
Sbjct:  419 RYSLEYSKSDLPNATLPFAIGSKNGI-LRVSAKINRSERVYNFKVIASLHGINE-KLAEKDVSIEILDSNDHAPVFSAKWMRQTPIVIGKPGDVLVKVDATDQDEGENGKIVYKFTSELPLEINANTGEITL---VEVPKKGNSWPATVWAIDLGLPLSRMSALNLMFYKNGTKIPAKPKP-----IIIQESENKHSPVFSSFPEI--VEVTEDAPIGTVVAKLQANDEDTGYNGFIRYVIHDIAGSSHEVLTVDEQSGEITVASDLSKLMKEKLEVLDVQLKVSAI----DAGTPVKSSVKTMKLRIKDVNNHSPQFDEVSYYL--RISENEKPGKDIFKVTANDFDGGNNGKIKFSLGNNQEKSSVISIDAKTGIVKLLKSL-DREDQDVHTFAIIASDEGFPMRVSVTNLTISVEDVNDNPPKCVVQHSRARIPEDLPHGAFVSCMAAFDEDIGQNSKLKFLL 865          

HSP 10 Score: 79.337 bits (194), Expect = 1.862e-14
Identity = 139/604 (23.01%), Postives = 248/604 (41.06%), Query Frame = 1
Query: 1033 VSKKLDFEEKKQYHAKLKACDEDNC-TTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIPSKL-ITTLQIVDQDKGPNGIVYCHLDPVC-EGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKSAVLKYQIDNYGAEYFEIDQNSGLIRCT-NNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPS----QLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLPTGHIETLLK-LDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQMLHSGTVILL---FRASDYGQPAKYSDHKLVINIFGDESGN 2808
            V   LD E K Q+   ++A           + + I D NDN P F  +    TI ED  +G+ +    A DRD    G I++S+      +    F +   SG + +  +L       Y  +++AR +D       L   TI+V DVND  P+     +     I   +PS   I    I D D  PN +    +     EG F + + +  +     + +   + + K+ A       G     ++  I +  +  ++ R    +K+  L     ENS+ GT V+    +       + +++ +     F ++  +G+++   ++ ID E+   + F  H +      +     + + + + NDN P     L + SI EN   S    Q + +I A DAD DE   I F + + + G         F +     + T++K LD EI   + L ++ASD              I + V+D+ND +PT+     + + + ++   G  L   +A+  D       + E I+ Y K    +SF         +N+ TG L +++ L   T+  L     A D G P   ++ ++ I++  DE+ N
Sbjct: 2668 VKSSLDRERKNQWKMTIRADAAGGVHAITTVTVDIGDVNDNAPAFHGDYERFTISEDAAVGTSVTIFSAMDRDDSPSGRIRFSL-----VEENPYFDLNENSGWLTVASQLDREKIDHY--KLIARATDEGGFNTDL-PFTIVVSDVNDSPPQF----EKEEFNIDLHLPSTSPILHFSIKDDDLSPNNVSQFFIPKGNEEGVFWIDSNNDLLLKRPEIVENKMQYQLKVTAF-----DGVFETSTKVKINLKSSKDSDIRCPEANKTVILA----ENSKKGTVVL---GESSLLGPNVTFKLSDNDGNVFVVNFRNGIVKVKESDQIDYEKNQQLEF--HRLTIQDNSEVCKELITVVIENLNDNRPKIIEKLLKVSIDENLPTSEDARQYITRIVAEDADFDE---IKFRMVDDFGG--------LFQIDDINGVVTVVKPLDSEILGFFNLTVVASDGE------FEDKATILVTVIDQNDNAPTFEKSTYS-MKVMESESIGYELAHFRASGGD-------QNETIEYYLKPSDVTSFVN-------LNAQTGILTLAKPLDFETLSALKLTVVAKDSGVPPLETEAQVEISVM-DENDN 3212          

HSP 11 Score: 78.1814 bits (191), Expect = 4.545e-14
Identity = 85/334 (25.45%), Postives = 145/334 (43.41%), Query Frame = 1
Query:  760 NILLNNKEKEVVSSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNSFILDISQLPSIFLKVSKKLDFEEKKQYHAKLKACDEDNC-----TTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKY--SIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIPSKLITTLQIVDQDKGPNGIVY-CHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKD 1737
            N+ +   + E      I V ++D+ND+ P FE     + + E   IG  ++   A+  D +    I+ Y       SF+   +Q  +  L ++K LDFE       KL    +D+      T   + I + DENDN P FE E Y   +KE+ + G  +  VKA D DS  FG + Y   I ++  TD     +    +G + + + +      +Y  +++A+D     P +S   + I VED NDH P      ++++L  + E     +    + D D   NG  +   +      SF++  +      L + +K ++  + K    VI KD
Sbjct: 3083 NLTVVASDGEFEDKATILVTVIDQNDNAPTFEKSTYSMKVMESESIGYELAHFRASGGDQNET--IEYYLKPSDVTSFVNLNAQ--TGILTLAKPLDFETLSAL--KLTVVAKDSGVPPLETEAQVEISVMDENDNAPKFEKEKYVGKVKENSKSGEKVLTVKALDVDSEHFGAVSYELEIVSETTTDTPVLPFAINSNGDVLISQSIDYEKIKKYNLKVIAKDGGR-PPLRSEALLEIHVEDENDHAPTFD-DCNMTALVQEGEAIGHRLLKFSVSDLDGPKNGAPFTVEIQGDGAKSFKVNEK----LELLTAKKLEYRKKDKYLLTVIAKD 3404          

HSP 12 Score: 71.2478 bits (173), Expect = 5.603e-12
Identity = 83/343 (24.20%), Postives = 152/343 (44.31%), Query Frame = 1
Query:  808 IQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNSFILDISQLPSIFLKVSKKLDFEEKKQYHAKLKACDEDN---CTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIR-TDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIP-SKLITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAI-VICKDQGEPSLESRKIIPIIITDLNEFRPTFK 1818
            + + ++D ND  P F  P     ISE ++ G ++ + SATD D +       Y L + + S    +       + V+KKL+ +        +KA D  N     T  + ++I  E+   P F    Y  ++ ED  +G++IG+V+  + +      I+++I     ++D    F VE  +G+I +K  L    ++++   I A   D      ++ +VT+ + DVND+ P      D     I E+      +T    +D+D  P+G +   L  V E  +   N +    ++ S  + D E   KID   +I +   E    +     I+++D+N+  P F+
Sbjct: 2491 LTLSVIDINDKPPFFVLPFYSTSISESAKEGDTVMMVSATDDDENDTIE---YSLLDGSESQFFSVHPRQGT-ITVAKKLEHKAGVTLSLTIKATDSANPPHHATTTVEVNIASESVKVPRFSNSHYLFSVMEDADVGNVIGRVQQMETE---IDEIRFTIVPGSEESDSFLPFSVERSTGKIIVKSSLDRERKNQWKMTIRA---DAAGGVHAITTVTVDIGDVNDNAPAFH--GDYERFTISEDAAVGTSVTIFSAMDRDDSPSGRIRFSL--VEENPYFDLNENSGWLTVAS--QLDRE---KIDHYKLIARATDEGGFNTDLPFTIVVSDVNDSPPQFE 2814          

HSP 13 Score: 68.9366 bits (167), Expect = 3.093e-11
Identity = 137/612 (22.39%), Postives = 256/612 (41.83%), Query Frame = 1
Query:  928 DKDHSSQYRIQNYKLDEPTNSFILDISQLPS-IFLKVSKK----LDFEEKKQYHAKLKA-CDEDNC----TTQNLIIHIKDENDNQPIF--ETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPI------NPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIPSKLITTLQ---IVDQDKGPNGIVYCHLDPVCEGSFELQ------NRSKDIYSLRSVRKFDHEVEQKIDAIVICKD---------QGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKV--MTVKAQDQDKSAVLKYQIDNYGAEY------FEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSW----NGNTMQ-------RHDNYFNVLPTGHIETLLKLDREICDLYILEIM-ASDSAKSPQIPLTSIVNITLRVLDENDESPTW-THPDNNILNITDTMRPGDHLLQLQATDRDVGANGKVRFEI 2592
            +KD + ++R+    + E ++ F     Q+   +FL++  K    L+ E K  Y   +KA C   +     TT  + + + D ND  P+F    + Y   I +D++  S + +V+A+D D G+   I +S+      +    F VE ++G ++    L      +Y  ++ + D          N  Q   +  +L+  V + KP+ R I     L  Q +I   ++   Q   I+     PN  +        E  FE++      + +K++  +   +      +     + I +D           +P + + + + I I  L E    F D  +  L    E +  G  +  M V  ++ D  ++++Y ++   ++       F I   +G++R +  +   ERV   +F V         K A  +V I +LD+ND++P+FS    + + I    P  ++ +++ATD D+ EN  I +   +      N NT +       +  N +       I+  L L R    +  L +M   +  K P  P   I+  +     EN  SP + + P+  I+ +T+    G  + +LQA D D G NG +R+ I
Sbjct:   66 EKDANCKFRVAEI-VGEKSSLFKAHSRQVGDFVFLRIRYKGDNPLNRELKDFYDILVKAMCKRRDLSNLETTARIHLRVIDRNDASPVFLVGEQGYEAEIDDDLEPFSTVLRVEASDADIGINSAIYFSL-----VNRSHDFIVEPVTGWVR---SLRHVKPGKYSLKVKSEDRASRLYYFDENEVQPSWTADVLIT-VRETKPKPRRI-----LVDQRKINPNILNNRQLAAIITLKDSPNDAIVGLKGNEKEHWFEVEPEVVGNDGTKELRWMLYAKNGSQVPKNTNVTLTIGEDYIRRSGFSISKKPVIPTNETVTIQIERLAEHLIRFLDNEKLTL-KTDEMAPIGRILYRMNVNVENPDDVSLIRYSLEYSKSDLPNATLPFAIGSKNGILRVSAKINRSERV--YNFKVIASLHGINEKLAEKDVSIEILDSNDHAPVFSAKWMRQTPIVIGKPGDVLVKVDATDQDEGENGKIVYKFTSELPLEINANTGEITLVEVPKKGNSWPAT-VWAIDLGLPLSR----MSALNLMFYKNGTKIPAKPKPIIIQES-----ENKHSPVFSSFPE--IVEVTEDAPIGTVVAKLQANDEDTGYNGFIRYVI 647          

HSP 14 Score: 65.4698 bits (158), Expect = 3.431e-10
Identity = 122/524 (23.28%), Postives = 221/524 (42.18%), Query Frame = 1
Query: 1150 NQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIPSKLITTLQIVDQD------KGPNGIVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQD-----QDKSAVLKYQIDNYGAEYF--EIDQNSGLIRCTNNL-IDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLP-TGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSI-VNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFN-QGSSQYFIVNSS 2670
            + P+FE   Y  +  E   IG  +  +KA   D     TI+YS+    D +I       T++G++  +K        +Y  ++VA  S       S     +L+EDVND  PE  I +D+S+      I  + IT +   D D      +    ++Y  +D   E  F +   + ++   R V + D   E     + +    G  +  ++ ++ I+ +   +  P F ++S Y+   +       + ++TV  +      Q   A       +   E +   ID+ +G I  +  L   R++   I   V     D   + A   + ++V+D ND  P F       SI E+      V  ++AT  D DEN  I +SL    +G+  Q    +F+V P  G I    KL+ +      L I A+DSA  P    T++ VNI      E+ + P +++  + + ++ +    G+ + ++Q  + ++    ++RF I+    + D    F+ + S+   IV SS
Sbjct: 2182 HAPVFEKLKYTASTPESTSIGQRLLTIKATTSDEN--DTIEYSLSGSKDIEIHPETGDVTITGQLDYEKT------QKYDLKLVATSSG--KQVSSEAEFIVLIEDVNDEMPEF-IRSDVSAKISDSAITGQFITIMSATDMDTTNSLDEESQKLLYKIVDG-DETLFNISPATGELSLARPVEQDDLVNEDTKKVLNVSVTDGMFTAYAKLVVEILRSGSMQPPPRF-EQSHYVANALENTIVNKSALLTVAVKGGVPPLQFSLAPTTSSNSSTSKEAWPVAIDRKTGRIHVSRVLNYHRDKRYQIPLVVE----DATGRRAFSTLTLSVIDINDKPPFFVLPFYSTSISESAKEGDTVMMVSAT--DDDENDTIEYSL---LDGSESQ----FFSVHPRQGTITVAKKLEHKAGVTLSLTIKATDSANPPHHATTTVEVNIA----SESVKVPRFSN-SHYLFSVMEDADVGNVIGRVQQMETEI---DEIRFTIVPGSEESDSFLPFSVERSTGKIIVKSS 2671          
BLAST of Protocadherin-9 vs. Ensembl Celegans
Match: cdh-3 (Cadherin-3 [Source:UniProtKB/Swiss-Prot;Acc:P34616])

HSP 1 Score: 120.553 bits (301), Expect = 6.693e-27
Identity = 154/660 (23.33%), Postives = 289/660 (43.79%), Query Frame = 1
Query:  796 SSVEIQVQILDKNDHNPIFETPETK--IVISEFSQIGISISLTSATDKD-HSSQYRIQNYKLDEPTNSFILDISQLPSIFLKVSKKLDFEEKKQYHAKLKACDE---DNCTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIPSKLITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLES--RKIIPIIITDLNEFRPTFKDKSQYL-----LGHVWENSEFGTKV-----MTVKAQDQDKSAVLK-------YQIDNYGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQML 2700
            S+ ++ + + D+ND  P F T +     V+ E   +   + + S+  +D    Q  +  Y +     S     S    I   +   LD EE   +   ++A D        T  ++IH+ D NDN P FE  +Y + I E+ +IGS I ++ A D+D      ++YS+ ++   +I   F +   +G I +  K++      + F +   D +    K S   V I VED ND+ P   +I D +S  I    P++ +  + +++                                +  + K DH      ++ +   + GE +L+S  +  +P+        R T  D + ++     L H      F   V     ++V+  D+ + AV K       Y I +  +++ E+++++G+++  ++L   E    + F +     D +P +   +  I ++D NDNSP F   L +F++ EN+GP +L+G + A D D+           ++         ++ F V  +G IE++  LDRE    Y L + A D  K  +   T+++   + VLDE+D +P ++   +  + + + +R G+ ++QL A+D D  +N   RFE+       DG      G    F V+ +TG ++++  L
Sbjct: 1630 STSQVIIHVTDENDEAPRFITGDVVNLKVLEELDTVSYPLIIGSSIAEDLDEGQNGLVTYSILSGNTSLFAVNSTTGDILSLIP--LDREESSLHELLIEAKDAGIPSLSATSKILIHVGDINDNTPEFELSSYFIKISENSKIGSKIIRILATDKDKD--AELQYSLESN--DEITIPFRINVATGWITVAGKVNREENEEFRFFVKVTDGE----KSSKVIVEIHVEDFNDNHP---MINDRNS-DIFVPDPTRSVEIIHVIN--------------------------------VHDLDKSDHLKFSLNNSNLNLSENGEITLKSPLQTAVPV--------RVTVSDDAGHVAFMEYLFHPHSRKHFPVFVEKLDTVSVREHDEQELAVFKANGDSIRYSIVSRCSDHLEMEKSTGILKTKSSLDAEEYSECLVFIIATTYFDNKPLSTITKATIKIVDINDNSPRFDQQLYRFNVTENSGP-KLIGHVIARDIDRSSRVFYEIVGGDA---------NHEFMVTESGQIESVRDLDRETKSEYHLIVEAIDDGKPRRRGNTTVI---VTVLDEDDNAPRFSRIFH--VEVPEDVRIGEPVIQLSASDADEHSNH--RFEL-------DGG-----GEGIPFRVDENTGMVFVNDSL 2206          

HSP 2 Score: 87.4261 bits (215), Expect = 6.375e-17
Identity = 85/294 (28.91%), Postives = 139/294 (47.28%), Query Frame = 1
Query: 1363 STFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIPS---KLITTLQIV-DQDKGPNGIVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKSAVLKYQIDNYGAEY--FEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDEN 2226
            + FT S   F  +      I   +S   V I V D ND  P   I  D+ +LK+ EE+ +    LI    I  D D+G NG+V   +       F + + + DI SL  +   D E     + ++  KD G PSL +   I I + D+N+  P F+  S ++   + ENS+ G+K++ + A D+DK A L+Y +++       F I+  +G I      ++RE      F V V D +   K++ V V+I V D NDN P+ +       + + T   +++  IN  D D+ ++
Sbjct: 1606 TIFTNSPLDFENIKTYRFNITAGKSTSQVIIHVTDENDEAPRF-ITGDVVNLKVLEELDTVSYPLIIGSSIAEDLDEGQNGLVTYSILSGNTSLFAVNSTTGDILSLIPL---DREESSLHELLIEAKDAGIPSLSATSKILIHVGDINDNTPEFELSSYFI--KISENSKIGSKIIRILATDKDKDAELQYSLESNDEITIPFRINVATGWITVAGK-VNREENEEFRFFVKVTDGE---KSSKVIVEIHVEDFNDNHPMINDRNSDIFVPDPTRSVEIIHVINVHDLDKSDH 1889          

HSP 3 Score: 78.1814 bits (191), Expect = 5.251e-14
Identity = 80/329 (24.32%), Postives = 145/329 (44.07%), Query Frame = 1
Query: 1264 TIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIPSKLITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKSAVLKYQIDNYGAEY-FEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSL 2247
            +I+YSI +     ++    +E  +G +K K  L     S     I+A       P  ++   TI + D+ND+ P  R    L    + E    KLI  +   D D+    + Y  +       F +    +    + SVR  D E + +   IV   D G+P       + + + D ++  P F   S+     V E+   G  V+ + A D D+ +  ++++D  G    F +D+N+G++   N+ +D E+  S    V + D     +T+   + + V D NDN+P+F    P++  I     ++ +GQ +A+D D + N  I +S+
Sbjct: 1974 SIRYSIVSRCSDHLE----MEKSTGILKTKSSLDAEEYSECLVFIIATTYFDNKPLSTITKATIKIVDINDNSP--RFDQQLYRFNVTENSGPKLIGHVIARDIDRSSR-VFYEIVGGDANHEFMVTESGQ----IESVRDLDRETKSEYHLIVEAIDDGKPRRRGNTTVIVTVLDEDDNAPRF---SRIFHVEVPEDVRIGEPVIQLSASDADEHSNHRFELDGGGEGIPFRVDENTGMV-FVNDSLDFEKKQSYRIKVKLTDGAWLIETS---LFVNVKDVNDNAPIFEK--PEYLFISEENSAE-IGQFHASDMDSENNGKIRYSV 2281          

HSP 4 Score: 72.4034 bits (176), Expect = 2.681e-12
Identity = 64/215 (29.77%), Postives = 109/215 (50.70%), Query Frame = 1
Query:  649 FIVTEEGKILVRKLIDLETLCSQYKLCCGEPVCILKANILLNNKEKEVVSSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNSFILDISQLPSIFLKVSKKLDFEEKKQYHAKLKACDEDNCTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDF 1293
            F+VTE G+I   + +D ET  S+Y L       I++A   +++ +     +  + V +LD++D+ P F +    + + E  +IG  +   SA+D D  S +R   ++LD         + +   +   V+  LDFE+K+ Y  K+K  D       +L +++KD NDN PIFE   Y    +E+    + IGQ  A+D DS   G I+YS+ + +
Sbjct: 2090 FMVTESGQIESVRDLDRET-KSEYHL-------IVEA---IDDGKPRRRGNTTVIVTVLDEDDNAPRF-SRIFHVEVPEDVRIGEPVIQLSASDADEHSNHR---FELDGGGEGIPFRVDENTGMVF-VNDSLDFEKKQSYRIKVKLTDGAWLIETSLFVNVKDVNDNAPIFEKPEYLFISEEN---SAEIGQFHASDMDSENNGKIRYSVTSPY 2285          

HSP 5 Score: 66.2402 bits (160), Expect = 1.931e-10
Identity = 78/278 (28.06%), Postives = 128/278 (46.04%), Query Frame = 1
Query:  796 SSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEP-----TNSFILDISQLPSIFLKVSKKLDFEEKKQYHAKLKACDE---DNCTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRII---ADLSSLKIQ-EEIPSKLITTLQIVDQDKGPNG 1593
            S + I + +LD ND++PIF     ++ I E + IG  + ++ ATD D      I  Y+L +      T S    +     +FL+V+ KLD E +  Y  +L A D+   +  ++ +L I I D NDN P F   +  LT+  +    + +  + A D DS     + Y I     T    +   E +     L  + +T    R  F + ARDS  + P  +  ++ + +E  N+H+P I I    +D   + +Q E++  K +  L I D D GP G
Sbjct:   99 SIIHILIDVLDVNDNSPIFPIDVQRVEIPETAPIGWRVQISGATDPDEGKNGTIGKYELVDSLATVDTMSPFGIVQSDGFLFLEVTGKLDRETRDLYSMRLTAIDQGVPELSSSCHLNILILDINDNPPNFGIRS--LTLNWNGLPNTKLFSLNATDLDSNENSLLTYRILPSGPTSEMFSISDENI-----LVTQNNTECLQRCEFVVEARDSG-VPPLSTTLNIVVNMEYGNEHEPNINIRFYPSDYPFIIVQPEDVNGKTLAILSITDSD-GPLG 367          

HSP 6 Score: 64.6994 bits (156), Expect = 6.601e-10
Identity = 48/132 (36.36%), Postives = 70/132 (53.03%), Query Frame = 1
Query: 1108 TTQNLIIH--IKDENDNQPIFE-TETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARD-SDPINPKQSLCSVTILVEDVNDHKPEI 1491
            TTQ  II   +K  N + PI + TE + L   E+  IG+I G+++A D DSGL G + Y I T  D D    F++++ SG ++  K      +  Y F   A+D   P   K + C  TI +EDVND+ P+ 
Sbjct:  613 TTQTSIITLIVKPLNQHSPICQITEIHVL---ENAPIGTIFGRIQARDEDSGLSGVVSYKILTKSD-DYDGIFHLDSTSGSLRSLKAFDAEKKRSYTFEYEAKDLGTP--SKTTNCPATIFIEDVNDNVPKF 738          

HSP 7 Score: 58.9214 bits (141), Expect = 3.041e-8
Identity = 75/308 (24.35%), Postives = 136/308 (44.16%), Query Frame = 1
Query: 1156 PIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIP-SKLITTLQIVDQDKGPNGIVYCHL---DPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQD---KSAVLKYQIDNYGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSD 2058
            PI     Y  T  +DV +G++IG++             K  I +  DT  +   + +   G + + K +++      P  +V R++           +T++V+ +N H P    I  ++ + + E  P   +   +Q  D+D G +G+V   +       +G F L + S    SLRS++ FD E ++        KD G PS  +     I I D+N+  P F   S+Y    +   S     V  V+A D D   K+  L+Y + NY  ++F++D+ +G +    ++    +  +IS +   MDS+
Sbjct:  544 PIHLKRAYTFTTWQDVSLGTVIGRLP------------KAQIYSTIDTVSELGVFPD---GSVFVGKTITS-DFVTLPVTLVNRNT------TQTSIITLIVKPLNQHSP----ICQITEIHVLENAPIGTIFGRIQARDEDSGLSGVVSYKILTKSDDYDGIFHLDSTSG---SLRSLKAFDAEKKRSYTFEYEAKDLGTPSKTTNCPATIFIEDVNDNVPKF--GSRYYTATISGKS--NETVAIVQANDNDVDVKNQKLQYHLLNY-HDFFQLDKETGKVTTIQDVPMTWQRLNISISAVNMDSE 817          

HSP 8 Score: 55.8398 bits (133), Expect = 2.645e-7
Identity = 63/228 (27.63%), Postives = 101/228 (44.30%), Query Frame = 1
Query: 1939 YGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQIN-ATDADQDENALI-------SFSLRNSWNGNTMQRHDNYFNVLPTGHIETLLKLDREICDLYILEIMASDSAKSPQIP-LTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQLQATDRDVGANGKVRFEII 2595
            +  +  E+  +S L R + N ID   ++S    +H++              I VLD NDNSP+F  ++ +  I E T P     QI+ ATD D+ +N  I       S +  ++ +   + + D +  +  TG      KLDRE  DLY + + A D      +P L+S  ++ + +LD ND  P +       L +     P   L  L ATD D   N  + + I+
Sbjct:   68 FDEQTLELSVSSPLDRESENAIDMLIITSPPSIIHIL--------------IDVLDVNDNSPIFPIDVQRVEIPE-TAPIGWRVQISGATDPDEGKNGTIGKYELVDSLATVDTMSPFGIVQSDGFLFLEVTG------KLDRETRDLYSMRLTAIDQG----VPELSSSCHLNILILDINDNPPNFGIRS---LTLNWNGLPNTKLFSLNATDLDSNENSLLTYRIL 267          

HSP 9 Score: 55.0694 bits (131), Expect = 4.456e-7
Identity = 46/154 (29.87%), Postives = 68/154 (44.16%), Query Frame = 1
Query: 1768 IIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDK--SAVLKYQIDNYGAEY---FEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDAD 2214
            II +I+  LN+  P      Q    HV EN+  GT    ++A+D+D   S V+ Y+I     +Y   F +D  SG +R      D E+  S +F     D  T  KT +    I + D NDN P F +     +I   +  +  + Q N  D D
Sbjct:  618 IITLIVKPLNQHSPI----CQITEIHVLENAPIGTIFGRIQARDEDSGLSGVVSYKILTKSDDYDGIFHLDSTSGSLRSLKAF-DAEKKRSYTFEYEAKDLGTPSKTTNCPATIFIEDVNDNVPKFGSRYYTATISGKSNETVAIVQANDNDVD 766          

HSP 10 Score: 51.9878 bits (123), Expect = 3.715e-6
Identity = 107/453 (23.62%), Postives = 176/453 (38.85%), Query Frame = 1
Query: 1162 FETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIV--ARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIPSKLITTLQ-IVDQDKGPNGIVYCHLDPVCEGSFELQN--------------RSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQD--KSAVLKYQIDNYG--AEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSP-----LFSTNLPQFSIIE---NTGPSQLVGQINATDADQDENALISFSLRNSW--NGNTMQRHD----NYFNVLPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLT 2415
            F  ET   ++ ED ++ +IIG ++A                     +I  T+ +   + +IK  ++    + S    R    A D   I    S+  + I V DVND+ P   I  D+  ++I E  P      +    D D+G NG +         G +EL +              +S     L    K D E        +   DQG P L S   + I+I D+N+  P F  +S  L    W N    TK+ ++ A D D  ++++L Y+I   G  +E F I   + L+   N     E +    F V   DS   P + ++ + + +   N++ P      + ++ P F I++     G +  +  I  +D     N+ I       W  NGN             N+L   H+E   +      + YILE  A+D  +SP   +T
Sbjct:   27 FSEETIKFSVSEDAKLNTIIGHLEA---------------------EIGYTYRLSRGNSKIKFDEQTLELSVSSPLDRESENAIDMLIITSPPSIIHILIDVLDVNDNSPIFPI--DVQRVEIPETAPIGWRVQISGATDPDEGKNGTI---------GKYELVDSLATVDTMSPFGIVQSDGFLFLEVTGKLDRETRDLYSMRLTAIDQGVPELSSSCHLNILILDINDNPPNFGIRSLTL---NW-NGLPNTKLFSLNATDLDSNENSLLTYRILPSGPTSEMFSISDENILVTQNNT----ECLQRCEFVVEARDSGVPPLSTTLNIVVNMEYGNEHEPNINIRFYPSDYP-FIIVQPEDVNGKTLAILSITDSDGPLGANSTI-------WIENGNEQSIFSLISRQSINILTVKHVENANQ------EQYILEFRAND-GQSPADRIT 424          
BLAST of Protocadherin-9 vs. Ensembl Fly
Match: ds (gene:FBgn0284247 transcript:FBtr0078045)

HSP 1 Score: 205.682 bits (522), Expect = 7.352e-53
Identity = 206/758 (27.18%), Postives = 356/758 (46.97%), Query Frame = 1
Query:  544 MHEEIPPNSEIGSILSA---IPHNLRSTSLEFITESD----FFIVTEEGKILVRKLIDLETLCSQYKLCCGEPVCILKANILLNNK----EKEVVSSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNSFILDISQLPSIFLKVSKKLDFEEKKQYHAKLKACDEDN---CTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSI---------RTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIP-SKLITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNRSKDIYSLRSVRK-FDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQD--KSAVLKYQI----DNYGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATD--ADQDENALI-SFS-LRNSWNGNTMQRH--DNYFNV-LPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNI-LNITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQML 2700
            + E+IP  + +GS+++A   + H  RS     I   D    F I T  G I + K +D E                 K+ +LLN +    E  V    ++ +++ D ND+ P FE    +I + E +++G  +    A DKD  S  ++  Y L + +   +  I    S  L +S+ LD+E  +++   + A D       T   +++ ++D NDN P+FE + Y++ + E   I + I QV A+D D+G    I Y I          +   +D+   F +   SG I L+  L   TR RY   ++A D+       +   V + V D ND+ P+ +        +I+E +    ++  +   D D G N  +   L P+   SF++   + +I    S R+  D E+ +  D +V  +DQG P   +R  + I ++D+N+  P   D  + ++  V E    GT+V+ V+A D+D  ++A + Y I    D+ G   F ID  SG+IR T  ++D E  S     V   D    P+     +++ VLD NDN P F+++   F + E+     +VG I+  +  AD   N++  SF  LR ++  N + +   +  F++   +G++     LDRE+   + LEI A D+  S   P +S + + + V D ND +P W  P + I L +++    G  +    ATD D G NG +++ +I+ + + + S    + +   F ++S TGAL +   L
Sbjct:  836 VKEDIPRGTVVGSVIAASGDVAH--RSPVRYSIYSGDPDGYFSIETNSGNIRIAKPLDHEA----------------KSQVLLNIQATLGEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQV-TYSLVKESGKGLFAIDAR-SGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNG-TPAAHAKTRVIVRVLDANDNDPKFQ--KSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPI-NSSFQVHPVTGEI----STREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVS-VREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIR-TRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNN-PQSSAITVKIEVADVNDNAPEW--PQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNES---QEQAMSLFRMDSLTGALSLQAPL 1557          

HSP 2 Score: 205.682 bits (522), Expect = 8.284e-53
Identity = 207/749 (27.64%), Postives = 333/749 (44.46%), Query Frame = 1
Query:  640 SDFFIVTEEGKILVRKLIDLETLCSQYKLCCGEPVCILKANILLNNKEKEVVSSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTS-----ATDKDHSSQYRIQNYKLDEPTNSFILDISQ-LPSIFLKVSKKLDFEEKKQYHAKLKACDEDNCTTQN---LIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIPSKLITTLQIVDQDKGPNG-IVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQD--KSAVLKYQIDNYG-------------AEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLP-TGHIETLLKLDREICDLYILEIMASDSA---KSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQML-HSGTVI--LLFRASDYGQPAKYSDHKLVINIF 2790
            ++F + +  G+I +   +D E   S Y+     PV        L      + ++  I++Q+ D ND+ P+F   E K+ + E  +     S T      ATD D+ +  ++ +Y++     + I  I +    IF+     L    +  +   + A D  N  +     + + I D     PIFE   YN  +KED+  G+++G V A   D      ++YSI   +  D    F +ET SG I++ K L    +S+    I A   +P  P      V I VEDVND+ PE        S+    E+ + L       D+D G +G + Y  +    +G F +  RS     L   +  D+E  Q+   IV   D G PSL +   I + + D+N+  P F +K +Y + +V E+     +++ V A D D   +A + Y+I + G             +++F I  NSG I     L DRE       TV   D+ T    A   V + VLDANDN P F  +  +F I EN     +VG + A+D D  ENA I +SL            ++ F V P TG I T   LDRE+ +LY L + A D     +S ++P      + + V D ND +P    P  +++++ +   PG  +++++A DRD G N  + + I+K  R  DG   F+        ++ ++G +    +L H    I  L   ASD G P + +   L + + 
Sbjct:  658 TEFEVRSASGEICIAGELDFERRSS-YEF----PV--------LATDRGGLSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQV-SYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSI---YSGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQATLGEP--PVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAA-HAHDKDSGSSGQVTYSLVKESGKGLFAIDARSG---HLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVF-EKDEYSV-NVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPL-DRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPI---------NSSFQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVP------VRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKG-RDSDGHGLFS--------IDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVL 1356          

HSP 3 Score: 182.185 bits (461), Expect = 1.292e-45
Identity = 189/727 (26.00%), Postives = 330/727 (45.39%), Query Frame = 1
Query:  568 SEIGSILSAIPHNLRSTSLEFITESDFFIVTEEGKILVRKLIDLETLCSQYKLCCGEPVCILKANILLNNKEKEVVSSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNSFILDISQLPS---------IFLKVSKKLDFEEKKQYHAKLKACDEDNCTTQNLI---IHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRII--ADLSSLKIQEEI-PSKLITTLQIVDQDKGPNGIVYCHLDPVC---EGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKS--AVLKYQID---NYGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVL-PTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDH-----LLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIV 2661
             + G I S  P+ + +   E   E+D  I    G+I  +  +D ET  S Y L            I L+ +      ++ + V + D+ND+ P F      I   E +   +  +L  A D D    Y  Q Y +    +  + D  +L S         + L++S  LD E    Y   ++A D      +  +   I I+D NDNQPIF    Y  T+ E+  +G+ + QV A+D D+   G ++Y+I     +D +  F ++  +G I + K L   T+  +   +VA+D     P ++   V+I V DVND++P I +I  +D +S KI E   P + +  + + D D       Y +++      +G F L  R   IY +      D E+       V+  D+G P L + K I + ITD+N+  P F+    +   +V E ++ GT V+ V A D+D+   + L Y +       A++F+ID  +GLI  T + ID E       TV   D    P +++  V +T+ D NDN P+F  +    S+ EN    + + +++A+D D   NA++++++   +      +H   F V   +G I    +LD E    Y   ++A+D        L++   I +++ D ND  P + +P    +++ ++ +         ++ + ATD D G  G+V + I+     E G    ++ + + F+V
Sbjct:  100 GDFGGIDSGPPYIIVA---EAGVETDLAIDRATGEIRTKVKLDRETRAS-YSLVA----------IPLSGR------NIRVLVTVKDENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEP-YNTQRYNI---VSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRR-QSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGE-QPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTE---YANVNVTLNGGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYH--ANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLI-TTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGF------KHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRGG-----LSTTAMIKMQLTDVNDNRPVF-YPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAG--NEAGIFRIDRSTGEIFVV 780          

HSP 4 Score: 162.925 bits (411), Expect = 9.355e-40
Identity = 215/781 (27.53%), Postives = 355/781 (45.45%), Query Frame = 1
Query:  631 ITESDFFIVTEEGKILVRKLIDLETLCSQYKLCCGEPVCILKANILLNNKEKEVVSSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSS----QYRIQNY--KLDEPTNSFILDISQLPSI--FLKVSKKLDFEEKKQYHAKLKACDEDNCTTQNL------IIHIKDENDNQPIFET------ETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTR-----SRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIPSKLITTLQIVDQDKGPNGIVYCHLDPVCEGSFEL-QNRSKDIYSLRSVR-------KFDHEVEQKIDAIVICKDQGEPSLES----RK-------------------IIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKS--AVLKYQI--DNYGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSD-TEPKTASVEVKITVL--DANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRN--SWNGNTMQRHDNYFNV-LPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTW-THPDNNILNITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQMLHSGTVILLFR---ASDYGQPAKYS 2763
            + E+ F I    G ++V +L+D E + S+++L       I   +   +N  +   S++ +++++ D ND+ P +      + +SE + +G  I   +ATD D  +    QYR+  Y  +L+E +    + + ++ S+   L +   LDFE  ++Y   ++A D+ +  T+ L       + I D ND+ P F +      +T +L I +  +IG ++  + A D DSG  G + Y I      + +  F + + +G I+L K L   T       R+   I A+D     PK+S  ++ ++V+  +++ P  R +  +    I E +PS     LQ+    K  +G    +L      S+E+    + D++ +   R       +FD E +      V  +D    S  S    RK                    I I + D+N+  P F+  S Y L  V ENSE G  + TV A D D+   A L Y I   N G + F ID +SG    +   +DRE+ S   +T+ +  SD  +PK+      IT+   D NDN+P F  +    S+ E+      V QI+A DAD   NA + +SL N   W           F +   +G I T+ KLDRE+   Y   ++A+D  +      ++ V + + VLD ND  P +  +P   I  +   ++PG  LL++QA D D+GAN ++ + +  +          N   S  F +N STGAL  SQ L S +  LL     A D G P + S
Sbjct: 1421 LIEAAFDIDRHSGNLVVARLLDRE-VQSEFRLE------IRALDTTASNNPQS--SAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNE-SQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGG---NGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPP--RFLQAVYRATILENVPSGSFV-LQVTA--KSLHGAENANL------SYEIPAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLS-VPENSEPGV-IHTVVASDLDEGPNADLIYSITGGNLGNK-FSIDSSSG--ELSARPLDREQHSR--YTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQ----------FAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEV--RSATVPVQINVLDINDNRPIFERYP--YIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAE----------NSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSS 2146          

HSP 5 Score: 145.976 bits (367), Expect = 1.247e-34
Identity = 168/656 (25.61%), Postives = 286/656 (43.60%), Query Frame = 1
Query:  808 IQVQILDKNDHNPIFETPET-KIVISEFSQIGISISLTSATDKDHSSQ----YRIQNYKLDEPTNSFILDISQLPSIFLKVSKKLDFEEKKQYHAKLKACDEDNCTTQ----NLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKP---EIRIIADLSSLKIQEEIPSKLITTLQIVDQDKGPNGIVYCHLDP---VCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKSAVLKYQIDNYGA----EYFEIDQNSGLIRCTN-NLIDRERVSSISFT-------------------------------------------------VHVMDSDTEPKTAS-VEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLP--TGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQLQATDRD 2559
            I + + D ND++P F       + + E S+ G+ I    A+D D        Y I    L    N F +D S   S  L  ++ LD E+  +Y  +++A D     ++    N+ I ++D+NDN P F+   Y  +++ED  +G+ + Q+ A D D G+   + YS+      + Q  F ++  SG I    KL    ++ Y F ++A D      + +   V I V D+ND++P       I  + +L IQ   P + +  +Q +D D G N  +   L+         F +   +    +L + +    E  + +   V+ +D+G P   S  +I ++I +  +  P  + +++     + ENS  GT+++ V A   D     K Q  ++GA        +D  SG IR    +L+D +R S+ S +                                                 V V  +   P  AS  E+ I + D NDNSP FS      ++ E       V Q++A D+D   NA + + +    +GN    HDN F + P  +G + T + LDREI D+Y L+I+A+D    PQ  +T    I ++++D ND  PT+  P NN++ +++    G  +  + A D D
Sbjct: 1833 IYITVGDVNDNSPEFRPGSCYGLSVPENSEPGV-IHTVVASDLDEGPNADLIYSITGGNLG---NKFSIDSS---SGELS-ARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLA----NETQWQFAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPAL-IQ---PGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTG---ALSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIELLIGEAPQGTPVLRFQNETYRVMLKENSPSGTRLLQVVALRSDGRR-QKVQF-SFGAGNEDGILSLDSLSGEIRVNKPHLLDYDRFSTPSMSALSRGRALHYEEEIDESSEEDPNNSTRSQRALTSSSFALTNSQPNEIRVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHI---VDGN----HDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEG-VPQ--MTGTATIRVQIVDVNDNQPTF--PPNNLVTVSEATELGAVITSISANDVD 2455          

HSP 6 Score: 135.191 bits (339), Expect = 3.065e-31
Identity = 172/691 (24.89%), Postives = 306/691 (44.28%), Query Frame = 1
Query:  796 SSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNSFILDISQLPSIFLKVSKK-LDFEEKKQYHAKLKACDEDN---CTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKP-----EIRIIADLSSLKIQEEIPSKLITTLQIVDQDKGPNGIVYCHLDPVCE-GSFELQNRSKDIYSLR----SVRKFDHEVEQKIDAIVI-CKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKS--AVLKYQIDNYGAE---YFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSL-RNSWNGNTMQRHDNYFNV-LPTGHIETLLKLDREICDLYILEIMASDSAKSPQIP-LTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQMLHSGT---VILLFRASDYGQPAKYSDHKLVINIF 2790
            +S  I ++I D ND+ P FE       + E +  G S+    A D+D      +  Y L E   +        P   L  ++  +D E +      + A D       +T  +++ I D NDN+PIF+   YN+++ E+  +G  I +V A+D D G+   + Y+I   F     + F V + SG I +  +L    RS Y F ++A D   ++   +   + + + DVND++P     E + ++   S K   +  S  I  +   D D G  G V   +    E G F +   + +I+ +R    SVR       Q +  + I   D G     +  ++ + I D  + RP   +K++Y   +V E+   GT V +V A   D +  + ++Y I  Y  +   YF I+ NSG IR    L D E  S +   +     +  P     +V I V D NDN+P F  ++ + S+ E+      +   +A D D   +  +++SL + S  G         F +   +GH+     LD E    + L + A+D      +P L++ + I + V D ND  P +   D   +N++++      ++Q+ A+D D G N ++ + I+        +S  +   SQ+F +  ++G +++   L   T     L   A+D G PA ++  ++++ + 
Sbjct:  486 ASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSAL-TYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKH--LTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRGGLS---TTAMIKMQLTDVNDNRPVFYPREYK-VSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRT------QPMHMLNISATDGGNLRSNADAVVFLSIIDAMQ-RPPIFEKARYNY-YVKEDIPRGTVVGSVIAASGDVAHRSPVRYSI--YSGDPDGYFSIETNSGNIRIAKPL-DHEAKSQVLLNIQATLGEP-PVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKG--------LFAIDARSGHLILSQHLDYESSQRHTLIVTATDGG----VPSLSTNLTILVDVQDVNDNPPVF-EKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVL 1144          

HSP 7 Score: 130.954 bits (328), Expect = 4.932e-30
Identity = 181/723 (25.03%), Postives = 317/723 (43.85%), Query Frame = 1
Query:  709 CSQYKLCCGEPVCILKANILLNNKEKEVVSSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLD-EPTNSFILDISQLPSIFLKVSKKLDFEEKKQYHAKLKACDE---DNCTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEI---RIIADLSSLKIQEEIPSKL-----ITTLQIVDQD-KGPNGIVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIV--ICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKSAVLKYQIDNYGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEP------KTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQL-VGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNV-LPTGHIETLLKLDREI-CDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRP-GDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQMLHSGTVILLFRASDYGQPAKYSDHKLVINIFGDES 2802
             S + L   +P  I    +        + S  E+ +++ D+ND++P F   +    +SE +  G  ++   A D D  S  R++ + +D    N+F+++ +   S  ++ +  LD E +  Y  K+ A DE       T  + + I D NDNQP F      +T+ E  ++G++I  + AND D+    T +    +  D +  S F ++  SG++ LK++L    +  Y   ++A D+      ++   +T+ V D ND+ P     +  A  + L    EI   L     + T+   D D +G N  V   ++P  EG F +   S  + S+ ++ +    V    D  V  I KD G+P+L+S  ++ +   D    R  F  ++QY    + E +  G+ V+ +     D+S  +   I       FE+ Q+  ++      +DRER       + +      P       ++ + V IT+LDANDN P+F  +    + I    P +  + Q+ A DADQ EN   S  + +  +GN     ++ F + L TG +    +LD +     Y L I A DS    Q PL S+    L + DEND  P +  P    ++      P G  + +  A+D D G  G++ + I        G +  ++ S + F V+S +G +         T   +F   DY Q  +Y    L  ++ G ++
Sbjct: 2275 SSSFALTNSQPNEIRVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAF--SGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNL-VTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDA----AHEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEG-FSVHP-SNGVVSV-NMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFL-QNQY-RAQISEAAPLGSVVLQLGQDALDQSLAI---IAGNEESAFELLQSKAIVLV--KPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQ-ENTPNSEVVYDITSGND----EHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHH--QRPLCSLQPFRLELHDENDNEPKF--PLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSI--------GPAPSDESSWKMFRVDSESGLV---------TSAFVF---DYEQRQRYDMELLASDMGGKKA 2951          

HSP 8 Score: 124.79 bits (312), Expect = 3.474e-28
Identity = 170/726 (23.42%), Postives = 295/726 (40.63%), Query Frame = 1
Query:  796 SSVEIQVQILDKNDHNPIFETPETKIV-ISEFSQIGISISLTSATDKDH----SSQYRIQNYKLDEPTNSFILDISQLPSIFLKVSKKLDFEEKKQYHAKLKACDEDNC---TTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGT----------IKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPIN-PKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIP-SKLITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNRSKDIYSLRSVRK-------FDHEVEQKIDAIVICKDQGE---PSLESRKIIPIIITDLNEFRPTF------KDKSQYLLGHVWENSEFGTKVMTVKAQDQDKS--AVLKYQIDNYGAE-YFEIDQNSGLIRCTNNLI----DRERVSSISFTVHVMD-SDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNV-LPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSI--------------------VNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALW---ISQMLHSGTVILLFRASDYGQPAKYSDH 2769
            + V +++ + D ND+ P    P+  +V + E    G  +    A D+DH    S  Y I   +  +    F +D +   S  ++    LD EE+  Y   + A D  N    T + L + + D NDN+P F + +    ++ED  +G ++G +   +R + +             + Y++       I++ F ++  SG + + + L    +S +   I A D+   N P+ S  +V I V DVND+ PE     D   L++ E  P   +I      D D G NG +   L        E Q ++  ++ + S+          D E  Q+   IV   DQ       L++   + + I D N+  P F        K+  L   + + +  G  V  + A D+D      L Y+I     E  F I+  +G+I    +L     D E+    +  +   D    EPK +S+ + + V  +++N P F   + + +I+EN      V Q+ A      ENA +S+ +            ++ F+V    G I T  + DRE    Y+L +   D+ +   +  +++                      I + V D ND SP +       L++ +   PG  +  + A+D D G N  + + I          +  N G+   F ++SS+G L    + +  HS    L  +ASD GQP     H
Sbjct: 1238 ARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPT---SGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWP--QDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLF--ISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGV-------ANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPG-VIHTVVASDLDEGPNADLIYSI----------TGGNLGNK--FSIDSSSGELSARPLDREQHS-RYTLQIQASDRGQPKSRQGH 1935          

HSP 9 Score: 105.145 bits (261), Expect = 3.569e-22
Identity = 168/700 (24.00%), Postives = 297/700 (42.43%), Query Frame = 1
Query:  646 FFIVTEEGKILVRKLIDLETLCSQYKLCCGEPVCILKANILLNNKEKEVVSSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNSFILDISQLPSIFLKVSKK--LDFEEKKQYHAKLKACDEDNCTTQNLI---IHIKDENDNQP-IFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARD-SDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSL--KIQEEIP-SKLITTLQIVDQ--DKGPNGI--------VYCHLDPVC----EGSFELQNRSKDIYSLRSV-RKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKS--AVLKYQIDNY----------GAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSD---TEPKTASVEVKITVLDANDNSPLF------STNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLPTGHIETLLKL-----DREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQLQATDRDVGANGKVRFEI 2592
            F I    G I +R  +D ET   +Y+L            +  +N      +   + V++LD ND++P F+  + +  I E  + G  + + +A+D D      I+ Y L    +SF     Q+  +  ++S +  LD E ++ Y   ++A D+        +   IH+ D NDN P I + +   ++++E+   G+ + +V+A DRD G   +I YSI    D+D    F ++  SG I+ +  L    RS Y   + A D  +P  P++++  + + V D+ND++P        SSL  +++E+     ++ ++  +++  D   N +        V   L+P+     E +F++   S ++   R + R+   E   +I A+         S  S   + I + D+N+  P +      L   V E +  GT +    A D D      L+Y++  Y              F +D  +G +     L D E V      V  +D     TE    SV V++ +LDAND++P F              I + T   ++V  I A D D  +N  +++ +    NG    R ++      TG IE +  L     D E    + L I A D  + P+ P  S +N+ L V   ++  P +         I + +  G  +LQ+ A       N  + +EI
Sbjct: 1096 FGIFPNSGWIYLRAPLDRET-RDRYQLTV----------LATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIR-YSLLPINSSF-----QVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNP--PRETVRMLRVEVLDLNDNRPTFTS----SSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQS--SAITVKIEVADVNDNAPEWPQDPIDL--QVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPL-DFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEI-TGGNGEGRFRINSQ-----TGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQ-PE-PKKSSLNLHLIVQGSHNNPPRFLQAVYRA-TILENVPSGSFVLQVTAKSLHGAENANLSYEI 1758          

HSP 10 Score: 102.834 bits (255), Expect = 1.911e-21
Identity = 167/690 (24.20%), Postives = 283/690 (41.01%), Query Frame = 1
Query:  808 IQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQ---NYKLDEPTNSFILDISQLPSIFLKVSKKLDFEEKKQYHAKLKACDEDNC---TTQNLIIHIKDENDNQP----IFETETYNLTIKEDVQIGSIIGQVKANDRDSGL-FGTIKYSIRTDFDTDIQSTFYVETLSGRIKL---KKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIPSKLITTLQIV--DQDKGPNGIVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQD--KSAVLKYQIDNYGAEY---FEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIE-----NTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLPTGHIETLL--KLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQML--HSGTVILLFRASDYGQPAKYSDHKLVINI 2787
            + + I D ND+ PIF        + E + +G S+    A+D D      ++   N +  +    F +D  +  +I+  ++K LDFE K+ +   + A D       TT  + I + D NDNQP    IF ++  +  I E  Q G  + ++  +D DS   +  +  ++           F + T    I L      L     S Y   +VA D     P  +  S+ + + DVND+ PE     DL    +  E+     + LQ++  D+D+G N  +   L    E   +          + +    D E E      V+ +D G P L S   + + I D+N+  P F D+S Y +  V EN   G  ++ V A D D   +A++ Y I   G ++   FE+   SG I C    +D ER SS  F V   D      TA +++++T  D NDN P+F     + S+ E     +   S  +  + ATD D      +S+ +  + N   + R D       TG I  +    L      +++L I A+D      +   +   + L ++D     P +     N     D  R G  +  + A   DV     VR+ I            ++     YF + +++G + I++ L   + + +LL   +  G+P  Y   ++ I +
Sbjct:  272 VNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRID-PRTGAIY--INKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGG-----DGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKG-TPPLHASKSIFLRITDVNDNPPEFE--QDLYHANVM-EVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIF-DQSFYNVS-VAENEPVGRCILKVSASDPDCGVNAMVNYTIGE-GFKHLTEFEVRSASGEI-CIAGELDFERRSSYEFPVLATDRGGLSTTAMIKMQLT--DVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIV-AGNEAGIFRIDR-----STGEIFVVRPDMLSVRTQPMHMLNISATDGGN---LRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPR-GTVVGSVIAASGDVAHRSPVRYSI------------YSGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQATLGEPPVYGHTQVNIEV 921          

HSP 11 Score: 93.2041 bits (230), Expect = 1.647e-18
Identity = 166/731 (22.71%), Postives = 305/731 (41.72%), Query Frame = 1
Query:  628 FITESDFFIVTEEGKILVRKLIDLETLCSQYKLCCGEPVCILKANILLNNKEKEVVSSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNSFILDISQLPSIF--------LKVSKKLDFEEKKQYHAKLKACDEDNCTTQNLIIHIKDENDNQPIFETE---TYNLT------IKEDVQIGSIIGQVKANDRDS-GLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKL---KKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDH-KPEIRIIADLSSLKIQEEIPSKLITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEP-----SLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDK----SAVLKYQIDNYGAEY-FEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVE-VKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSL------RNSWNGNTMQRHDNYFNVLPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLL-QLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQML 2700
            F+ E  F  +     +L R++ D+      YKL            I  +    ++  +  I+VQI+D ND+ P F  P   + +SE +++G  I+  SA D D    Y    Y+L   +    +DI  + SIF        L + ++LD+E +++Y   + A D  +     L + + DENDN P+F  +    Y         I E + +   +  V A D DS G    + Y I        Q  F V   +G + +   + + +  +   Y  RI+A+D+     K +L S T+L    ND+     + + +    +I E  P  L + +  + QD     +     +   E +FEL  +SK I  ++ + +  +++ +    +V+    G P     +  S   + I I D N+  P F D+S      + E +     +  ++A D D+    ++ + Y I +   E+ F ID  +G++   N L       S    +   DS  +    S++  ++ + D NDN P F        + EN      V + +A+D D+     +++S+       +SW    M R D+      +G + +    D E    Y +E++ASD          + V + + +   ++ +P +T      +       P  +++ Q+ ATD D G +G+V +++   +               +F VN S+GA+ I + L
Sbjct: 2370 FVIEPAFSGIVRTNIVLDREIRDI------YKLKI----------IATDEGVPQMTGTATIRVQIVDVNDNQPTF-PPNNLVTVSEATELGAVITSISANDVD---TYPALTYRLGAEST---VDIENM-SIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAHEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEP-----AQEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAG----KPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAP--LGSVVLQLGQDALDQSLAIIAGNE--ESAFELL-QSKAIVLVKPLDRERNDLYKL--RLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIF-DRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWK---MFRVDS-----ESGLVTSAFVFDYEQRQRYDMELLASDMGGK-----KASVAVRVEIESRDEFTPQFTERTYRFVLPAAVALPQGYVVGQVTATDSDSGPDGRVVYQLSAPH--------------SHFKVNRSSGAVLIKRKL 3032          

HSP 12 Score: 85.5001 bits (210), Expect = 3.679e-16
Identity = 105/446 (23.54%), Postives = 187/446 (41.93%), Query Frame = 1
Query:  541 QMHEEIPPNSEIGSILSAIPHNLRSTSLEFIT---ESDFFIVTEEGKILVRKLIDLETLCSQYKLCCGEPVCILKANILLNNKEKEVVSSVEIQVQILDKNDHNPIFE-TPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNSFILDISQ----------LPSIFLKVSKKLDFEE-KKQYHAKLKACDEDN----CTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIR-TDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIPSK-LITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHE------VEQKIDAIVICKDQGEP-SLESRKIIPIIITDL 1794
            Q   +I   + +GS++  +  +    SL  I    ES F ++  +  +LV+ L        + +L    P      + L ++    V+      + ILD ND+ PIF+ + + +  ISE + +  SI+   A D D            + P +  + DI+           L +  L V+ +LD++   K Y   ++ACD  +    C+ Q   + + DENDN+P F    Y   + E+  +GS + +  A+D D G FG + YSI     D      F V++ SG +          R RY   ++A D   +  K++  +V + +E  ++  P+         L     +P   ++  +   D D GP+G V   L       F++ NRS     ++   K D +      ++ +  ++VI    G   SL S  ++ I +  L
Sbjct: 2652 QYRAQISEAAPLGSVVLQLGQDALDQSLAIIAGNEESAFELLQSKAIVLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVI------ITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQE----------NTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASD---MGGKKASVAVRVEIESRDEFTPQFTERTYRFVLPAAVALPQGYVVGQVTATDSDSGPDGRVVYQLS-APHSHFKV-NRSSGAVLIKRKLKLDGDGDGNLYMDGRDISLVISASSGRHNSLSSMAVVEIALDPL 3076          
BLAST of Protocadherin-9 vs. Ensembl Fly
Match: ds (gene:FBgn0284247 transcript:FBtr0343249)

HSP 1 Score: 205.682 bits (522), Expect = 7.352e-53
Identity = 206/758 (27.18%), Postives = 356/758 (46.97%), Query Frame = 1
Query:  544 MHEEIPPNSEIGSILSA---IPHNLRSTSLEFITESD----FFIVTEEGKILVRKLIDLETLCSQYKLCCGEPVCILKANILLNNK----EKEVVSSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNSFILDISQLPSIFLKVSKKLDFEEKKQYHAKLKACDEDN---CTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSI---------RTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIP-SKLITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNRSKDIYSLRSVRK-FDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQD--KSAVLKYQI----DNYGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATD--ADQDENALI-SFS-LRNSWNGNTMQRH--DNYFNV-LPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNI-LNITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQML 2700
            + E+IP  + +GS+++A   + H  RS     I   D    F I T  G I + K +D E                 K+ +LLN +    E  V    ++ +++ D ND+ P FE    +I + E +++G  +    A DKD  S  ++  Y L + +   +  I    S  L +S+ LD+E  +++   + A D       T   +++ ++D NDN P+FE + Y++ + E   I + I QV A+D D+G    I Y I          +   +D+   F +   SG I L+  L   TR RY   ++A D+       +   V + V D ND+ P+ +        +I+E +    ++  +   D D G N  +   L P+   SF++   + +I    S R+  D E+ +  D +V  +DQG P   +R  + I ++D+N+  P   D  + ++  V E    GT+V+ V+A D+D  ++A + Y I    D+ G   F ID  SG+IR T  ++D E  S     V   D    P+     +++ VLD NDN P F+++   F + E+     +VG I+  +  AD   N++  SF  LR ++  N + +   +  F++   +G++     LDRE+   + LEI A D+  S   P +S + + + V D ND +P W  P + I L +++    G  +    ATD D G NG +++ +I+ + + + S    + +   F ++S TGAL +   L
Sbjct:  836 VKEDIPRGTVVGSVIAASGDVAH--RSPVRYSIYSGDPDGYFSIETNSGNIRIAKPLDHEA----------------KSQVLLNIQATLGEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQV-TYSLVKESGKGLFAIDAR-SGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNG-TPAAHAKTRVIVRVLDANDNDPKFQ--KSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPI-NSSFQVHPVTGEI----STREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVS-VREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIR-TRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNN-PQSSAITVKIEVADVNDNAPEW--PQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNES---QEQAMSLFRMDSLTGALSLQAPL 1557          

HSP 2 Score: 205.682 bits (522), Expect = 8.284e-53
Identity = 207/749 (27.64%), Postives = 333/749 (44.46%), Query Frame = 1
Query:  640 SDFFIVTEEGKILVRKLIDLETLCSQYKLCCGEPVCILKANILLNNKEKEVVSSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTS-----ATDKDHSSQYRIQNYKLDEPTNSFILDISQ-LPSIFLKVSKKLDFEEKKQYHAKLKACDEDNCTTQN---LIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIPSKLITTLQIVDQDKGPNG-IVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQD--KSAVLKYQIDNYG-------------AEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLP-TGHIETLLKLDREICDLYILEIMASDSA---KSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQML-HSGTVI--LLFRASDYGQPAKYSDHKLVINIF 2790
            ++F + +  G+I +   +D E   S Y+     PV        L      + ++  I++Q+ D ND+ P+F   E K+ + E  +     S T      ATD D+ +  ++ +Y++     + I  I +    IF+     L    +  +   + A D  N  +     + + I D     PIFE   YN  +KED+  G+++G V A   D      ++YSI   +  D    F +ET SG I++ K L    +S+    I A   +P  P      V I VEDVND+ PE        S+    E+ + L       D+D G +G + Y  +    +G F +  RS     L   +  D+E  Q+   IV   D G PSL +   I + + D+N+  P F +K +Y + +V E+     +++ V A D D   +A + Y+I + G             +++F I  NSG I     L DRE       TV   D+ T    A   V + VLDANDN P F  +  +F I EN     +VG + A+D D  ENA I +SL            ++ F V P TG I T   LDRE+ +LY L + A D     +S ++P      + + V D ND +P    P  +++++ +   PG  +++++A DRD G N  + + I+K  R  DG   F+        ++ ++G +    +L H    I  L   ASD G P + +   L + + 
Sbjct:  658 TEFEVRSASGEICIAGELDFERRSS-YEF----PV--------LATDRGGLSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQV-SYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSI---YSGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQATLGEP--PVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAA-HAHDKDSGSSGQVTYSLVKESGKGLFAIDARSG---HLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVF-EKDEYSV-NVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPL-DRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPI---------NSSFQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVP------VRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKG-RDSDGHGLFS--------IDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVL 1356          

HSP 3 Score: 182.185 bits (461), Expect = 1.292e-45
Identity = 189/727 (26.00%), Postives = 330/727 (45.39%), Query Frame = 1
Query:  568 SEIGSILSAIPHNLRSTSLEFITESDFFIVTEEGKILVRKLIDLETLCSQYKLCCGEPVCILKANILLNNKEKEVVSSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNSFILDISQLPS---------IFLKVSKKLDFEEKKQYHAKLKACDEDNCTTQNLI---IHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRII--ADLSSLKIQEEI-PSKLITTLQIVDQDKGPNGIVYCHLDPVC---EGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKS--AVLKYQID---NYGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVL-PTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDH-----LLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIV 2661
             + G I S  P+ + +   E   E+D  I    G+I  +  +D ET  S Y L            I L+ +      ++ + V + D+ND+ P F      I   E +   +  +L  A D D    Y  Q Y +    +  + D  +L S         + L++S  LD E    Y   ++A D      +  +   I I+D NDNQPIF    Y  T+ E+  +G+ + QV A+D D+   G ++Y+I     +D +  F ++  +G I + K L   T+  +   +VA+D     P ++   V+I V DVND++P I +I  +D +S KI E   P + +  + + D D       Y +++      +G F L  R   IY +      D E+       V+  D+G P L + K I + ITD+N+  P F+    +   +V E ++ GT V+ V A D+D+   + L Y +       A++F+ID  +GLI  T + ID E       TV   D    P +++  V +T+ D NDN P+F  +    S+ EN    + + +++A+D D   NA++++++   +      +H   F V   +G I    +LD E    Y   ++A+D        L++   I +++ D ND  P + +P    +++ ++ +         ++ + ATD D G  G+V + I+     E G    ++ + + F+V
Sbjct:  100 GDFGGIDSGPPYIIVA---EAGVETDLAIDRATGEIRTKVKLDRETRAS-YSLVA----------IPLSGR------NIRVLVTVKDENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEP-YNTQRYNI---VSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRR-QSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGE-QPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTE---YANVNVTLNGGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYH--ANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLI-TTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGF------KHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRGG-----LSTTAMIKMQLTDVNDNRPVF-YPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAG--NEAGIFRIDRSTGEIFVV 780          

HSP 4 Score: 162.925 bits (411), Expect = 9.355e-40
Identity = 215/781 (27.53%), Postives = 355/781 (45.45%), Query Frame = 1
Query:  631 ITESDFFIVTEEGKILVRKLIDLETLCSQYKLCCGEPVCILKANILLNNKEKEVVSSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSS----QYRIQNY--KLDEPTNSFILDISQLPSI--FLKVSKKLDFEEKKQYHAKLKACDEDNCTTQNL------IIHIKDENDNQPIFET------ETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTR-----SRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIPSKLITTLQIVDQDKGPNGIVYCHLDPVCEGSFEL-QNRSKDIYSLRSVR-------KFDHEVEQKIDAIVICKDQGEPSLES----RK-------------------IIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKS--AVLKYQI--DNYGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSD-TEPKTASVEVKITVL--DANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRN--SWNGNTMQRHDNYFNV-LPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTW-THPDNNILNITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQMLHSGTVILLFR---ASDYGQPAKYS 2763
            + E+ F I    G ++V +L+D E + S+++L       I   +   +N  +   S++ +++++ D ND+ P +      + +SE + +G  I   +ATD D  +    QYR+  Y  +L+E +    + + ++ S+   L +   LDFE  ++Y   ++A D+ +  T+ L       + I D ND+ P F +      +T +L I +  +IG ++  + A D DSG  G + Y I      + +  F + + +G I+L K L   T       R+   I A+D     PK+S  ++ ++V+  +++ P  R +  +    I E +PS     LQ+    K  +G    +L      S+E+    + D++ +   R       +FD E +      V  +D    S  S    RK                    I I + D+N+  P F+  S Y L  V ENSE G  + TV A D D+   A L Y I   N G + F ID +SG    +   +DRE+ S   +T+ +  SD  +PK+      IT+   D NDN+P F  +    S+ E+      V QI+A DAD   NA + +SL N   W           F +   +G I T+ KLDRE+   Y   ++A+D  +      ++ V + + VLD ND  P +  +P   I  +   ++PG  LL++QA D D+GAN ++ + +  +          N   S  F +N STGAL  SQ L S +  LL     A D G P + S
Sbjct: 1421 LIEAAFDIDRHSGNLVVARLLDRE-VQSEFRLE------IRALDTTASNNPQS--SAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNE-SQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGG---NGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPP--RFLQAVYRATILENVPSGSFV-LQVTA--KSLHGAENANL------SYEIPAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLS-VPENSEPGV-IHTVVASDLDEGPNADLIYSITGGNLGNK-FSIDSSSG--ELSARPLDREQHSR--YTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQ----------FAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEV--RSATVPVQINVLDINDNRPIFERYP--YIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAE----------NSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSS 2146          

HSP 5 Score: 145.976 bits (367), Expect = 1.247e-34
Identity = 168/656 (25.61%), Postives = 286/656 (43.60%), Query Frame = 1
Query:  808 IQVQILDKNDHNPIFETPET-KIVISEFSQIGISISLTSATDKDHSSQ----YRIQNYKLDEPTNSFILDISQLPSIFLKVSKKLDFEEKKQYHAKLKACDEDNCTTQ----NLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKP---EIRIIADLSSLKIQEEIPSKLITTLQIVDQDKGPNGIVYCHLDP---VCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKSAVLKYQIDNYGA----EYFEIDQNSGLIRCTN-NLIDRERVSSISFT-------------------------------------------------VHVMDSDTEPKTAS-VEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLP--TGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQLQATDRD 2559
            I + + D ND++P F       + + E S+ G+ I    A+D D        Y I    L    N F +D S   S  L  ++ LD E+  +Y  +++A D     ++    N+ I ++D+NDN P F+   Y  +++ED  +G+ + Q+ A D D G+   + YS+      + Q  F ++  SG I    KL    ++ Y F ++A D      + +   V I V D+ND++P       I  + +L IQ   P + +  +Q +D D G N  +   L+         F +   +    +L + +    E  + +   V+ +D+G P   S  +I ++I +  +  P  + +++     + ENS  GT+++ V A   D     K Q  ++GA        +D  SG IR    +L+D +R S+ S +                                                 V V  +   P  AS  E+ I + D NDNSP FS      ++ E       V Q++A D+D   NA + + +    +GN    HDN F + P  +G + T + LDREI D+Y L+I+A+D    PQ  +T    I ++++D ND  PT+  P NN++ +++    G  +  + A D D
Sbjct: 1833 IYITVGDVNDNSPEFRPGSCYGLSVPENSEPGV-IHTVVASDLDEGPNADLIYSITGGNLG---NKFSIDSS---SGELS-ARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLA----NETQWQFAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPAL-IQ---PGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTG---ALSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIELLIGEAPQGTPVLRFQNETYRVMLKENSPSGTRLLQVVALRSDGRR-QKVQF-SFGAGNEDGILSLDSLSGEIRVNKPHLLDYDRFSTPSMSALSRGRALHYEEEIDESSEEDPNNSTRSQRALTSSSFALTNSQPNEIRVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHI---VDGN----HDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEG-VPQ--MTGTATIRVQIVDVNDNQPTF--PPNNLVTVSEATELGAVITSISANDVD 2455          

HSP 6 Score: 135.191 bits (339), Expect = 3.065e-31
Identity = 172/691 (24.89%), Postives = 306/691 (44.28%), Query Frame = 1
Query:  796 SSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNSFILDISQLPSIFLKVSKK-LDFEEKKQYHAKLKACDEDN---CTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKP-----EIRIIADLSSLKIQEEIPSKLITTLQIVDQDKGPNGIVYCHLDPVCE-GSFELQNRSKDIYSLR----SVRKFDHEVEQKIDAIVI-CKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKS--AVLKYQIDNYGAE---YFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSL-RNSWNGNTMQRHDNYFNV-LPTGHIETLLKLDREICDLYILEIMASDSAKSPQIP-LTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQMLHSGT---VILLFRASDYGQPAKYSDHKLVINIF 2790
            +S  I ++I D ND+ P FE       + E +  G S+    A D+D      +  Y L E   +        P   L  ++  +D E +      + A D       +T  +++ I D NDN+PIF+   YN+++ E+  +G  I +V A+D D G+   + Y+I   F     + F V + SG I +  +L    RS Y F ++A D   ++   +   + + + DVND++P     E + ++   S K   +  S  I  +   D D G  G V   +    E G F +   + +I+ +R    SVR       Q +  + I   D G     +  ++ + I D  + RP   +K++Y   +V E+   GT V +V A   D +  + ++Y I  Y  +   YF I+ NSG IR    L D E  S +   +     +  P     +V I V D NDN+P F  ++ + S+ E+      +   +A D D   +  +++SL + S  G         F +   +GH+     LD E    + L + A+D      +P L++ + I + V D ND  P +   D   +N++++      ++Q+ A+D D G N ++ + I+        +S  +   SQ+F +  ++G +++   L   T     L   A+D G PA ++  ++++ + 
Sbjct:  486 ASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSAL-TYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKH--LTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRGGLS---TTAMIKMQLTDVNDNRPVFYPREYK-VSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRT------QPMHMLNISATDGGNLRSNADAVVFLSIIDAMQ-RPPIFEKARYNY-YVKEDIPRGTVVGSVIAASGDVAHRSPVRYSI--YSGDPDGYFSIETNSGNIRIAKPL-DHEAKSQVLLNIQATLGEP-PVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKG--------LFAIDARSGHLILSQHLDYESSQRHTLIVTATDGG----VPSLSTNLTILVDVQDVNDNPPVF-EKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVL 1144          

HSP 7 Score: 130.954 bits (328), Expect = 4.932e-30
Identity = 181/723 (25.03%), Postives = 317/723 (43.85%), Query Frame = 1
Query:  709 CSQYKLCCGEPVCILKANILLNNKEKEVVSSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLD-EPTNSFILDISQLPSIFLKVSKKLDFEEKKQYHAKLKACDE---DNCTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEI---RIIADLSSLKIQEEIPSKL-----ITTLQIVDQD-KGPNGIVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIV--ICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKSAVLKYQIDNYGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEP------KTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQL-VGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNV-LPTGHIETLLKLDREI-CDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRP-GDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQMLHSGTVILLFRASDYGQPAKYSDHKLVINIFGDES 2802
             S + L   +P  I    +        + S  E+ +++ D+ND++P F   +    +SE +  G  ++   A D D  S  R++ + +D    N+F+++ +   S  ++ +  LD E +  Y  K+ A DE       T  + + I D NDNQP F      +T+ E  ++G++I  + AND D+    T +    +  D +  S F ++  SG++ LK++L    +  Y   ++A D+      ++   +T+ V D ND+ P     +  A  + L    EI   L     + T+   D D +G N  V   ++P  EG F +   S  + S+ ++ +    V    D  V  I KD G+P+L+S  ++ +   D    R  F  ++QY    + E +  G+ V+ +     D+S  +   I       FE+ Q+  ++      +DRER       + +      P       ++ + V IT+LDANDN P+F  +    + I    P +  + Q+ A DADQ EN   S  + +  +GN     ++ F + L TG +    +LD +     Y L I A DS    Q PL S+    L + DEND  P +  P    ++      P G  + +  A+D D G  G++ + I        G +  ++ S + F V+S +G +         T   +F   DY Q  +Y    L  ++ G ++
Sbjct: 2275 SSSFALTNSQPNEIRVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAF--SGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNL-VTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDA----AHEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEG-FSVHP-SNGVVSV-NMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFL-QNQY-RAQISEAAPLGSVVLQLGQDALDQSLAI---IAGNEESAFELLQSKAIVLV--KPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQ-ENTPNSEVVYDITSGND----EHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHH--QRPLCSLQPFRLELHDENDNEPKF--PLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSI--------GPAPSDESSWKMFRVDSESGLV---------TSAFVF---DYEQRQRYDMELLASDMGGKKA 2951          

HSP 8 Score: 124.79 bits (312), Expect = 3.474e-28
Identity = 170/726 (23.42%), Postives = 295/726 (40.63%), Query Frame = 1
Query:  796 SSVEIQVQILDKNDHNPIFETPETKIV-ISEFSQIGISISLTSATDKDH----SSQYRIQNYKLDEPTNSFILDISQLPSIFLKVSKKLDFEEKKQYHAKLKACDEDNC---TTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGT----------IKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPIN-PKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIP-SKLITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNRSKDIYSLRSVRK-------FDHEVEQKIDAIVICKDQGE---PSLESRKIIPIIITDLNEFRPTF------KDKSQYLLGHVWENSEFGTKVMTVKAQDQDKS--AVLKYQIDNYGAE-YFEIDQNSGLIRCTNNLI----DRERVSSISFTVHVMD-SDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNV-LPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSI--------------------VNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALW---ISQMLHSGTVILLFRASDYGQPAKYSDH 2769
            + V +++ + D ND+ P    P+  +V + E    G  +    A D+DH    S  Y I   +  +    F +D +   S  ++    LD EE+  Y   + A D  N    T + L + + D NDN+P F + +    ++ED  +G ++G +   +R + +             + Y++       I++ F ++  SG + + + L    +S +   I A D+   N P+ S  +V I V DVND+ PE     D   L++ E  P   +I      D D G NG +   L        E Q ++  ++ + S+          D E  Q+   IV   DQ       L++   + + I D N+  P F        K+  L   + + +  G  V  + A D+D      L Y+I     E  F I+  +G+I    +L     D E+    +  +   D    EPK +S+ + + V  +++N P F   + + +I+EN      V Q+ A      ENA +S+ +            ++ F+V    G I T  + DRE    Y+L +   D+ +   +  +++                      I + V D ND SP +       L++ +   PG  +  + A+D D G N  + + I          +  N G+   F ++SS+G L    + +  HS    L  +ASD GQP     H
Sbjct: 1238 ARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPT---SGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWP--QDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLF--ISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGV-------ANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPG-VIHTVVASDLDEGPNADLIYSI----------TGGNLGNK--FSIDSSSGELSARPLDREQHS-RYTLQIQASDRGQPKSRQGH 1935          

HSP 9 Score: 105.145 bits (261), Expect = 3.569e-22
Identity = 168/700 (24.00%), Postives = 297/700 (42.43%), Query Frame = 1
Query:  646 FFIVTEEGKILVRKLIDLETLCSQYKLCCGEPVCILKANILLNNKEKEVVSSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNSFILDISQLPSIFLKVSKK--LDFEEKKQYHAKLKACDEDNCTTQNLI---IHIKDENDNQP-IFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARD-SDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSL--KIQEEIP-SKLITTLQIVDQ--DKGPNGI--------VYCHLDPVC----EGSFELQNRSKDIYSLRSV-RKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKS--AVLKYQIDNY----------GAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSD---TEPKTASVEVKITVLDANDNSPLF------STNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLPTGHIETLLKL-----DREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQLQATDRDVGANGKVRFEI 2592
            F I    G I +R  +D ET   +Y+L            +  +N      +   + V++LD ND++P F+  + +  I E  + G  + + +A+D D      I+ Y L    +SF     Q+  +  ++S +  LD E ++ Y   ++A D+        +   IH+ D NDN P I + +   ++++E+   G+ + +V+A DRD G   +I YSI    D+D    F ++  SG I+ +  L    RS Y   + A D  +P  P++++  + + V D+ND++P        SSL  +++E+     ++ ++  +++  D   N +        V   L+P+     E +F++   S ++   R + R+   E   +I A+         S  S   + I + D+N+  P +      L   V E +  GT +    A D D      L+Y++  Y              F +D  +G +     L D E V      V  +D     TE    SV V++ +LDAND++P F              I + T   ++V  I A D D  +N  +++ +    NG    R ++      TG IE +  L     D E    + L I A D  + P+ P  S +N+ L V   ++  P +         I + +  G  +LQ+ A       N  + +EI
Sbjct: 1096 FGIFPNSGWIYLRAPLDRET-RDRYQLTV----------LATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIR-YSLLPINSSF-----QVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNP--PRETVRMLRVEVLDLNDNRPTFTS----SSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQS--SAITVKIEVADVNDNAPEWPQDPIDL--QVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPL-DFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEI-TGGNGEGRFRINSQ-----TGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQ-PE-PKKSSLNLHLIVQGSHNNPPRFLQAVYRA-TILENVPSGSFVLQVTAKSLHGAENANLSYEI 1758          

HSP 10 Score: 102.834 bits (255), Expect = 1.911e-21
Identity = 167/690 (24.20%), Postives = 283/690 (41.01%), Query Frame = 1
Query:  808 IQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQ---NYKLDEPTNSFILDISQLPSIFLKVSKKLDFEEKKQYHAKLKACDEDNC---TTQNLIIHIKDENDNQP----IFETETYNLTIKEDVQIGSIIGQVKANDRDSGL-FGTIKYSIRTDFDTDIQSTFYVETLSGRIKL---KKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIPSKLITTLQIV--DQDKGPNGIVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQD--KSAVLKYQIDNYGAEY---FEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIE-----NTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLPTGHIETLL--KLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQML--HSGTVILLFRASDYGQPAKYSDHKLVINI 2787
            + + I D ND+ PIF        + E + +G S+    A+D D      ++   N +  +    F +D  +  +I+  ++K LDFE K+ +   + A D       TT  + I + D NDNQP    IF ++  +  I E  Q G  + ++  +D DS   +  +  ++           F + T    I L      L     S Y   +VA D     P  +  S+ + + DVND+ PE     DL    +  E+     + LQ++  D+D+G N  +   L    E   +          + +    D E E      V+ +D G P L S   + + I D+N+  P F D+S Y +  V EN   G  ++ V A D D   +A++ Y I   G ++   FE+   SG I C    +D ER SS  F V   D      TA +++++T  D NDN P+F     + S+ E     +   S  +  + ATD D      +S+ +  + N   + R D       TG I  +    L      +++L I A+D      +   +   + L ++D     P +     N     D  R G  +  + A   DV     VR+ I            ++     YF + +++G + I++ L   + + +LL   +  G+P  Y   ++ I +
Sbjct:  272 VNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRID-PRTGAIY--INKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGG-----DGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKG-TPPLHASKSIFLRITDVNDNPPEFE--QDLYHANVM-EVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIF-DQSFYNVS-VAENEPVGRCILKVSASDPDCGVNAMVNYTIGE-GFKHLTEFEVRSASGEI-CIAGELDFERRSSYEFPVLATDRGGLSTTAMIKMQLT--DVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIV-AGNEAGIFRIDR-----STGEIFVVRPDMLSVRTQPMHMLNISATDGGN---LRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPR-GTVVGSVIAASGDVAHRSPVRYSI------------YSGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQATLGEPPVYGHTQVNIEV 921          

HSP 11 Score: 93.2041 bits (230), Expect = 1.647e-18
Identity = 166/731 (22.71%), Postives = 305/731 (41.72%), Query Frame = 1
Query:  628 FITESDFFIVTEEGKILVRKLIDLETLCSQYKLCCGEPVCILKANILLNNKEKEVVSSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNSFILDISQLPSIF--------LKVSKKLDFEEKKQYHAKLKACDEDNCTTQNLIIHIKDENDNQPIFETE---TYNLT------IKEDVQIGSIIGQVKANDRDS-GLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKL---KKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDH-KPEIRIIADLSSLKIQEEIPSKLITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEP-----SLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDK----SAVLKYQIDNYGAEY-FEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVE-VKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSL------RNSWNGNTMQRHDNYFNVLPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLL-QLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQML 2700
            F+ E  F  +     +L R++ D+      YKL            I  +    ++  +  I+VQI+D ND+ P F  P   + +SE +++G  I+  SA D D    Y    Y+L   +    +DI  + SIF        L + ++LD+E +++Y   + A D  +     L + + DENDN P+F  +    Y         I E + +   +  V A D DS G    + Y I        Q  F V   +G + +   + + +  +   Y  RI+A+D+     K +L S T+L    ND+     + + +    +I E  P  L + +  + QD     +     +   E +FEL  +SK I  ++ + +  +++ +    +V+    G P     +  S   + I I D N+  P F D+S      + E +     +  ++A D D+    ++ + Y I +   E+ F ID  +G++   N L       S    +   DS  +    S++  ++ + D NDN P F        + EN      V + +A+D D+     +++S+       +SW    M R D+      +G + +    D E    Y +E++ASD          + V + + +   ++ +P +T      +       P  +++ Q+ ATD D G +G+V +++   +               +F VN S+GA+ I + L
Sbjct: 2370 FVIEPAFSGIVRTNIVLDREIRDI------YKLKI----------IATDEGVPQMTGTATIRVQIVDVNDNQPTF-PPNNLVTVSEATELGAVITSISANDVD---TYPALTYRLGAEST---VDIENM-SIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAHEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEP-----AQEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAG----KPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAP--LGSVVLQLGQDALDQSLAIIAGNE--ESAFELL-QSKAIVLVKPLDRERNDLYKL--RLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIF-DRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWK---MFRVDS-----ESGLVTSAFVFDYEQRQRYDMELLASDMGGK-----KASVAVRVEIESRDEFTPQFTERTYRFVLPAAVALPQGYVVGQVTATDSDSGPDGRVVYQLSAPH--------------SHFKVNRSSGAVLIKRKL 3032          

HSP 12 Score: 85.5001 bits (210), Expect = 3.679e-16
Identity = 105/446 (23.54%), Postives = 187/446 (41.93%), Query Frame = 1
Query:  541 QMHEEIPPNSEIGSILSAIPHNLRSTSLEFIT---ESDFFIVTEEGKILVRKLIDLETLCSQYKLCCGEPVCILKANILLNNKEKEVVSSVEIQVQILDKNDHNPIFE-TPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNSFILDISQ----------LPSIFLKVSKKLDFEE-KKQYHAKLKACDEDN----CTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIR-TDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIPSK-LITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHE------VEQKIDAIVICKDQGEP-SLESRKIIPIIITDL 1794
            Q   +I   + +GS++  +  +    SL  I    ES F ++  +  +LV+ L        + +L    P      + L ++    V+      + ILD ND+ PIF+ + + +  ISE + +  SI+   A D D            + P +  + DI+           L +  L V+ +LD++   K Y   ++ACD  +    C+ Q   + + DENDN+P F    Y   + E+  +GS + +  A+D D G FG + YSI     D      F V++ SG +          R RY   ++A D   +  K++  +V + +E  ++  P+         L     +P   ++  +   D D GP+G V   L       F++ NRS     ++   K D +      ++ +  ++VI    G   SL S  ++ I +  L
Sbjct: 2652 QYRAQISEAAPLGSVVLQLGQDALDQSLAIIAGNEESAFELLQSKAIVLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVI------ITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQE----------NTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASD---MGGKKASVAVRVEIESRDEFTPQFTERTYRFVLPAAVALPQGYVVGQVTATDSDSGPDGRVVYQLS-APHSHFKV-NRSSGAVLIKRKLKLDGDGDGNLYMDGRDISLVISASSGRHNSLSSMAVVEIALDPL 3076          
BLAST of Protocadherin-9 vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0304899)

HSP 1 Score: 198.749 bits (504), Expect = 9.527e-51
Identity = 189/674 (28.04%), Postives = 309/674 (45.85%), Query Frame = 1
Query:  808 IQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNSFILDISQLPSIF--------LKVSKKLDFEEKKQYHAKLKACD------EDNCTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGS---IIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQS-LCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIPSKL-ITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKSAVLKYQI--DNYGAEYFEIDQNS-GLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLP-TGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQMLHSGTVILLFR---ASDYGQP 2751
            +QV +LD NDH+P FE  + +  I E + +G ++    ATD+D      I+ Y ++  T+   L   Q   IF        +     LD E    YH  + A D      E    T ++ + + D+NDN P F   TY + + ED   G+    +  ++A D D G    I+Y+I      + QS F ++++SG + L K L     S   +R+V R  D  +P +S    + + V D ND+ P  R         + E +P    I  +Q  D D+G N  +   +    + +F L    +  + +++++  D E + +    V+ KD G P   +   + I + D+N+  P F  K  Y   +V E+   GT V TV A D D+ + L Y+I   N    +    QN  GLI    +L D ++      TV   DS     TA+V + IT  DAN+ +P+F       S+ E+      V  ++ATD+D   NA I++SL N  + N +   D  F++ P TG I T   LDRE    Y+L + A D        L+   ++ + V D ND +P +  P      + D +  G  ++Q+ A+D DVG NG++++ ++     EDGS          F+++ ++G +  ++ L   +V +      A D G P
Sbjct:  450 LQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIE-YGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAI---IGGNTQSQFSIDSMSGDVSLVKPLD--YESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAP--RFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISER-DDNFPLAVDPRTGW-VQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPK--YYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSL-DYKQEKRFLLTVAATDSGGRSDTATVHINIT--DANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSL-NEESINGLGSPDP-FSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNP---SLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDAL-VGTSVIQVAASDPDVGLNGRIKY-LLSDRDIEDGS----------FVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSP 1091          

HSP 2 Score: 184.111 bits (466), Expect = 3.110e-46
Identity = 189/667 (28.34%), Postives = 307/667 (46.03%), Query Frame = 1
Query:  646 FFIVTEEGKILVRKLIDLETLCSQYKLCCGEPVCILKANILLNNKEKEVVSSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGI---SISLTSATDKDHSSQYRIQNYKLDEPTNS-FILDISQLPSIFLKVSKKLDFEEKKQYHAKLKACDEDNCTTQN---LIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIPSKLITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNR-SKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKS--AVLKY-----QIDNYGA-EYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLPT-GHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQLQATDRDVGANGKVRFEII 2595
            F I +  G I  R  +D ET    Y L       ++ A  L + + +   ++  +QV++LD ND+ P F      + + E    G    +++   ATD D  +   I+   +   T S F +D     S  + + K LD+E  + Y   ++A D  + +  N   L++++ D NDN P F T  +  ++ E+V +G  I +V+A D D G    I YSI    + D      V+  +G ++  K L    + R+ F++VA+D   + PK +  SV I V+DVND+ P        +++  +++ P   +TT+   D D+    + Y        G F + ++  + + ++   +  D++ E++    V   D G  S      + I ITD N F P F++        V+E++  GT V+ V A D D    A + Y      I+  G+ + F I+  +G I  TN  +DRE  S    TV   D      + + +V+I V D NDN+P F + L Q SI+E+      V Q+ A+D D   N  I + L +          D  F + PT G I T   LDRE   ++ L  +A D   SP  PL+S V + +R+ D ND  PT+   D   L + +    G  + ++ A D D G N  V + II
Sbjct:  521 FRIDSRSGVISTRSSLDRET-SDSYHL-------LVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSM---SGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSIS---ERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGG-VPPKSASSSVVITVQDVNDNDPAFNPKYYEANVG-EDQPPGTPVTTVTATDPDEDSR-LHYEITTGNTRGRFAITSQNGRGLITI--AQSLDYKQEKRFLLTVAATDSGGRS--DTATVHINITDANNFAPIFENAP--YSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAI-VTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSD------RDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKG-SP--PLSSTVEVQIRLEDVNDSPPTFAS-DKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSII 1153          

HSP 3 Score: 147.902 bits (372), Expect = 3.573e-35
Identity = 176/708 (24.86%), Postives = 312/708 (44.07%), Query Frame = 1
Query:  634 TESDFFIVTEEGKILVRKLIDLETLCSQYKLCCGEPVCILKANILLNNKEKEVVSSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNSFILDISQLPSIFLKVSKKLDFEEKKQYHAKLKACDED---NCTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGR--IKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIPSKLITTLQIVDQDKGPNGIVYCHLDPVC---EGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKS--AVLKYQIDNYGAE--YFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLP-----TGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQMLHS 2706
            T+S F I +  G + + K +D E++ S Y+L       +++A    +       ++ ++ V ++D ND+ P F T + +  + E   +G +I    A D D  +   I  Y + E  ++F L +      +++  K LD EE+ ++  ++ A D        + +++I ++D NDN P F  + Y   + ED   G+ +  V A D D      + Y I T    + +  F + + +GR  I + + L      R+   + A DS     +    +V I + D N+  P I   A  S+   ++      +  +   D D G N  +   L+       GS +  + +    ++ +    D E        V  KD G PSL     + I +TD+N+  P FK  S      + E++  GT V+ V A D D      +KY + +   E   F ID  SG IR TN  +DRE V+    T   +D  + P +++VEV+I + D ND+ P F+++     + EN+    +VG+I+A D D+  NA++ +S+    + N        F+++         + T+ +LD E        ++    A SP  PL +  +I + V D ND +P          N  D   P   + ++ A D DV  + K+ + I+            +  ++    +NSS+G L +S  L++
Sbjct:  628 TQSQFSIDSMSGDVSLVKPLDYESVRS-YRL-------VIRAQ---DGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEI-TYSISERDDNFPLAVDPRTG-WVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDED--SRLHYEITTG---NTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDS---GGRSDTATVHINITDANNFAP-IFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFK--SPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIR-TNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNA-------FSLVTRPGSERAQLLTMTELDYESTRKRFELVV---RAASP--PLRNDAHIEILVTDVNDNAPVLRDFQVIFNNFRDHF-PSGEIGRIPAFDADV--SDKLHYRIL------------SGNNANLLRLNSSSGGLVLSPQLNT 1283          

HSP 4 Score: 138.658 bits (348), Expect = 2.109e-32
Identity = 165/665 (24.81%), Postives = 282/665 (42.41%), Query Frame = 1
Query:  835 DHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNSFILDISQLPSIFLKVSKKLDFEEKKQYHAKLKACDED---NCTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIR--TDFDTDIQST----FYVETLSGRIKLKKKLSTFTRSRYPFRIVARD--SDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEE----IPSKLITTLQIVDQDKGPN-GIVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKS--AVLKYQIDNYGAEY-FEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLPT---GHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQMLHSGTV---ILLFRASDYGQPA 2754
            + +P FE       + E    G +++   A D + S         LD  + S     S+  +  +  S  LD E    ++ ++ A D+       T  L +++ D ND+ P FE E +  +I+E   +GS +  ++A D+D G    I+Y I   TD     Q      F +++ SG I  +  L   T   Y   + A D  S     + +  SV + V D ND+ P+        ++++ E+         +  ++  D D+G N  I Y  +    +  F + + S D+ SL  V+  D+E  +    ++  +D G PS  +   + + + D N+  P F   SQ+    V EN   G  ++ V+A D D+   A + Y I      +   +D  +G ++ T   +DRE     +F V   D    PK+AS  V ITV D NDN P F+    + ++ E+  P   V  + ATD D+D       +      GNT  R    F +      G I     LD +    ++L + A+DS        +    + + + D N+ +P + +   +  ++ +    G  +L + ATD DVG N ++ + + ++       S    GS   F +N  TGA+  +  L   T    +L   A D G P+
Sbjct:  354 NQSPYFEQALYVASVLEEQPAGAAVTTVRARDPEDSPVVYSMVSLLDSRSQSLFKVDSR--TGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFS--ERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDV-SL--VKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFY-TSQFQES-VLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQ-TIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEIT-----TGNTRGR----FAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGR-----SDTATVHINITDANNFAPIFENAPYSA-SVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEE-------SINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPS 986          

HSP 5 Score: 106.301 bits (264), Expect = 1.617e-22
Identity = 92/349 (26.36%), Postives = 163/349 (46.70%), Query Frame = 1
Query: 1804 RPTFKDKSQYL-----LGHVWENSEFGTKVMTVKAQDQDKSAVLKYQI---DNYGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNY--FNV-LPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTH-------PDNNILNITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQMLHSGTV---ILLFRASDYGQPAKYSDHKLVINI 2787
            R   +++S Y      +  V E    G  V TV+A+D + S V+   +   D+     F++D  +G++  T+  +DRE +    F V   D    P++ +  +++ VLD ND+SP F     + SI E       V  + ATD D  +NA I + +    +G  + +      F +   +G I T   LDRE  D Y L + A+D A +     T+  ++ ++VLD+ND  P ++        P++      D       +  ++ATD D G N  +R+ II       G ++ +Q     F ++S +G + + + L   +V    L+ RA D G P++ +  +L++N+
Sbjct:  349 RRELRNQSPYFEQALYVASVLEEQPAGAAVTTVRARDPEDSPVVYSMVSLLDSRSQSLFKVDSRTGVV-TTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNT-----VAHIRATDADQGNNAAIRYAII-------GGNTQSQ-----FSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNV 679          
BLAST of Protocadherin-9 vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0300578)

HSP 1 Score: 198.749 bits (504), Expect = 9.527e-51
Identity = 189/674 (28.04%), Postives = 309/674 (45.85%), Query Frame = 1
Query:  808 IQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNSFILDISQLPSIF--------LKVSKKLDFEEKKQYHAKLKACD------EDNCTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGS---IIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQS-LCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIPSKL-ITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKSAVLKYQI--DNYGAEYFEIDQNS-GLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLP-TGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQMLHSGTVILLFR---ASDYGQP 2751
            +QV +LD NDH+P FE  + +  I E + +G ++    ATD+D      I+ Y ++  T+   L   Q   IF        +     LD E    YH  + A D      E    T ++ + + D+NDN P F   TY + + ED   G+    +  ++A D D G    I+Y+I      + QS F ++++SG + L K L     S   +R+V R  D  +P +S    + + V D ND+ P  R         + E +P    I  +Q  D D+G N  +   +    + +F L    +  + +++++  D E + +    V+ KD G P   +   + I + D+N+  P F  K  Y   +V E+   GT V TV A D D+ + L Y+I   N    +    QN  GLI    +L D ++      TV   DS     TA+V + IT  DAN+ +P+F       S+ E+      V  ++ATD+D   NA I++SL N  + N +   D  F++ P TG I T   LDRE    Y+L + A D        L+   ++ + V D ND +P +  P      + D +  G  ++Q+ A+D DVG NG++++ ++     EDGS          F+++ ++G +  ++ L   +V +      A D G P
Sbjct:  450 LQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIE-YGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAI---IGGNTQSQFSIDSMSGDVSLVKPLD--YESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAP--RFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISER-DDNFPLAVDPRTGW-VQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPK--YYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSL-DYKQEKRFLLTVAATDSGGRSDTATVHINIT--DANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSL-NEESINGLGSPDP-FSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNP---SLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDAL-VGTSVIQVAASDPDVGLNGRIKY-LLSDRDIEDGS----------FVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSP 1091          

HSP 2 Score: 184.111 bits (466), Expect = 3.110e-46
Identity = 189/667 (28.34%), Postives = 307/667 (46.03%), Query Frame = 1
Query:  646 FFIVTEEGKILVRKLIDLETLCSQYKLCCGEPVCILKANILLNNKEKEVVSSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGI---SISLTSATDKDHSSQYRIQNYKLDEPTNS-FILDISQLPSIFLKVSKKLDFEEKKQYHAKLKACDEDNCTTQN---LIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIPSKLITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNR-SKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKS--AVLKY-----QIDNYGA-EYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLPT-GHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQLQATDRDVGANGKVRFEII 2595
            F I +  G I  R  +D ET    Y L       ++ A  L + + +   ++  +QV++LD ND+ P F      + + E    G    +++   ATD D  +   I+   +   T S F +D     S  + + K LD+E  + Y   ++A D  + +  N   L++++ D NDN P F T  +  ++ E+V +G  I +V+A D D G    I YSI    + D      V+  +G ++  K L    + R+ F++VA+D   + PK +  SV I V+DVND+ P        +++  +++ P   +TT+   D D+    + Y        G F + ++  + + ++   +  D++ E++    V   D G  S      + I ITD N F P F++        V+E++  GT V+ V A D D    A + Y      I+  G+ + F I+  +G I  TN  +DRE  S    TV   D      + + +V+I V D NDN+P F + L Q SI+E+      V Q+ A+D D   N  I + L +          D  F + PT G I T   LDRE   ++ L  +A D   SP  PL+S V + +R+ D ND  PT+   D   L + +    G  + ++ A D D G N  V + II
Sbjct:  521 FRIDSRSGVISTRSSLDRET-SDSYHL-------LVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSM---SGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSIS---ERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGG-VPPKSASSSVVITVQDVNDNDPAFNPKYYEANVG-EDQPPGTPVTTVTATDPDEDSR-LHYEITTGNTRGRFAITSQNGRGLITI--AQSLDYKQEKRFLLTVAATDSGGRS--DTATVHINITDANNFAPIFENAP--YSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAI-VTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSD------RDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKG-SP--PLSSTVEVQIRLEDVNDSPPTFAS-DKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSII 1153          

HSP 3 Score: 147.902 bits (372), Expect = 3.573e-35
Identity = 176/708 (24.86%), Postives = 312/708 (44.07%), Query Frame = 1
Query:  634 TESDFFIVTEEGKILVRKLIDLETLCSQYKLCCGEPVCILKANILLNNKEKEVVSSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNSFILDISQLPSIFLKVSKKLDFEEKKQYHAKLKACDED---NCTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGR--IKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIPSKLITTLQIVDQDKGPNGIVYCHLDPVC---EGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKS--AVLKYQIDNYGAE--YFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLP-----TGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQMLHS 2706
            T+S F I +  G + + K +D E++ S Y+L       +++A    +       ++ ++ V ++D ND+ P F T + +  + E   +G +I    A D D  +   I  Y + E  ++F L +      +++  K LD EE+ ++  ++ A D        + +++I ++D NDN P F  + Y   + ED   G+ +  V A D D      + Y I T    + +  F + + +GR  I + + L      R+   + A DS     +    +V I + D N+  P I   A  S+   ++      +  +   D D G N  +   L+       GS +  + +    ++ +    D E        V  KD G PSL     + I +TD+N+  P FK  S      + E++  GT V+ V A D D      +KY + +   E   F ID  SG IR TN  +DRE V+    T   +D  + P +++VEV+I + D ND+ P F+++     + EN+    +VG+I+A D D+  NA++ +S+    + N        F+++         + T+ +LD E        ++    A SP  PL +  +I + V D ND +P          N  D   P   + ++ A D DV  + K+ + I+            +  ++    +NSS+G L +S  L++
Sbjct:  628 TQSQFSIDSMSGDVSLVKPLDYESVRS-YRL-------VIRAQ---DGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEI-TYSISERDDNFPLAVDPRTG-WVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDED--SRLHYEITTG---NTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDS---GGRSDTATVHINITDANNFAP-IFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFK--SPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIR-TNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNA-------FSLVTRPGSERAQLLTMTELDYESTRKRFELVV---RAASP--PLRNDAHIEILVTDVNDNAPVLRDFQVIFNNFRDHF-PSGEIGRIPAFDADV--SDKLHYRIL------------SGNNANLLRLNSSSGGLVLSPQLNT 1283          

HSP 4 Score: 138.658 bits (348), Expect = 2.109e-32
Identity = 165/665 (24.81%), Postives = 282/665 (42.41%), Query Frame = 1
Query:  835 DHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNSFILDISQLPSIFLKVSKKLDFEEKKQYHAKLKACDED---NCTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIR--TDFDTDIQST----FYVETLSGRIKLKKKLSTFTRSRYPFRIVARD--SDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEE----IPSKLITTLQIVDQDKGPN-GIVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKS--AVLKYQIDNYGAEY-FEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLPT---GHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQMLHSGTV---ILLFRASDYGQPA 2754
            + +P FE       + E    G +++   A D + S         LD  + S     S+  +  +  S  LD E    ++ ++ A D+       T  L +++ D ND+ P FE E +  +I+E   +GS +  ++A D+D G    I+Y I   TD     Q      F +++ SG I  +  L   T   Y   + A D  S     + +  SV + V D ND+ P+        ++++ E+         +  ++  D D+G N  I Y  +    +  F + + S D+ SL  V+  D+E  +    ++  +D G PS  +   + + + D N+  P F   SQ+    V EN   G  ++ V+A D D+   A + Y I      +   +D  +G ++ T   +DRE     +F V   D    PK+AS  V ITV D NDN P F+    + ++ E+  P   V  + ATD D+D       +      GNT  R    F +      G I     LD +    ++L + A+DS        +    + + + D N+ +P + +   +  ++ +    G  +L + ATD DVG N ++ + + ++       S    GS   F +N  TGA+  +  L   T    +L   A D G P+
Sbjct:  354 NQSPYFEQALYVASVLEEQPAGAAVTTVRARDPEDSPVVYSMVSLLDSRSQSLFKVDSR--TGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFS--ERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDV-SL--VKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFY-TSQFQES-VLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQ-TIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEIT-----TGNTRGR----FAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGR-----SDTATVHINITDANNFAPIFENAPYSA-SVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEE-------SINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPS 986          

HSP 5 Score: 106.301 bits (264), Expect = 1.617e-22
Identity = 92/349 (26.36%), Postives = 163/349 (46.70%), Query Frame = 1
Query: 1804 RPTFKDKSQYL-----LGHVWENSEFGTKVMTVKAQDQDKSAVLKYQI---DNYGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNY--FNV-LPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTH-------PDNNILNITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQMLHSGTV---ILLFRASDYGQPAKYSDHKLVINI 2787
            R   +++S Y      +  V E    G  V TV+A+D + S V+   +   D+     F++D  +G++  T+  +DRE +    F V   D    P++ +  +++ VLD ND+SP F     + SI E       V  + ATD D  +NA I + +    +G  + +      F +   +G I T   LDRE  D Y L + A+D A +     T+  ++ ++VLD+ND  P ++        P++      D       +  ++ATD D G N  +R+ II       G ++ +Q     F ++S +G + + + L   +V    L+ RA D G P++ +  +L++N+
Sbjct:  349 RRELRNQSPYFEQALYVASVLEEQPAGAAVTTVRARDPEDSPVVYSMVSLLDSRSQSLFKVDSRTGVV-TTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNT-----VAHIRATDADQGNNAAIRYAII-------GGNTQSQ-----FSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNV 679          
BLAST of Protocadherin-9 vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0330601)

HSP 1 Score: 198.749 bits (504), Expect = 1.062e-50
Identity = 189/674 (28.04%), Postives = 309/674 (45.85%), Query Frame = 1
Query:  808 IQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNSFILDISQLPSIF--------LKVSKKLDFEEKKQYHAKLKACD------EDNCTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGS---IIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQS-LCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIPSKL-ITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKSAVLKYQI--DNYGAEYFEIDQNS-GLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLP-TGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQMLHSGTVILLFR---ASDYGQP 2751
            +QV +LD NDH+P FE  + +  I E + +G ++    ATD+D      I+ Y ++  T+   L   Q   IF        +     LD E    YH  + A D      E    T ++ + + D+NDN P F   TY + + ED   G+    +  ++A D D G    I+Y+I      + QS F ++++SG + L K L     S   +R+V R  D  +P +S    + + V D ND+ P  R         + E +P    I  +Q  D D+G N  +   +    + +F L    +  + +++++  D E + +    V+ KD G P   +   + I + D+N+  P F  K  Y   +V E+   GT V TV A D D+ + L Y+I   N    +    QN  GLI    +L D ++      TV   DS     TA+V + IT  DAN+ +P+F       S+ E+      V  ++ATD+D   NA I++SL N  + N +   D  F++ P TG I T   LDRE    Y+L + A D        L+   ++ + V D ND +P +  P      + D +  G  ++Q+ A+D DVG NG++++ ++     EDGS          F+++ ++G +  ++ L   +V +      A D G P
Sbjct:  450 LQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIE-YGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAI---IGGNTQSQFSIDSMSGDVSLVKPLD--YESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAP--RFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISER-DDNFPLAVDPRTGW-VQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPK--YYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSL-DYKQEKRFLLTVAATDSGGRSDTATVHINIT--DANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSL-NEESINGLGSPDP-FSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNP---SLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDAL-VGTSVIQVAASDPDVGLNGRIKY-LLSDRDIEDGS----------FVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSP 1091          

HSP 2 Score: 184.111 bits (466), Expect = 3.435e-46
Identity = 189/667 (28.34%), Postives = 307/667 (46.03%), Query Frame = 1
Query:  646 FFIVTEEGKILVRKLIDLETLCSQYKLCCGEPVCILKANILLNNKEKEVVSSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGI---SISLTSATDKDHSSQYRIQNYKLDEPTNS-FILDISQLPSIFLKVSKKLDFEEKKQYHAKLKACDEDNCTTQN---LIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIPSKLITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNR-SKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKS--AVLKY-----QIDNYGA-EYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLPT-GHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQLQATDRDVGANGKVRFEII 2595
            F I +  G I  R  +D ET    Y L       ++ A  L + + +   ++  +QV++LD ND+ P F      + + E    G    +++   ATD D  +   I+   +   T S F +D     S  + + K LD+E  + Y   ++A D  + +  N   L++++ D NDN P F T  +  ++ E+V +G  I +V+A D D G    I YSI    + D      V+  +G ++  K L    + R+ F++VA+D   + PK +  SV I V+DVND+ P        +++  +++ P   +TT+   D D+    + Y        G F + ++  + + ++   +  D++ E++    V   D G  S      + I ITD N F P F++        V+E++  GT V+ V A D D    A + Y      I+  G+ + F I+  +G I  TN  +DRE  S    TV   D      + + +V+I V D NDN+P F + L Q SI+E+      V Q+ A+D D   N  I + L +          D  F + PT G I T   LDRE   ++ L  +A D   SP  PL+S V + +R+ D ND  PT+   D   L + +    G  + ++ A D D G N  V + II
Sbjct:  521 FRIDSRSGVISTRSSLDRET-SDSYHL-------LVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSM---SGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSIS---ERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGG-VPPKSASSSVVITVQDVNDNDPAFNPKYYEANVG-EDQPPGTPVTTVTATDPDEDSR-LHYEITTGNTRGRFAITSQNGRGLITI--AQSLDYKQEKRFLLTVAATDSGGRS--DTATVHINITDANNFAPIFENAP--YSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAI-VTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSD------RDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKG-SP--PLSSTVEVQIRLEDVNDSPPTFAS-DKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSII 1153          

HSP 3 Score: 147.902 bits (372), Expect = 3.559e-35
Identity = 176/708 (24.86%), Postives = 312/708 (44.07%), Query Frame = 1
Query:  634 TESDFFIVTEEGKILVRKLIDLETLCSQYKLCCGEPVCILKANILLNNKEKEVVSSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNSFILDISQLPSIFLKVSKKLDFEEKKQYHAKLKACDED---NCTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGR--IKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIPSKLITTLQIVDQDKGPNGIVYCHLDPVC---EGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKS--AVLKYQIDNYGAE--YFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLP-----TGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQMLHS 2706
            T+S F I +  G + + K +D E++ S Y+L       +++A    +       ++ ++ V ++D ND+ P F T + +  + E   +G +I    A D D  +   I  Y + E  ++F L +      +++  K LD EE+ ++  ++ A D        + +++I ++D NDN P F  + Y   + ED   G+ +  V A D D      + Y I T    + +  F + + +GR  I + + L      R+   + A DS     +    +V I + D N+  P I   A  S+   ++      +  +   D D G N  +   L+       GS +  + +    ++ +    D E        V  KD G PSL     + I +TD+N+  P FK  S      + E++  GT V+ V A D D      +KY + +   E   F ID  SG IR TN  +DRE V+    T   +D  + P +++VEV+I + D ND+ P F+++     + EN+    +VG+I+A D D+  NA++ +S+    + N        F+++         + T+ +LD E        ++    A SP  PL +  +I + V D ND +P          N  D   P   + ++ A D DV  + K+ + I+            +  ++    +NSS+G L +S  L++
Sbjct:  628 TQSQFSIDSMSGDVSLVKPLDYESVRS-YRL-------VIRAQ---DGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEI-TYSISERDDNFPLAVDPRTG-WVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDED--SRLHYEITTG---NTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDS---GGRSDTATVHINITDANNFAP-IFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFK--SPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIR-TNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNA-------FSLVTRPGSERAQLLTMTELDYESTRKRFELVV---RAASP--PLRNDAHIEILVTDVNDNAPVLRDFQVIFNNFRDHF-PSGEIGRIPAFDADV--SDKLHYRIL------------SGNNANLLRLNSSSGGLVLSPQLNT 1283          

HSP 4 Score: 138.658 bits (348), Expect = 2.209e-32
Identity = 165/665 (24.81%), Postives = 282/665 (42.41%), Query Frame = 1
Query:  835 DHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNSFILDISQLPSIFLKVSKKLDFEEKKQYHAKLKACDED---NCTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIR--TDFDTDIQST----FYVETLSGRIKLKKKLSTFTRSRYPFRIVARD--SDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEE----IPSKLITTLQIVDQDKGPN-GIVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKS--AVLKYQIDNYGAEY-FEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLP---TGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQMLHSGTV---ILLFRASDYGQPA 2754
            + +P FE       + E    G +++   A D + S         LD  + S     S+  +  +  S  LD E    ++ ++ A D+       T  L +++ D ND+ P FE E +  +I+E   +GS +  ++A D+D G    I+Y I   TD     Q      F +++ SG I  +  L   T   Y   + A D  S     + +  SV + V D ND+ P+        ++++ E+         +  ++  D D+G N  I Y  +    +  F + + S D+ SL  V+  D+E  +    ++  +D G PS  +   + + + D N+  P F   SQ+    V EN   G  ++ V+A D D+   A + Y I      +   +D  +G ++ T   +DRE     +F V   D    PK+AS  V ITV D NDN P F+    + ++ E+  P   V  + ATD D+D       +      GNT  R    F +      G I     LD +    ++L + A+DS        +    + + + D N+ +P + +   +  ++ +    G  +L + ATD DVG N ++ + + ++       S    GS   F +N  TGA+  +  L   T    +L   A D G P+
Sbjct:  354 NQSPYFEQALYVASVLEEQPAGAAVTTVRARDPEDSPVVYSMVSLLDSRSQSLFKVDSR--TGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFS--ERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDV-SL--VKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFY-TSQFQES-VLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQ-TIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEIT-----TGNTRGR----FAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGR-----SDTATVHINITDANNFAPIFENAPYSA-SVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEE-------SINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPS 986          

HSP 5 Score: 106.301 bits (264), Expect = 1.595e-22
Identity = 92/349 (26.36%), Postives = 163/349 (46.70%), Query Frame = 1
Query: 1804 RPTFKDKSQYL-----LGHVWENSEFGTKVMTVKAQDQDKSAVLKYQI---DNYGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNY--FNV-LPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTH-------PDNNILNITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQMLHSGTV---ILLFRASDYGQPAKYSDHKLVINI 2787
            R   +++S Y      +  V E    G  V TV+A+D + S V+   +   D+     F++D  +G++  T+  +DRE +    F V   D    P++ +  +++ VLD ND+SP F     + SI E       V  + ATD D  +NA I + +    +G  + +      F +   +G I T   LDRE  D Y L + A+D A +     T+  ++ ++VLD+ND  P ++        P++      D       +  ++ATD D G N  +R+ II       G ++ +Q     F ++S +G + + + L   +V    L+ RA D G P++ +  +L++N+
Sbjct:  349 RRELRNQSPYFEQALYVASVLEEQPAGAAVTTVRARDPEDSPVVYSMVSLLDSRSQSLFKVDSRTGVV-TTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNT-----VAHIRATDADQGNNAAIRYAII-------GGNTQSQ-----FSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNV 679          
BLAST of Protocadherin-9 vs. Ensembl Zebrafish
Match: CT030123.1 (protocadherin 1b [Source:NCBI gene;Acc:572016])

HSP 1 Score: 255.373 bits (651), Expect = 2.380e-69
Identity = 242/838 (28.88%), Postives = 380/838 (45.35%), Query Frame = 1
Query:  433 LNKIKTTCLYYLQIMIWFIVIFC-----VNTVLALSDKISIQMHEEIPPNSEIGSILS--AIPHNLRSTSLEFITESDFFIVTEEGKILV-RKLIDLETLCSQYKLCCGEPVCILKANILLNNKEKEVVSS-VEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLD---EPTNSFILDISQ-----LPSIFLKVSKKLDFEEKKQYHAKLKACDEDNCTTQN---LIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIA------DLSSLKIQEEIP-SKLITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNRS--------KDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKS--AVLKYQIDNYGA--EYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITD-TMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQML---HSGTVILLFRASDYGQPAKYSDHKLVINIFGDES-GNLN 2814
            L  +  + L+   +++W +++ C     VNT+L        Q+ EE PPN+ IGS+ S   +P       LE +      +  + G I      ID E+L     L  G+P C L+  + + +  K      +E +++ILD+ND+ P F +P   + I E + +G   ++  ATD+D  S   I +Y L    E TN F L ++Q     LP +   V   LD E +  Y   +K  D  +   Q+   L I I D NDN P FE   Y   + E+  +G  + QVKAND D G  G + YS+     + +     ++  +G I +K  +     S   F + A+D+ P   K S   VTI V+D ND+ P IRI        +     I E++P    +  +++ D+D+G N +V C    V  G    Q RS        K  Y L++    D+E  ++    ++  D G P+L S   + + +TD+N+  P F   + Y +   +E ++ G KV+ V A D D    A L Y I         FEI+ N+G +R  + L DRE++    F V   D        +  V + VLD NDN P F  N   FS+ EN  P   VG +   D D+ ENA +  S+    NG  M ++  Y        I + +  DRE    Y   + A D    P+   +S V IT+ VLDEND +P  T P N+     D    P  H+  ++A D D+G N ++ F I+              G+       SS G + +++     H G   L+ +  D G P + +    +++I+ +E+ GN++
Sbjct:   23 LQPLLHSALFNYAMLVWILLLLCCSANVVNTIL-------YQVTEEQPPNTLIGSLASDQGLPDTGHLYKLE-VGAPYLRVDGKTGDIYTTENSIDRESLKDCRNLFEGDP-CFLEFEVSITDLMKGTGPRLIEGRIEILDENDNTPQFSSPVLTLSIPENTHVGALFAIPVATDRDSGSN-GIADYALTTGPEATNLFSLQVAQDSDEKLPQLI--VLGNLDRELRDSYDLNIKVVDGGSPPRQSSALLRITITDANDNVPKFERSHYEGELPENSPVGHSVLQVKANDSDMGPNGEVTYSLHQP-SSPVMRLLSIDRNTGIIFVKGSVDREEISILKFYVQAKDNGP-QSKSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTC----VVAGDVPFQLRSASETGNDRKRKYFLQTTTLLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFS-PTLYEV-EFFEENQPGDKVLDVVATDADSGTNAELTYSITGGSVPEGLFEINPNTGEVRVMSQL-DREQLDHYQFLVAAADKGVPSLRGTATVVVKVLDRNDNDPKFMLNGYSFSVQENMPPLSPVGMVTVNDHDEGENARVQLSVEPD-NGKFMIQNGTY-------TILSTISFDREKESTYSFRLKAVDGGDPPR---SSYVGITINVLDENDNAPYVTKPANSSYKFLDPRTSPETHVESVEAEDIDIGLNSELDFNIVG-------------GNPHGLFRISSEGEITLAKEFTPKHIGLHRLVVKVKDKGTPPRQT--TALVHIYVNETIGNVS 813          
BLAST of Protocadherin-9 vs. Ensembl Zebrafish
Match: CT030123.1 (protocadherin 1b [Source:NCBI gene;Acc:572016])

HSP 1 Score: 252.677 bits (644), Expect = 1.826e-68
Identity = 240/825 (29.09%), Postives = 375/825 (45.45%), Query Frame = 1
Query:  472 IMIWFIVIFC-----VNTVLALSDKISIQMHEEIPPNSEIGSILS--AIPHNLRSTSLEFITESDFFIVTEEGKILV-RKLIDLETLCSQYKLCCGEPVCILKANILLNNKEKEVVSS-VEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLD---EPTNSFILDISQ-----LPSIFLKVSKKLDFEEKKQYHAKLKACDEDNCTTQN---LIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIA------DLSSLKIQEEIP-SKLITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNRS--------KDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKS--AVLKYQIDNYGA--EYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITD-TMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQML---HSGTVILLFRASDYGQPAKYSDHKLVINIFGDES-GNLN 2814
            +++W +++ C     VNT+L        Q+ EE PPN+ IGS+ S   +P       LE +      +  + G I      ID E+L     L  G+P C L+  + + +  K      +E +++ILD+ND+ P F +P   + I E + +G   ++  ATD+D  S   I +Y L    E TN F L ++Q     LP +   V   LD E +  Y   +K  D  +   Q+   L I I D NDN P FE   Y   + E+  +G  + QVKAND D G  G + YS+     + +     ++  +G I +K  +     S   F + A+D+ P   K S   VTI V+D ND+ P IRI        +     I E++P    +  +++ D+D+G N +V C    V  G    Q RS        K  Y L++    D+E  ++    ++  D G P+L S   + + +TD+N+  P F   + Y +   +E ++ G KV+ V A D D    A L Y I         FEI+ N+G +R  + L DRE++    F V   D        +  V + VLD NDN P F  N   FS+ EN  P   VG +   D D+ ENA +  S+    NG  M ++  Y        I + +  DRE    Y   + A D    P+   +S V IT+ VLDEND +P  T P N+     D    P  H+  ++A D D+G N ++ F I+              G+       SS G + +++     H G   L+ +  D G P + +    +++I+ +E+ GN++
Sbjct:   33 MLVWILLLLCCSANVVNTIL-------YQVTEEQPPNTLIGSLASDQGLPDTGHLYKLE-VGAPYLRVDGKTGDIYTTENSIDRESLKDCRNLFEGDP-CFLEFEVSITDLMKGTGPRLIEGRIEILDENDNTPQFSSPVLTLSIPENTHVGALFAIPVATDRDSGSN-GIADYALTTGPEATNLFSLQVAQDSDEKLPQLI--VLGNLDRELRDSYDLNIKVVDGGSPPRQSSALLRITITDANDNVPKFERSHYEGELPENSPVGHSVLQVKANDSDMGPNGEVTYSLHQP-SSPVMRLLSIDRNTGIIFVKGSVDREEISILKFYVQAKDNGP-QSKSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTC----VVAGDVPFQLRSASETGNDRKRKYFLQTTTLLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFS-PTLYEV-EFFEENQPGDKVLDVVATDADSGTNAELTYSITGGSVPEGLFEINPNTGEVRVMSQL-DREQLDHYQFLVAAADKGVPSLRGTATVVVKVLDRNDNDPKFMLNGYSFSVQENMPPLSPVGMVTVNDHDEGENARVQLSVEPD-NGKFMIQNGTYT-------ILSTISFDREKESTYSFRLKAVDGGDPPR---SSYVGITINVLDENDNAPYVTKPANSSYKFLDPRTSPETHVESVEAEDIDIGLNSELDFNIVG-------------GNPHGLFRISSEGEITLAKEFTPKHIGLHRLVVKVKDKGTPPRQT--TALVHIYVNETIGNVS 810          
BLAST of Protocadherin-9 vs. Ensembl Zebrafish
Match: CT030123.1 (protocadherin 1b [Source:NCBI gene;Acc:572016])

HSP 1 Score: 251.906 bits (642), Expect = 2.024e-68
Identity = 240/825 (29.09%), Postives = 375/825 (45.45%), Query Frame = 1
Query:  472 IMIWFIVIFC-----VNTVLALSDKISIQMHEEIPPNSEIGSILS--AIPHNLRSTSLEFITESDFFIVTEEGKILV-RKLIDLETLCSQYKLCCGEPVCILKANILLNNKEKEVVSS-VEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLD---EPTNSFILDISQ-----LPSIFLKVSKKLDFEEKKQYHAKLKACDEDNCTTQN---LIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIA------DLSSLKIQEEIP-SKLITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNRS--------KDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKS--AVLKYQIDNYGA--EYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITD-TMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQML---HSGTVILLFRASDYGQPAKYSDHKLVINIFGDES-GNLN 2814
            +++W +++ C     VNT+L        Q+ EE PPN+ IGS+ S   +P       LE +      +  + G I      ID E+L     L  G+P C L+  + + +  K      +E +++ILD+ND+ P F +P   + I E + +G   ++  ATD+D  S   I +Y L    E TN F L ++Q     LP +   V   LD E +  Y   +K  D  +   Q+   L I I D NDN P FE   Y   + E+  +G  + QVKAND D G  G + YS+     + +     ++  +G I +K  +     S   F + A+D+ P   K S   VTI V+D ND+ P IRI        +     I E++P    +  +++ D+D+G N +V C    V  G    Q RS        K  Y L++    D+E  ++    ++  D G P+L S   + + +TD+N+  P F   + Y +   +E ++ G KV+ V A D D    A L Y I         FEI+ N+G +R  + L DRE++    F V   D        +  V + VLD NDN P F  N   FS+ EN  P   VG +   D D+ ENA +  S+    NG  M ++  Y        I + +  DRE    Y   + A D    P+   +S V IT+ VLDEND +P  T P N+     D    P  H+  ++A D D+G N ++ F I+              G+       SS G + +++     H G   L+ +  D G P + +    +++I+ +E+ GN++
Sbjct:   15 MLVWILLLLCCSANVVNTIL-------YQVTEEQPPNTLIGSLASDQGLPDTGHLYKLE-VGAPYLRVDGKTGDIYTTENSIDRESLKDCRNLFEGDP-CFLEFEVSITDLMKGTGPRLIEGRIEILDENDNTPQFSSPVLTLSIPENTHVGALFAIPVATDRDSGSN-GIADYALTTGPEATNLFSLQVAQDSDEKLPQLI--VLGNLDRELRDSYDLNIKVVDGGSPPRQSSALLRITITDANDNVPKFERSHYEGELPENSPVGHSVLQVKANDSDMGPNGEVTYSLHQP-SSPVMRLLSIDRNTGIIFVKGSVDREEISILKFYVQAKDNGP-QSKSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTC----VVAGDVPFQLRSASETGNDRKRKYFLQTTTLLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFS-PTLYEV-EFFEENQPGDKVLDVVATDADSGTNAELTYSITGGSVPEGLFEINPNTGEVRVMSQL-DREQLDHYQFLVAAADKGVPSLRGTATVVVKVLDRNDNDPKFMLNGYSFSVQENMPPLSPVGMVTVNDHDEGENARVQLSVEPD-NGKFMIQNGTY-------TILSTISFDREKESTYSFRLKAVDGGDPPR---SSYVGITINVLDENDNAPYVTKPANSSYKFLDPRTSPETHVESVEAEDIDIGLNSELDFNIVG-------------GNPHGLFRISSEGEITLAKEFTPKHIGLHRLVVKVKDKGTPPRQT--TALVHIYVNETIGNVS 792          
BLAST of Protocadherin-9 vs. Ensembl Zebrafish
Match: CT030123.1 (protocadherin 1b [Source:NCBI gene;Acc:572016])

HSP 1 Score: 251.906 bits (642), Expect = 2.626e-68
Identity = 240/825 (29.09%), Postives = 375/825 (45.45%), Query Frame = 1
Query:  472 IMIWFIVIFC-----VNTVLALSDKISIQMHEEIPPNSEIGSILS--AIPHNLRSTSLEFITESDFFIVTEEGKILV-RKLIDLETLCSQYKLCCGEPVCILKANILLNNKEKEVVSS-VEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLD---EPTNSFILDISQ-----LPSIFLKVSKKLDFEEKKQYHAKLKACDEDNCTTQN---LIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIA------DLSSLKIQEEIP-SKLITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNRS--------KDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKS--AVLKYQIDNYGA--EYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITD-TMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQML---HSGTVILLFRASDYGQPAKYSDHKLVINIFGDES-GNLN 2814
            +++W +++ C     VNT+L        Q+ EE PPN+ IGS+ S   +P       LE +      +  + G I      ID E+L     L  G+P C L+  + + +  K      +E +++ILD+ND+ P F +P   + I E + +G   ++  ATD+D  S   I +Y L    E TN F L ++Q     LP +   V   LD E +  Y   +K  D  +   Q+   L I I D NDN P FE   Y   + E+  +G  + QVKAND D G  G + YS+     + +     ++  +G I +K  +     S   F + A+D+ P   K S   VTI V+D ND+ P IRI        +     I E++P    +  +++ D+D+G N +V C    V  G    Q RS        K  Y L++    D+E  ++    ++  D G P+L S   + + +TD+N+  P F   + Y +   +E ++ G KV+ V A D D    A L Y I         FEI+ N+G +R  + L DRE++    F V   D        +  V + VLD NDN P F  N   FS+ EN  P   VG +   D D+ ENA +  S+    NG  M ++  Y        I + +  DRE    Y   + A D    P+   +S V IT+ VLDEND +P  T P N+     D    P  H+  ++A D D+G N ++ F I+              G+       SS G + +++     H G   L+ +  D G P + +    +++I+ +E+ GN++
Sbjct:   34 MLVWILLLLCCSANVVNTIL-------YQVTEEQPPNTLIGSLASDQGLPDTGHLYKLE-VGAPYLRVDGKTGDIYTTENSIDRESLKDCRNLFEGDP-CFLEFEVSITDLMKGTGPRLIEGRIEILDENDNTPQFSSPVLTLSIPENTHVGALFAIPVATDRDSGSN-GIADYALTTGPEATNLFSLQVAQDSDEKLPQLI--VLGNLDRELRDSYDLNIKVVDGGSPPRQSSALLRITITDANDNVPKFERSHYEGELPENSPVGHSVLQVKANDSDMGPNGEVTYSLHQP-SSPVMRLLSIDRNTGIIFVKGSVDREEISILKFYVQAKDNGP-QSKSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTC----VVAGDVPFQLRSASETGNDRKRKYFLQTTTLLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFS-PTLYEV-EFFEENQPGDKVLDVVATDADSGTNAELTYSITGGSVPEGLFEINPNTGEVRVMSQL-DREQLDHYQFLVAAADKGVPSLRGTATVVVKVLDRNDNDPKFMLNGYSFSVQENMPPLSPVGMVTVNDHDEGENARVQLSVEPD-NGKFMIQNGTYT-------ILSTISFDREKESTYSFRLKAVDGGDPPR---SSYVGITINVLDENDNAPYVTKPANSSYKFLDPRTSPETHVESVEAEDIDIGLNSELDFNIVG-------------GNPHGLFRISSEGEITLAKEFTPKHIGLHRLVVKVKDKGTPPRQT--TALVHIYVNETIGNVS 811          
BLAST of Protocadherin-9 vs. Ensembl Zebrafish
Match: pcdh1b (protocadherin 1b [Source:ZFIN;Acc:ZDB-GENE-091015-2])

HSP 1 Score: 252.292 bits (643), Expect = 3.152e-68
Identity = 240/825 (29.09%), Postives = 375/825 (45.45%), Query Frame = 1
Query:  472 IMIWFIVIFC-----VNTVLALSDKISIQMHEEIPPNSEIGSILS--AIPHNLRSTSLEFITESDFFIVTEEGKILV-RKLIDLETLCSQYKLCCGEPVCILKANILLNNKEKEVVSS-VEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLD---EPTNSFILDISQ-----LPSIFLKVSKKLDFEEKKQYHAKLKACDEDNCTTQN---LIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIA------DLSSLKIQEEIP-SKLITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNRS--------KDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKS--AVLKYQIDNYGA--EYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITD-TMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQML---HSGTVILLFRASDYGQPAKYSDHKLVINIFGDES-GNLN 2814
            +++W +++ C     VNT+L        Q+ EE PPN+ IGS+ S   +P       LE +      +  + G I      ID E+L     L  G+P C L+  + + +  K      +E +++ILD+ND+ P F +P   + I E + +G   ++  ATD+D  S   I +Y L    E TN F L ++Q     LP +   V   LD E +  Y   +K  D  +   Q+   L I I D NDN P FE   Y   + E+  +G  + QVKAND D G  G + YS+     + +     ++  +G I +K  +     S   F + A+D+ P   K S   VTI V+D ND+ P IRI        +     I E++P    +  +++ D+D+G N +V C    V  G    Q RS        K  Y L++    D+E  ++    ++  D G P+L S   + + +TD+N+  P F   + Y +   +E ++ G KV+ V A D D    A L Y I         FEI+ N+G +R  + L DRE++    F V   D        +  V + VLD NDN P F  N   FS+ EN  P   VG +   D D+ ENA +  S+    NG  M ++  Y        I + +  DRE    Y   + A D    P+   +S V IT+ VLDEND +P  T P N+     D    P  H+  ++A D D+G N ++ F I+              G+       SS G + +++     H G   L+ +  D G P + +    +++I+ +E+ GN++
Sbjct:   15 MLVWILLLLCCSANVVNTIL-------YQVTEEQPPNTLIGSLASDQGLPDTGHLYKLE-VGAPYLRVDGKTGDIYTTENSIDRESLKDCRNLFEGDP-CFLEFEVSITDLMKGTGPRLIEGRIEILDENDNTPQFSSPVLTLSIPENTHVGALFAIPVATDRDSGSN-GIADYALTTGPEATNLFSLQVAQDSDEKLPQLI--VLGNLDRELRDSYDLNIKVVDGGSPPRQSSALLRITITDANDNVPKFERSHYEGELPENSPVGHSVLQVKANDSDMGPNGEVTYSLHQP-SSPVMRLLSIDRNTGIIFVKGSVDREEISILKFYVQAKDNGP-QSKSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTC----VVAGDVPFQLRSASETGNDRKRKYFLQTTTLLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFS-PTLYEV-EFFEENQPGDKVLDVVATDADSGTNAELTYSITGGSVPEGLFEINPNTGEVRVMSQL-DREQLDHYQFLVAAADKGVPSLRGTATVVVKVLDRNDNDPKFMLNGYSFSVQENMPPLSPVGMVTVNDHDEGENARVQLSVEPD-NGKFMIQNGTYT-------ILSTISFDREKESTYSFRLKAVDGGDPPR---SSYVGITINVLDENDNAPYVTKPANSSYKFLDPRTSPETHVESVEAEDIDIGLNSELDFNIVG-------------GNPHGLFRISSEGEITLAKEFTPKHIGLHRLVVKVKDKGTPPRQT--TALVHIYVNETIGNVS 792          
BLAST of Protocadherin-9 vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 244.588 bits (623), Expect = 2.647e-65
Identity = 230/798 (28.82%), Postives = 364/798 (45.61%), Query Frame = 1
Query:  484 FIVIFCVNTVLALSDKISIQMHEEIPPNSEIGSILS--AIPHNLRSTSLEFITESDFFIVTEEGKILVRKL-IDLETLCSQYKLCCGEPVCILKANILLNNKEKEVVSSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKL---DEPTNSFILDISQ-----LPSIFLKVSKKLDFEEKKQYHAKLKACDEDN---CTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKP--EIR----IIADLSSLKIQEEIPSKL-ITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNR--------SKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVW-ENSEFGTKVMTVKAQDQDKS--AVLKYQI--DNYGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDN-NILNITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQML---HSGTVILLFRASDYGQPAKYS 2763
            F+ +F    +L  S K++ ++ EE PPN  IGS+ S    P +     LE +      +  + G I   +  ID E+L     L  GE  C L+  + + +    V   ++ Q++I+D ND+ P F +P   + I E + IG+   + +ATD+D S    + +Y+L    E  + F L +++      P +   V   LD E++  Y   +K  D       ++  L I I D NDN P FE   Y   + E+  +G  + QVKAND D G+   I YS     DT ++   +++  +G I ++  +         F +VA+D    NPK +   VTI + D ND+KP  EIR    +        I E++P +  +  +Q+ D D+G N  V C    V  G    Q +        SK  Y L++    D+E  ++    ++  D G P L S   + + +TD+N+  P F   SQ L+  V+ EN++    VM V A D D    + L Y I  D      F I+ +SG IR  N ++DRE+     F V  +D        +  V ITVLD NDN P F  N   FS++EN      VG +   DAD+ ENA I  S+        +Q          TG I + +  DRE    Y   + A D    P+   +S V +T+ VLDEND +P    P N +   +T    PG  +  ++A D D G N ++ + I          + F     + F ++ + G + + + +   H G   L+ + +D G+P+++ 
Sbjct:   45 FLWLFFQLPILGSSTKVAYRVPEEQPPNILIGSLASDYGYPDSKHLYKLE-LGHPYLRVDGKTGDIYTTETSIDRESLRECQNLEPGEK-CFLEFEVSMTDLMSPVPRLLDGQIEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRD-SGVNGVSSYELIVGPEAQDLFGLQVAEDQDEKQPQLI--VMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDT-VRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDKG-ANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTC----VVAGDVPFQLKQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVF---SQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIFSINPDSGQIRV-NTVLDREQREHYDFHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGMVTVIDADKGENAHIHLSVEPESGEFVIQNG--------TGTILSSISFDREHQSTYTFRLKAVDGGDPPR---SSYVGVTINVLDENDNAPVIVVPSNISYKYLTPQTHPGTPVNWVRAEDMDTGINAELDYSIAS-------GNPF-----ELFQISHNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKPSRHG 804          

HSP 2 Score: 115.161 bits (287), Expect = 4.186e-25
Identity = 138/587 (23.51%), Postives = 236/587 (40.20%), Query Frame = 1
Query: 1126 IHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFT------RSRYPFRIVARDSD-PINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIPSKLITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGH------VWENSEFGTKVMTVKAQDQDKSAVLKYQIDNYGAEYFEIDQNSG--------LIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLP-TGHIETLLKLDREICDLYILEIMASDSAKSPQIP-LTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQML---HSGTVILLFRASDYGQPAKYSDHKLVINIFGDESGN 2808
            I I D NDN P F +    L+I E+  IG +     A DRDSG+ G   Y +      + Q  F ++    + + + +L          R  Y   I  +D   P     +L  ++IL  D ND+ P+   +A  + L     +   ++  ++  D D+G N  +        +    L +  +    +      D E    +   V+ KD+G     +R  + I I D N+ +P  + +   L+ H      + E+    T V  V+  D D+           G   F++ Q S             T   +D E V   +  +  +DS   P +++  +K+ V D NDN+P+FS +L +    EN   + LV +++ATDAD   N+ + +S+    +   +      F++ P +G I     LDRE  + Y   ++A D      IP L    ++ + VLD ND  P +     N  ++ + M     +  +   D D G N  +   +              +  S  F++ + TG +  S      H  T     +A D G P + S   + IN+  DE+ N
Sbjct:  156 IEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYELI--VGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISIL--DTNDNAPKFEKMAYEAELPENSPMGHSVLQ-VKANDSDQGVNAEIDYSFHQASDTVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGI------FSINPDSGQIRVNTVLDREQREHYDFHVVAVDKG----IPSLKGTASVVITVLDRNDNDPKFMLNGYN-FSVMENMPRLSPVGMVTVIDADKGENAHIHLSV--------------EPESGEFVIQNGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRSSYVGVTINVL-DENDN 711          
BLAST of Protocadherin-9 vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 243.817 bits (621), Expect = 3.210e-65
Identity = 230/798 (28.82%), Postives = 364/798 (45.61%), Query Frame = 1
Query:  484 FIVIFCVNTVLALSDKISIQMHEEIPPNSEIGSILS--AIPHNLRSTSLEFITESDFFIVTEEGKILVRKL-IDLETLCSQYKLCCGEPVCILKANILLNNKEKEVVSSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKL---DEPTNSFILDISQ-----LPSIFLKVSKKLDFEEKKQYHAKLKACDEDN---CTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKP--EIR----IIADLSSLKIQEEIPSKL-ITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNR--------SKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVW-ENSEFGTKVMTVKAQDQDKS--AVLKYQI--DNYGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDN-NILNITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQML---HSGTVILLFRASDYGQPAKYS 2763
            F+ +F    +L  S K++ ++ EE PPN  IGS+ S    P +     LE +      +  + G I   +  ID E+L     L  GE  C L+  + + +    V   ++ Q++I+D ND+ P F +P   + I E + IG+   + +ATD+D S    + +Y+L    E  + F L +++      P +   V   LD E++  Y   +K  D       ++  L I I D NDN P FE   Y   + E+  +G  + QVKAND D G+   I YS     DT ++   +++  +G I ++  +         F +VA+D    NPK +   VTI + D ND+KP  EIR    +        I E++P +  +  +Q+ D D+G N  V C    V  G    Q +        SK  Y L++    D+E  ++    ++  D G P L S   + + +TD+N+  P F   SQ L+  V+ EN++    VM V A D D    + L Y I  D      F I+ +SG IR  N ++DRE+     F V  +D        +  V ITVLD NDN P F  N   FS++EN      VG +   DAD+ ENA I  S+        +Q          TG I + +  DRE    Y   + A D    P+   +S V +T+ VLDEND +P    P N +   +T    PG  +  ++A D D G N ++ + I          + F     + F ++ + G + + + +   H G   L+ + +D G+P+++ 
Sbjct:   53 FLWLFFQLPILGSSTKVAYRVPEEQPPNILIGSLASDYGYPDSKHLYKLE-LGHPYLRVDGKTGDIYTTETSIDRESLRECQNLEPGEK-CFLEFEVSMTDLMSPVPRLLDGQIEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRD-SGVNGVSSYELIVGPEAQDLFGLQVAEDQDEKQPQLI--VMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDT-VRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDKG-ANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTC----VVAGDVPFQLKQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVF---SQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIFSINPDSGQIRV-NTVLDREQREHYDFHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGMVTVIDADKGENAHIHLSVEPESGEFVIQNG--------TGTILSSISFDREHQSTYTFRLKAVDGGDPPR---SSYVGVTINVLDENDNAPVIVVPSNISYKYLTPQTHPGTPVNWVRAEDMDTGINAELDYSIAS-------GNPF-----ELFQISHNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKPSRHG 812          

HSP 2 Score: 114.005 bits (284), Expect = 9.369e-25
Identity = 138/587 (23.51%), Postives = 236/587 (40.20%), Query Frame = 1
Query: 1126 IHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFT------RSRYPFRIVARDSD-PINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIPSKLITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGH------VWENSEFGTKVMTVKAQDQDKSAVLKYQIDNYGAEYFEIDQNSG--------LIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLP-TGHIETLLKLDREICDLYILEIMASDSAKSPQIP-LTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQML---HSGTVILLFRASDYGQPAKYSDHKLVINIFGDESGN 2808
            I I D NDN P F +    L+I E+  IG +     A DRDSG+ G   Y +      + Q  F ++    + + + +L          R  Y   I  +D   P     +L  ++IL  D ND+ P+   +A  + L     +   ++  ++  D D+G N  +        +    L +  +    +      D E    +   V+ KD+G     +R  + I I D N+ +P  + +   L+ H      + E+    T V  V+  D D+           G   F++ Q S             T   +D E V   +  +  +DS   P +++  +K+ V D NDN+P+FS +L +    EN   + LV +++ATDAD   N+ + +S+    +   +      F++ P +G I     LDRE  + Y   ++A D      IP L    ++ + VLD ND  P +     N  ++ + M     +  +   D D G N  +   +              +  S  F++ + TG +  S      H  T     +A D G P + S   + IN+  DE+ N
Sbjct:  164 IEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYELIVG--PEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISIL--DTNDNAPKFEKMAYEAELPENSPMGHSVLQ-VKANDSDQGVNAEIDYSFHQASDTVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGI------FSINPDSGQIRVNTVLDREQREHYDFHVVAVDKG----IPSLKGTASVVITVLDRNDNDPKFMLNGYN-FSVMENMPRLSPVGMVTVIDADKGENAHIHLSV--------------EPESGEFVIQNGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRSSYVGVTINVL-DENDN 719          
BLAST of Protocadherin-9 vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 244.202 bits (622), Expect = 3.653e-65
Identity = 230/798 (28.82%), Postives = 364/798 (45.61%), Query Frame = 1
Query:  484 FIVIFCVNTVLALSDKISIQMHEEIPPNSEIGSILS--AIPHNLRSTSLEFITESDFFIVTEEGKILVRKL-IDLETLCSQYKLCCGEPVCILKANILLNNKEKEVVSSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKL---DEPTNSFILDISQ-----LPSIFLKVSKKLDFEEKKQYHAKLKACDEDN---CTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKP--EIR----IIADLSSLKIQEEIPSKL-ITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNR--------SKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVW-ENSEFGTKVMTVKAQDQDKS--AVLKYQI--DNYGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDN-NILNITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQML---HSGTVILLFRASDYGQPAKYS 2763
            F+ +F    +L  S K++ ++ EE PPN  IGS+ S    P +     LE +      +  + G I   +  ID E+L     L  GE  C L+  + + +    V   ++ Q++I+D ND+ P F +P   + I E + IG+   + +ATD+D S    + +Y+L    E  + F L +++      P +   V   LD E++  Y   +K  D       ++  L I I D NDN P FE   Y   + E+  +G  + QVKAND D G+   I YS     DT ++   +++  +G I ++  +         F +VA+D    NPK +   VTI + D ND+KP  EIR    +        I E++P +  +  +Q+ D D+G N  V C    V  G    Q +        SK  Y L++    D+E  ++    ++  D G P L S   + + +TD+N+  P F   SQ L+  V+ EN++    VM V A D D    + L Y I  D      F I+ +SG IR  N ++DRE+     F V  +D        +  V ITVLD NDN P F  N   FS++EN      VG +   DAD+ ENA I  S+        +Q          TG I + +  DRE    Y   + A D    P+   +S V +T+ VLDEND +P    P N +   +T    PG  +  ++A D D G N ++ + I          + F     + F ++ + G + + + +   H G   L+ + +D G+P+++ 
Sbjct:   53 FLWLFFQLPILGSSTKVAYRVPEEQPPNILIGSLASDYGYPDSKHLYKLE-LGHPYLRVDGKTGDIYTTETSIDRESLRECQNLEPGEK-CFLEFEVSMTDLMSPVPRLLDGQIEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRD-SGVNGVSSYELIVGPEAQDLFGLQVAEDQDEKQPQLI--VMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDT-VRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDKG-ANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTC----VVAGDVPFQLKQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVF---SQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIFSINPDSGQIRV-NTVLDREQREHYDFHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGMVTVIDADKGENAHIHLSVEPESGEFVIQNG--------TGTILSSISFDREHQSTYTFRLKAVDGGDPPR---SSYVGVTINVLDENDNAPVIVVPSNISYKYLTPQTHPGTPVNWVRAEDMDTGINAELDYSIAS-------GNPF-----ELFQISHNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKPSRHG 812          

HSP 2 Score: 114.775 bits (286), Expect = 6.006e-25
Identity = 138/587 (23.51%), Postives = 236/587 (40.20%), Query Frame = 1
Query: 1126 IHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFT------RSRYPFRIVARDSD-PINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIPSKLITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGH------VWENSEFGTKVMTVKAQDQDKSAVLKYQIDNYGAEYFEIDQNSG--------LIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLP-TGHIETLLKLDREICDLYILEIMASDSAKSPQIP-LTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQML---HSGTVILLFRASDYGQPAKYSDHKLVINIFGDESGN 2808
            I I D NDN P F +    L+I E+  IG +     A DRDSG+ G   Y +      + Q  F ++    + + + +L          R  Y   I  +D   P     +L  ++IL  D ND+ P+   +A  + L     +   ++  ++  D D+G N  +        +    L +  +    +      D E    +   V+ KD+G     +R  + I I D N+ +P  + +   L+ H      + E+    T V  V+  D D+           G   F++ Q S             T   +D E V   +  +  +DS   P +++  +K+ V D NDN+P+FS +L +    EN   + LV +++ATDAD   N+ + +S+    +   +      F++ P +G I     LDRE  + Y   ++A D      IP L    ++ + VLD ND  P +     N  ++ + M     +  +   D D G N  +   +              +  S  F++ + TG +  S      H  T     +A D G P + S   + IN+  DE+ N
Sbjct:  164 IEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYELI--VGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISIL--DTNDNAPKFEKMAYEAELPENSPMGHSVLQ-VKANDSDQGVNAEIDYSFHQASDTVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGI------FSINPDSGQIRVNTVLDREQREHYDFHVVAVDKG----IPSLKGTASVVITVLDRNDNDPKFMLNGYN-FSVMENMPRLSPVGMVTVIDADKGENAHIHLSV--------------EPESGEFVIQNGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRSSYVGVTINVL-DENDN 719          
BLAST of Protocadherin-9 vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 242.276 bits (617), Expect = 5.018e-65
Identity = 230/798 (28.82%), Postives = 364/798 (45.61%), Query Frame = 1
Query:  484 FIVIFCVNTVLALSDKISIQMHEEIPPNSEIGSILS--AIPHNLRSTSLEFITESDFFIVTEEGKILVRKL-IDLETLCSQYKLCCGEPVCILKANILLNNKEKEVVSSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKL---DEPTNSFILDISQ-----LPSIFLKVSKKLDFEEKKQYHAKLKACDEDN---CTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKP--EIR----IIADLSSLKIQEEIPSKL-ITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNR--------SKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVW-ENSEFGTKVMTVKAQDQDKS--AVLKYQI--DNYGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDN-NILNITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQML---HSGTVILLFRASDYGQPAKYS 2763
            F+ +F    +L  S K++ ++ EE PPN  IGS+ S    P +     LE +      +  + G I   +  ID E+L     L  GE  C L+  + + +    V   ++ Q++I+D ND+ P F +P   + I E + IG+   + +ATD+D S    + +Y+L    E  + F L +++      P +   V   LD E++  Y   +K  D       ++  L I I D NDN P FE   Y   + E+  +G  + QVKAND D G+   I YS     DT ++   +++  +G I ++  +         F +VA+D    NPK +   VTI + D ND+KP  EIR    +        I E++P +  +  +Q+ D D+G N  V C    V  G    Q +        SK  Y L++    D+E  ++    ++  D G P L S   + + +TD+N+  P F   SQ L+  V+ EN++    VM V A D D    + L Y I  D      F I+ +SG IR  N ++DRE+     F V  +D        +  V ITVLD NDN P F  N   FS++EN      VG +   DAD+ ENA I  S+        +Q          TG I + +  DRE    Y   + A D    P+   +S V +T+ VLDEND +P    P N +   +T    PG  +  ++A D D G N ++ + I          + F     + F ++ + G + + + +   H G   L+ + +D G+P+++ 
Sbjct:   53 FLWLFFQLPILGSSTKVAYRVPEEQPPNILIGSLASDYGYPDSKHLYKLE-LGHPYLRVDGKTGDIYTTETSIDRESLRECQNLEPGEK-CFLEFEVSMTDLMSPVPRLLDGQIEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRD-SGVNGVSSYELIVGPEAQDLFGLQVAEDQDEKQPQLI--VMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDT-VRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDKG-ANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTC----VVAGDVPFQLKQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVF---SQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIFSINPDSGQIRV-NTVLDREQREHYDFHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGMVTVIDADKGENAHIHLSVEPESGEFVIQNG--------TGTILSSISFDREHQSTYTFRLKAVDGGDPPR---SSYVGVTINVLDENDNAPVIVVPSNISYKYLTPQTHPGTPVNWVRAEDMDTGINAELDYSIAS-------GNPF-----ELFQISHNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKPSRHG 812          

HSP 2 Score: 113.62 bits (283), Expect = 1.258e-24
Identity = 138/587 (23.51%), Postives = 236/587 (40.20%), Query Frame = 1
Query: 1126 IHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFT------RSRYPFRIVARDSD-PINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIPSKLITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGH------VWENSEFGTKVMTVKAQDQDKSAVLKYQIDNYGAEYFEIDQNSG--------LIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLP-TGHIETLLKLDREICDLYILEIMASDSAKSPQIP-LTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQML---HSGTVILLFRASDYGQPAKYSDHKLVINIFGDESGN 2808
            I I D NDN P F +    L+I E+  IG +     A DRDSG+ G   Y +      + Q  F ++    + + + +L          R  Y   I  +D   P     +L  ++IL  D ND+ P+   +A  + L     +   ++  ++  D D+G N  +        +    L +  +    +      D E    +   V+ KD+G     +R  + I I D N+ +P  + +   L+ H      + E+    T V  V+  D D+           G   F++ Q S             T   +D E V   +  +  +DS   P +++  +K+ V D NDN+P+FS +L +    EN   + LV +++ATDAD   N+ + +S+    +   +      F++ P +G I     LDRE  + Y   ++A D      IP L    ++ + VLD ND  P +     N  ++ + M     +  +   D D G N  +   +              +  S  F++ + TG +  S      H  T     +A D G P + S   + IN+  DE+ N
Sbjct:  164 IEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYELIVG--PEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISIL--DTNDNAPKFEKMAYEAELPENSPMGHSVLQ-VKANDSDQGVNAEIDYSFHQASDTVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGI------FSINPDSGQIRVNTVLDREQREHYDFHVVAVDKG----IPSLKGTASVVITVLDRNDNDPKFMLNGYN-FSVMENMPRLSPVGMVTVIDADKGENAHIHLSV--------------EPESGEFVIQNGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRSSYVGVTINVL-DENDN 719          
BLAST of Protocadherin-9 vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 241.891 bits (616), Expect = 8.486e-65
Identity = 230/798 (28.82%), Postives = 364/798 (45.61%), Query Frame = 1
Query:  484 FIVIFCVNTVLALSDKISIQMHEEIPPNSEIGSILS--AIPHNLRSTSLEFITESDFFIVTEEGKILVRKL-IDLETLCSQYKLCCGEPVCILKANILLNNKEKEVVSSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKL---DEPTNSFILDISQ-----LPSIFLKVSKKLDFEEKKQYHAKLKACDEDN---CTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKP--EIR----IIADLSSLKIQEEIPSKL-ITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNR--------SKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVW-ENSEFGTKVMTVKAQDQDKS--AVLKYQI--DNYGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDN-NILNITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQML---HSGTVILLFRASDYGQPAKYS 2763
            F+ +F    +L  S K++ ++ EE PPN  IGS+ S    P +     LE +      +  + G I   +  ID E+L     L  GE  C L+  + + +    V   ++ Q++I+D ND+ P F +P   + I E + IG+   + +ATD+D S    + +Y+L    E  + F L +++      P +   V   LD E++  Y   +K  D       ++  L I I D NDN P FE   Y   + E+  +G  + QVKAND D G+   I YS     DT ++   +++  +G I ++  +         F +VA+D    NPK +   VTI + D ND+KP  EIR    +        I E++P +  +  +Q+ D D+G N  V C    V  G    Q +        SK  Y L++    D+E  ++    ++  D G P L S   + + +TD+N+  P F   SQ L+  V+ EN++    VM V A D D    + L Y I  D      F I+ +SG IR  N ++DRE+     F V  +D        +  V ITVLD NDN P F  N   FS++EN      VG +   DAD+ ENA I  S+        +Q          TG I + +  DRE    Y   + A D    P+   +S V +T+ VLDEND +P    P N +   +T    PG  +  ++A D D G N ++ + I          + F     + F ++ + G + + + +   H G   L+ + +D G+P+++ 
Sbjct:   53 FLWLFFQLPILGSSTKVAYRVPEEQPPNILIGSLASDYGYPDSKHLYKLE-LGHPYLRVDGKTGDIYTTETSIDRESLRECQNLEPGEK-CFLEFEVSMTDLMSPVPRLLDGQIEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRD-SGVNGVSSYELIVGPEAQDLFGLQVAEDQDEKQPQLI--VMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDT-VRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDKG-ANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTC----VVAGDVPFQLKQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVF---SQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIFSINPDSGQIRV-NTVLDREQREHYDFHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGMVTVIDADKGENAHIHLSVEPESGEFVIQNG--------TGTILSSISFDREHQSTYTFRLKAVDGGDPPR---SSYVGVTINVLDENDNAPVIVVPSNISYKYLTPQTHPGTPVNWVRAEDMDTGINAELDYSIAS-------GNPF-----ELFQISHNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKPSRHG 812          

HSP 2 Score: 112.849 bits (281), Expect = 1.778e-24
Identity = 138/587 (23.51%), Postives = 236/587 (40.20%), Query Frame = 1
Query: 1126 IHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFT------RSRYPFRIVARDSD-PINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIPSKLITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGH------VWENSEFGTKVMTVKAQDQDKSAVLKYQIDNYGAEYFEIDQNSG--------LIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLP-TGHIETLLKLDREICDLYILEIMASDSAKSPQIP-LTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQML---HSGTVILLFRASDYGQPAKYSDHKLVINIFGDESGN 2808
            I I D NDN P F +    L+I E+  IG +     A DRDSG+ G   Y +      + Q  F ++    + + + +L          R  Y   I  +D   P     +L  ++IL  D ND+ P+   +A  + L     +   ++  ++  D D+G N  +        +    L +  +    +      D E    +   V+ KD+G     +R  + I I D N+ +P  + +   L+ H      + E+    T V  V+  D D+           G   F++ Q S             T   +D E V   +  +  +DS   P +++  +K+ V D NDN+P+FS +L +    EN   + LV +++ATDAD   N+ + +S+    +   +      F++ P +G I     LDRE  + Y   ++A D      IP L    ++ + VLD ND  P +     N  ++ + M     +  +   D D G N  +   +              +  S  F++ + TG +  S      H  T     +A D G P + S   + IN+  DE+ N
Sbjct:  164 IEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYELIVG--PEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISIL--DTNDNAPKFEKMAYEAELPENSPMGHSVLQ-VKANDSDQGVNAEIDYSFHQASDTVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGI------FSINPDSGQIRVNTVLDREQREHYDFHVVAVDKG----IPSLKGTASVVITVLDRNDNDPKFMLNGYN-FSVMENMPRLSPVGMVTVIDADKGENAHIHLSV--------------EPESGEFVIQNGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRSSYVGVTINVL-DENDN 719          
BLAST of Protocadherin-9 vs. Ensembl Mouse
Match: Pcdhgb2 (protocadherin gamma subfamily B, 2 [Source:MGI Symbol;Acc:MGI:1935170])

HSP 1 Score: 224.172 bits (570), Expect = 1.190e-59
Identity = 193/677 (28.51%), Postives = 326/677 (48.15%), Query Frame = 1
Query:  460 YYLQIMIWFIVIFCVNTVLALSDKISIQMHEEIPPNSEIGSI---LSAIPHNLRSTSLEFITESDFFIVT-EEGKILVRKLIDLETLCSQYKLCCGEPVCILKANILLNNKEKEVVSSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSS----QYRIQNYKLDEPTNSFILDISQLPSIFLKVSKKLDFEEKKQYHAKLKACDEDN---CTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIP-SKLITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQD--KSAVLKYQIDNYGAE------YFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSP--LFSTNLPQFSII-----ENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHD-NYFNV-LPTGHIETLLKL-DREICDLYILEIMASDSAKSP 2400
            ++LQ++  F+++       AL+D+I   + EE+  NS +G++   L     NL +  L    E D+F V  E G +LV   ID E +C +      +P C+L+ +I+     ++ ++   + V + D ND+ P+F+  E  + I E ++ G +  L  A D D  S    +Y + + +  E T     D  + P + LK  + LD EE   +   L A D  +     T  + I + D NDN P+F  + +++T++EDV  G  + QV A D+D G+   I Y+   + D  ++  F ++  +G I  K  L   T   Y   + A+D   +    S CS+ + + D ND  PE+ + +  + L   E+ P   +I  ++  D+D G NG VYCH+  +    F L++ SK+ Y L + R  D E   + +  ++  D+G+P L S  II + I+D+N+  P F   S YL+ HV EN+  GT +  V A D D   + ++ Y I     E      +  ++Q+SG++       D E++ S   T+   D  +   +A+V +++ V D NDN+P  L+ T  P  S +         P  LV ++ A DAD   NA +S+        + +Q  D   F++ L TG + T   L DR+     +L +   D  + P
Sbjct:   11 WWLQVLSPFLLLLFHG---ALADQIRYSIPEELAKNSIVGNLARDLGLSVQNLPTRKLRVSAEKDYFTVNPESGDLLVGDRIDREQVCGK------QPQCVLEFDIV----AEKPLNIFHVAVILQDVNDNAPLFKQSEVDLNIGESTRPGKAFPLDPALDLDAGSNSLQKYYLTDNEYFEVTEKETPDGRKYPELILK--RFLDREEHNFHQLVLTAVDGGDPPRSGTTQIRIQVTDINDNPPMFSQDVFSVTLREDVPPGFSVLQVTATDQDEGVNAEITYAFH-NVDEQVERIFNLDKRTGEITTKDNLDFETAKSYTLNVEAKDPGDL---ASHCSIQVKILDENDCVPEVIVTSVFTPLP--EDSPLGTVIALIKTRDRDSGENGDVYCHV--LGNEGFVLKSSSKNYYKLVTDRTLDREAIPEYNVTIVAADRGKPPLSSNVIITLHISDVNDNAPVFHQAS-YLV-HVAENNPPGTSIAQVSASDPDLGSNGLISYSIIASDLEPRALSSFVSVNQDSGVV-FAQRAFDHEQLRSFQLTLQARDHGSPTLSANVSMRVLVGDRNDNAPRVLYPTLEPDGSALFDMVPRAAEPGYLVTKVVAVDADSGHNAWLSY--------HVLQASDPGLFSLGLRTGEVRTARALGDRDSARQRLL-VAVRDGGQPP 652          

HSP 2 Score: 108.997 bits (271), Expect = 1.841e-23
Identity = 147/578 (25.43%), Postives = 242/578 (41.87%), Query Frame = 1
Query:  997 LDISQLPSIFLKVSKKLDFEEKKQYHAKLKACD----EDNCTTQ------------------NLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGR----IKLKKKLSTFTRSRYPFRIVARDS-DPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIPSKLITTLQIV--DQDKGPNG-IVYC--HLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKSAVLKYQIDNYGAEYFEIDQNSG--LIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVL--PTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVL--DENDESPTWTH----PDNNIL--NITDTMRPGDHLLQLQATDRDVGANGKVRFEIIK 2598
            L +  LP+  L+VS + D+         L   D    E  C  Q                  ++ + ++D NDN P+F+    +L I E  + G       A D D+G     KY +    D +       ET  GR    + LK+ L     + +   + A D  DP  P+     + I V D+ND+ P      D+ S+ ++E++P    + LQ+   DQD+G N  I Y   ++D   E  F L  R+ +I    +    D E  +     V  KD G+  L S   I + I D N+  P     S +    + E+S  GT +  +K +D+D            G E F +  +S       T+  +DRE +   + T+   D    P +++V + + + D NDN+P+F        + EN  P   + Q++A+D D   N LIS+S+  S   +   R  + F  +   +G +      D E    + L + A D   SP    T   N+++RVL  D ND +P   +    PD + L   +     PG  + ++ A D D G N  + + +++
Sbjct:   55 LSVQNLPTRKLRVSAEKDYFTVNPESGDLLVGDRIDREQVCGKQPQCVLEFDIVAEKPLNIFHVAVILQDVNDNAPLFKQSEVDLNIGESTRPGKAFPLDPALDLDAGSNSLQKYYLT---DNEYFEVTEKETPDGRKYPELILKRFLDREEHNFHQLVLTAVDGGDP--PRSGTTQIRIQVTDINDNPPMFS--QDVFSVTLREDVPPGF-SVLQVTATDQDEGVNAEITYAFHNVDEQVERIFNLDKRTGEI---TTKDNLDFETAKSYTLNVEAKDPGD--LASHCSIQVKILDENDCVPEVIVTSVFT--PLPEDSPLGTVIALIKTRDRDSGENGDVYCHVLGNEGFVLKSSSKNYYKLVTDRTLDREAIPEYNVTIVAADRGKPPLSSNVIITLHISDVNDNAPVFHQASYLVHVAENNPPGTSIAQVSASDPDLGSNGLISYSIIAS---DLEPRALSSFVSVNQDSGVVFAQRAFDHEQLRSFQLTLQARDHG-SP----TLSANVSMRVLVGDRNDNAPRVLYPTLEPDGSALFDMVPRAAEPGYLVTKVVAVDADSGHNAWLSYHVLQ 609          

HSP 3 Score: 95.1301 bits (235), Expect = 3.616e-19
Identity = 144/565 (25.49%), Postives = 233/565 (41.24%), Query Frame = 1
Query: 1186 TIKEDVQIGSIIGQVKANDRDSGL----FGTIKYSIRTDFDTDIQSTFYVETLSG------RIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEI-PSKLITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNR----SKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLG-HVWENSEFGTKVMTVKAQDQDKS--AVLKYQIDNYGAEY---FEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQML---HSGTVILLFRASDYGQPAKYSDHKLVINIFGDESGN 2808
            +I E++   SI+G +    RD GL      T K  +  + D      F V   SG      RI  ++      +    F IVA    P+N    +  V ++++DVND+ P  +       L I E   P K       +D D G N +   +L       FE+  +     +    L   R  D E       ++   D G+P       I I +TD+N+  P F   SQ +    + E+   G  V+ V A DQD+   A + Y   N   +    F +D+ +G I   +NL D E   S +  V   D        S++VKI  LD ND  P          + E++    ++  I   D D  EN  +   +  +          NY+ ++      T   LDRE    Y + I+A+D  K P   L+S V ITL + D ND +P + H  + ++++ +   PG  + Q+ A+D D+G+NG + + II    +    SSF         VN  +G ++  +        +  L  +A D+G P   ++  + + + GD + N
Sbjct:   35 SIPEELAKNSIVGNLA---RDLGLSVQNLPTRKLRVSAEKDY-----FTVNPESGDLLVGDRIDREQVCGKQPQCVLEFDIVAEK--PLN----IFHVAVILQDVNDNAPLFK--QSEVDLNIGESTRPGKAFPLDPALDLDAGSNSLQKYYL--TDNEYFEVTEKETPDGRKYPELILKRFLDREEHNFHQLVLTAVDGGDPPRSGTTQIRIQVTDINDNPPMF---SQDVFSVTLREDVPPGFSVLQVTATDQDEGVNAEITYAFHNVDEQVERIFNLDKRTGEITTKDNL-DFETAKSYTLNVEAKDPGDLASHCSIQVKI--LDENDCVPEVIVTSVFTPLPEDSPLGTVIALIKTRDRDSGENGDVYCHVLGNEGFVLKSSSKNYYKLV------TDRTLDREAIPEYNVTIVAADRGKPP---LSSNVIITLHISDVNDNAPVF-HQASYLVHVAENNPPGTSIAQVSASDPDLGSNGLISYSIIASDLEPRALSSF-------VSVNQDSGVVFAQRAFDHEQLRSFQLTLQARDHGSPTLSANVSMRV-LVGDRNDN 557          
BLAST of Protocadherin-9 vs. Ensembl Mouse
Match: Pcdh9 (protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801])

HSP 1 Score: 221.861 bits (564), Expect = 3.403e-58
Identity = 215/811 (26.51%), Postives = 371/811 (45.75%), Query Frame = 1
Query:  490 VIFCVNTVLALSDKISIQMHEEIPPNSEIGSILSAIPHNLRSTSLEFITESD----FFIVTEEGKILVRKL-------------IDLETLCSQYKLCCGEPVCILKANILLNNKEKEVVSSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNSFILDISQLPSIF----LKVSKKLDFEEKKQYHAKLKACDEDNCTTQN-----LIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIADLS----SLKIQEEIP-SKLITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQD--KSAVLKYQIDNYGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNN--ILNITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQM---LHSGTVILLFRASDYGQPAKYSDHKLVINIFGDESGN 2808
            +I C+    A++ ++   + EE+P N  IG+I    P +L  + +   T +     + +V++ G   + K+             ID E LC+       E  C  +  +++     +    ++I++ + D ND+ P+F +P   I I E + I     + SATD D +    +Q+Y+L    + F LDI + P       L V + LD E+K  Y  K+K   ED  T Q      L + + D NDN+P+F+     + I E+  +G+ + Q+ A D D G    I+Y          +  F +   +G I +++ L     + +   ++A D    +   +  +VTI V DVND+ P I +   +S    ++ + E+ P +  I  + + D+D   NG V C ++   E  F L+    + Y L +    D+E  ++    ++  D G+PSL    ++ + + D N+  P F      L   V EN+  G  + T+ A D+D  K+A + YQ+    A +F++D+ +G++  +  + +RE      FTV   D+ T P  +   V +TVLD NDNSP F+ N  QF + EN      VG I  TD D  EN  ++ S+ N         ++N+     +G I++ +  DRE    Y  ++ A+D  + P+   +S   +T+ V+D ND SP    P +N     +  +  PG  + ++ A D D G N ++++ I+         S  N+G    F ++  TG + + +       G   L+   SD G P       LV     D +GN
Sbjct:   12 LIACLRLDSAIAQELIYTIREELPENVPIGNI----PKDLNISHINAATGTSASLVYRLVSKAGDAPLVKVSSSTGEIFTTSNRIDREKLCAGASYA-EENECFFELEVVI--LPNDFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPD-TGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKV--EDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDG---SSTPARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIE--REVPFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIEL--SVSENNRRGLYLTTISATDEDSGKNADIVYQL-GPNASFFDLDRKTGVLTASR-VFNREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDEDAGENKAVTLSILND--------NENFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPR---SSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAIPGSVVAEVFAVDIDTGMNAELKYTIV---------SGNNKG---LFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYPKALHTLVLVFLYVNDTAGN 780          
BLAST of Protocadherin-9 vs. Ensembl Mouse
Match: Pcdh9 (protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801])

HSP 1 Score: 218.779 bits (556), Expect = 3.470e-58
Identity = 215/810 (26.54%), Postives = 371/810 (45.80%), Query Frame = 1
Query:  490 VIFCVNTVLALSDKISIQMHEEIPPNSEIGSILSAIPHNLRSTSLEFITESD----FFIVTEEGKI-LVR------KLIDLETLCSQYKLCCG-----EPVCILKANILLNNKEKEVVSSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNSFILDISQLPSIF----LKVSKKLDFEEKKQYHAKLKACDEDNCTTQN-----LIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIADLS----SLKIQEEIP-SKLITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQD--KSAVLKYQIDNYGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNN--ILNITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQM---LHSGTVILLFRASDYGQPAKYSDHKLVINIFGDESGN 2808
            +I C+    A++ ++   + EE+P N  IG+I    P +L  + +   T +     + +V++ G   LV+      ++        + KLC G     E  C  +  +++     +    ++I++ + D ND+ P+F +P   I I E + I     + SATD D      +Q+Y+L    + F LDI + P       L V + LD E+K  Y  K+K   ED  T Q      L + + D NDN+P+F+     + I E+  +G+ + Q+ A D D G    I+Y          +  F +   +G I +++ L     + +   ++A D    +   +  +VTI V DVND+ P I +   +S    ++ + E+ P +  I  + + D+D   NG V C ++   E  F L+    + Y L +    D+E  ++    ++  D G+PSL    ++ + + D N+  P F      L   V EN+  G  + T+ A D+D  K+A + YQ+    A +F++D+ +G++  +  + +RE      FTV   D+ T P  +   V +TVLD NDNSP F+ N  QF + EN      VG I  TD D  EN  ++ S+ N         ++N+     +G I++ +  DRE    Y  ++ A+D  + P+   +S   +T+ V+D ND SP    P +N     +  +  PG  + ++ A D D G N ++++ I+         S  N+G    F ++  TG + + +       G   L+   SD G P       LV     D +GN
Sbjct:   12 LIACLRLDSAIAQELIYTIREELPENVPIGNI----PKDLNISHINAATGTSASLVYRLVSKAGDAPLVKVSSSTGEIFTTSNRIDREKLCAGASYAEENECFFELEVVI--LPNDFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFN-GVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKV--EDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDG---SSTPARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIE--REVPFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIEL--SVSENNRRGLYLTTISATDEDSGKNADIVYQL-GPNASFFDLDRKTGVLTASR-VFNREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDEDAGENKAVTLSILND--------NENFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPR---SSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAIPGSVVAEVFAVDIDTGMNAELKYTIV---------SGNNKG---LFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYPKALHTLVLVFLYVNDTAGN 780          
BLAST of Protocadherin-9 vs. Ensembl Mouse
Match: Pcdh9 (protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801])

HSP 1 Score: 221.476 bits (563), Expect = 4.086e-58
Identity = 215/811 (26.51%), Postives = 371/811 (45.75%), Query Frame = 1
Query:  490 VIFCVNTVLALSDKISIQMHEEIPPNSEIGSILSAIPHNLRSTSLEFITESD----FFIVTEEGKILVRKL-------------IDLETLCSQYKLCCGEPVCILKANILLNNKEKEVVSSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNSFILDISQLPSIF----LKVSKKLDFEEKKQYHAKLKACDEDNCTTQN-----LIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIADLS----SLKIQEEIP-SKLITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQD--KSAVLKYQIDNYGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNN--ILNITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQM---LHSGTVILLFRASDYGQPAKYSDHKLVINIFGDESGN 2808
            +I C+    A++ ++   + EE+P N  IG+I    P +L  + +   T +     + +V++ G   + K+             ID E LC+       E  C  +  +++     +    ++I++ + D ND+ P+F +P   I I E + I     + SATD D +    +Q+Y+L    + F LDI + P       L V + LD E+K  Y  K+K   ED  T Q      L + + D NDN+P+F+     + I E+  +G+ + Q+ A D D G    I+Y          +  F +   +G I +++ L     + +   ++A D    +   +  +VTI V DVND+ P I +   +S    ++ + E+ P +  I  + + D+D   NG V C ++   E  F L+    + Y L +    D+E  ++    ++  D G+PSL    ++ + + D N+  P F      L   V EN+  G  + T+ A D+D  K+A + YQ+    A +F++D+ +G++  +  + +RE      FTV   D+ T P  +   V +TVLD NDNSP F+ N  QF + EN      VG I  TD D  EN  ++ S+ N         ++N+     +G I++ +  DRE    Y  ++ A+D  + P+   +S   +T+ V+D ND SP    P +N     +  +  PG  + ++ A D D G N ++++ I+         S  N+G    F ++  TG + + +       G   L+   SD G P       LV     D +GN
Sbjct:   12 LIACLRLDSAIAQELIYTIREELPENVPIGNI----PKDLNISHINAATGTSASLVYRLVSKAGDAPLVKVSSSTGEIFTTSNRIDREKLCAGASYA-EENECFFELEVVI--LPNDFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPD-TGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKV--EDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDG---SSTPARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIE--REVPFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIEL--SVSENNRRGLYLTTISATDEDSGKNADIVYQL-GPNASFFDLDRKTGVLTASR-VFNREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDEDAGENKAVTLSILND--------NENFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPR---SSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAIPGSVVAEVFAVDIDTGMNAELKYTIV---------SGNNKG---LFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYPKALHTLVLVFLYVNDTAGN 780          
BLAST of Protocadherin-9 vs. Ensembl Mouse
Match: Pcdh9 (protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801])

HSP 1 Score: 221.09 bits (562), Expect = 5.072e-58
Identity = 215/811 (26.51%), Postives = 371/811 (45.75%), Query Frame = 1
Query:  490 VIFCVNTVLALSDKISIQMHEEIPPNSEIGSILSAIPHNLRSTSLEFITESD----FFIVTEEGKILVRKL-------------IDLETLCSQYKLCCGEPVCILKANILLNNKEKEVVSSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNSFILDISQLPSIF----LKVSKKLDFEEKKQYHAKLKACDEDNCTTQN-----LIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIADLS----SLKIQEEIP-SKLITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQD--KSAVLKYQIDNYGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNN--ILNITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQM---LHSGTVILLFRASDYGQPAKYSDHKLVINIFGDESGN 2808
            +I C+    A++ ++   + EE+P N  IG+I    P +L  + +   T +     + +V++ G   + K+             ID E LC+       E  C  +  +++     +    ++I++ + D ND+ P+F +P   I I E + I     + SATD D +    +Q+Y+L    + F LDI + P       L V + LD E+K  Y  K+K   ED  T Q      L + + D NDN+P+F+     + I E+  +G+ + Q+ A D D G    I+Y          +  F +   +G I +++ L     + +   ++A D    +   +  +VTI V DVND+ P I +   +S    ++ + E+ P +  I  + + D+D   NG V C ++   E  F L+    + Y L +    D+E  ++    ++  D G+PSL    ++ + + D N+  P F      L   V EN+  G  + T+ A D+D  K+A + YQ+    A +F++D+ +G++  +  + +RE      FTV   D+ T P  +   V +TVLD NDNSP F+ N  QF + EN      VG I  TD D  EN  ++ S+ N         ++N+     +G I++ +  DRE    Y  ++ A+D  + P+   +S   +T+ V+D ND SP    P +N     +  +  PG  + ++ A D D G N ++++ I+         S  N+G    F ++  TG + + +       G   L+   SD G P       LV     D +GN
Sbjct:   12 LIACLRLDSAIAQELIYTIREELPENVPIGNI----PKDLNISHINAATGTSASLVYRLVSKAGDAPLVKVSSSTGEIFTTSNRIDREKLCAGASYA-EENECFFELEVVI--LPNDFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPD-TGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKV--EDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDG---SSTPARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIE--REVPFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIEL--SVSENNRRGLYLTTISATDEDSGKNADIVYQL-GPNASFFDLDRKTGVLTASR-VFNREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDEDAGENKAVTLSILND--------NENFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPR---SSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAIPGSVVAEVFAVDIDTGMNAELKYTIV---------SGNNKG---LFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYPKALHTLVLVFLYVNDTAGN 780          
BLAST of Protocadherin-9 vs. UniProt/SwissProt
Match: sp|Q9BZA8|PC11Y_HUMAN (Protocadherin-11 Y-linked OS=Homo sapiens OX=9606 GN=PCDH11Y PE=1 SV=1)

HSP 1 Score: 229.95 bits (585), Expect = 7.855e-60
Identity = 215/809 (26.58%), Postives = 373/809 (46.11%), Query Frame = 1
Query:  478 IWFIVIFCVNTVLALSDKISIQMHEEIPPNSEIGSIL-----SAIPHNLRSTSLEFITESDFFIVTEEGKI-LVR------KLIDLETLCSQYKLCCGEPV---CILKANILLNNKEKEVVSSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNSFILDISQLPS----IFLKVSKKLDFEEKKQYHAKLKACD---EDNCTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKP--EIRIIADL--SSLKIQEEIP-SKLITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDK--SAVLKYQIDNYGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILN--ITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQ---MLHSGTVILLFRASDYGQPAKYSDHKLVINIFGDES 2802
            I+ +++ CV       +K +  + EEIP N  IG++L     S IP+   +T+++F       +V + G + L+R      ++        + KLC G P    C  +  + +     E+   V+I+  I D ND+ P+F      I I E S I    +L +A D D      +QNY+L +  N F LD+ + P       L V K+LD EEK  Y  K+K  D       +T  L + + D NDN P+F+     ++I E+  +G+ + Q+ A D D G    I +S         +  F++   +G I +K+ L       +   ++A D   + P +++  V + V DVND+ P  +IR I +    ++ + E IP +  I  + + D+D   NG V C  D   E  F L+    + + L +    D+E  ++    ++  D G+P L    ++ I + D N+  P F     ++   + EN+  G ++M V A D D   +A + Y +       F +D+ +G++     L DRE+     FT+   D+   P T++V V ++++D NDNSP+F+ N  +F + EN      VG I  TD D  +N+ ++ S+        +  +D++     TG I   +  DRE  + Y   + A D  +   +  +S   +T+ V+D ND  P +  P  N     +  +  PG  + Q+ A D D G N +VR+ I+    ++             F ++  TG + + +   +   G   +L +A+D GQP       +++N+F +ES
Sbjct:   41 IFAVLLVCVVFHSGAQEK-NYTIREEIPENVLIGNLLKDLNLSLIPNKSLTTTMQFK------LVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAI--LPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGIN-GVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGG-LMPARAM--VLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTD--HEIPFRLRPVFSNQFLLENAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFT--QSFVTVSIPENNSPGIQLMKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVKKL-DREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYKFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSI--------LDENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGR---VSRSSSAKVTINVVDVNDNKPVFIVPPYNYSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRD------------LFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSLFS-VVIVNLFVNES 807          
BLAST of Protocadherin-9 vs. UniProt/SwissProt
Match: sp|Q6WYY1|PC11X_PANPA (Protocadherin-11 X-linked OS=Pan paniscus OX=9597 GN=PCDH11X PE=3 SV=1)

HSP 1 Score: 228.024 bits (580), Expect = 3.396e-59
Identity = 213/809 (26.33%), Postives = 372/809 (45.98%), Query Frame = 1
Query:  478 IWFIVIFCVNTVLALSDKISIQMHEEIPPNSEIGSIL-----SAIPHNLRSTSLEFITESDFFIVTEEGKI-LVR------KLIDLETLCSQYKLCCGEPV---CILKANILLNNKEKEVVSSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNSFILDISQLPS----IFLKVSKKLDFEEKKQYHAKLKACD---EDNCTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKP--EIRIIADL--SSLKIQEEIP-SKLITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDK--SAVLKYQIDNYGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILN--ITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQ---MLHSGTVILLFRASDYGQPAKYSDHKLVINIFGDES 2802
            I+ +++ CV       +K +  + EE+P N  IG +L     S IP+   +T+++F       +V + G + L+R      ++        + KLC G P    C  +  + +     E+   V+I+  I D ND+ P+F      I I E S I    +L +A D D  +   +QNY+L +  N F LD+ + P       L V K+LD EEK  Y  K+K  D       +T  L + + D NDN P+F+     ++I E+  +G+ + Q+ A D D G    I +S         +  F++   +G I +K+ L       +   ++A D   + P +++  V + V DVND+ P  +IR I +    ++ + E IP +  I  + + D+D   NG V C  D   E  F L+    + + L +    D+E  ++    ++  D G+P L    ++ I + D N+  P F     ++   + EN+  G ++  V A D D   +A + Y +       F +D+ +G++     L DRE+     FT+   D+   P T++V V ++++D NDNSP+F+ N   F + EN      VG I  TD D  +N+ ++ S+        +  +D++     TG I   +  DRE  + Y   + A D  +   +  +S   +T+ V+D ND  P +  P +N     +  +  PG  + Q+ A D D G N +VR+ I+    ++             F ++  TG + + +   +   G   +L +A+D GQP       +++N+F +ES
Sbjct:    9 IFAVLLACVVFHSGAQEK-NYTIREEMPENVLIGDLLKDLNLSLIPNKSLTTAMQFK------LVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAI--LPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGTN-GVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGG-LMPARAM--VLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTD--HEIPFRLRPVFSNQFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFT--QSFVTVSIPENNSPGIQLTKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVKKL-DREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSI--------LDENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGR---VSRSSSAKVTINVVDVNDNKPVFIVPPSNYSYELVLPSTNPGTVVFQVMAVDNDTGMNAEVRYSIVGGNTRD------------LFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSLFS-VVIVNLFVNES 775          
BLAST of Protocadherin-9 vs. UniProt/SwissProt
Match: sp|Q71M42|PC11X_PANTR (Protocadherin-11 X-linked OS=Pan troglodytes OX=9598 GN=PCDH11X PE=3 SV=1)

HSP 1 Score: 228.024 bits (580), Expect = 3.768e-59
Identity = 213/809 (26.33%), Postives = 372/809 (45.98%), Query Frame = 1
Query:  478 IWFIVIFCVNTVLALSDKISIQMHEEIPPNSEIGSIL-----SAIPHNLRSTSLEFITESDFFIVTEEGKI-LVR------KLIDLETLCSQYKLCCGEPV---CILKANILLNNKEKEVVSSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNSFILDISQLPS----IFLKVSKKLDFEEKKQYHAKLKACD---EDNCTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKP--EIRIIADL--SSLKIQEEIP-SKLITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDK--SAVLKYQIDNYGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILN--ITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQ---MLHSGTVILLFRASDYGQPAKYSDHKLVINIFGDES 2802
            I+ +++ CV       +K +  + EE+P N  IG +L     S IP+   +T+++F       +V + G + L+R      ++        + KLC G P    C  +  + +     E+   V+I+  I D ND+ P+F      I I E S I    +L +A D D  +   +QNY+L +  N F LD+ + P       L V K+LD EEK  Y  K+K  D       +T  L + + D NDN P+F+     ++I E+  +G+ + Q+ A D D G    I +S         +  F++   +G I +K+ L       +   ++A D   + P +++  V + V DVND+ P  +IR I +    ++ + E IP +  I  + + D+D   NG V C  D   E  F L+    + + L +    D+E  ++    ++  D G+P L    ++ I + D N+  P F     ++   + EN+  G ++  V A D D   +A + Y +       F +D+ +G++     L DRE+     FT+   D+   P T++V V ++++D NDNSP+F+ N   F + EN      VG I  TD D  +N+ ++ S+        +  +D++     TG I   +  DRE  + Y   + A D  +   +  +S   +T+ V+D ND  P +  P +N     +  +  PG  + Q+ A D D G N +VR+ I+    ++             F ++  TG + + +   +   G   +L +A+D GQP       +++N+F +ES
Sbjct:    9 IFAVLLACVVFHSGAQEK-NYTIREEMPENVLIGDLLKDLNLSLIPNKSLTTAMQFK------LVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAI--LPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGTN-GVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGG-LMPARAM--VLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTD--HEIPFRLRPVFSNQFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFT--QSFVTVSIPENNSPGIQLTKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVKKL-DREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSI--------LDENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGR---VSRSSSAKVTINVVDVNDNKPVFIVPPSNYSYELVLPSTNPGTVVFQVMAVDNDTGMNAEVRYSIVGGNTRD------------LFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSLFS-VVIVNLFVNES 775          
BLAST of Protocadherin-9 vs. UniProt/SwissProt
Match: sp|Q9HC56|PCDH9_HUMAN (Protocadherin-9 OS=Homo sapiens OX=9606 GN=PCDH9 PE=1 SV=2)

HSP 1 Score: 227.639 bits (579), Expect = 3.965e-59
Identity = 218/811 (26.88%), Postives = 372/811 (45.87%), Query Frame = 1
Query:  490 VIFCVNTVLALSDKISIQMHEEIPPNSEIGSILSAIPHNLRSTSLEFITESD----FFIVTEEGKILVRKL-------------IDLETLCSQYKLCCGEPVCILKANILLNNKEKEVVSSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNSFILDISQLPSIF----LKVSKKLDFEEKKQYHAKLKACDEDNCTTQN-----LIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIADLS----SLKIQEEIP-SKLITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQD--KSAVLKYQIDNYGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNN--ILNITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQM---LHSGTVILLFRASDYGQPAKYSDHKLVINIFGDESGN 2808
            +I C+    A++ ++   + EE+P N  IG+I    P +L  + +   T +     + +V++ G   + K+             ID E LC+       E  C  +  +++     +    ++I++ + D ND+ P+F +P   I I E + I     + SATD D +    +Q+Y+L    + F LDI + P       L V + LD E+K  Y  K+K   ED  T Q      L + + D NDN+P+F+     + I E+  +G+ + Q+ A D D G    I+Y          +  F +   +G I +++ L     + +   ++A D    +   +  +VTI V DVND+ P I +   +S    ++ + E+ P +  I  + + D+D   NG V C ++   E  F L+    + Y L +    D+E  ++    ++  D G+PSL    ++ + + D N+  P F      L   V EN+  G  + T+ A D+D  K+A + YQ+    A +F++D+ +G++  +  + DRE      FTV   D+ T P  +   V +TVLD NDNSP F+ N  QF + EN      VG I  TDAD  EN  ++ S+ N         +DN+     +G I++ +  DRE    Y  ++ A+D  + P+   +S   +T+ V+D ND SP    P +N     +  +  PG  + ++ A D D G N ++++ I+         S  N+G    F ++  TG + + +       G   L+   SD G P       LV     D +GN
Sbjct:   12 LIACLRLDSAIAQELIYTIREELPENVPIGNI----PKDLNISHINAATGTSASLVYRLVSKAGDAPLVKVSSSTGEIFTTSNRIDREKLCAGASYA-EENECFFELEVVI--LPNDFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPD-TGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKV--EDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDG---SSTPARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIE--REVPFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIEL--SVSENNRRGLYLTTISATDEDSGKNADIVYQL-GPNASFFDLDRKTGVLTASR-VFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENKAVTLSILND--------NDNFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPR---SSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAIPGSVVAEVFAVDVDTGMNAELKYTIV---------SGNNKG---LFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYPKSLHTLVLVFLYVNDTAGN 780          
BLAST of Protocadherin-9 vs. UniProt/SwissProt
Match: sp|Q9BZA7|PC11X_HUMAN (Protocadherin-11 X-linked OS=Homo sapiens OX=9606 GN=PCDH11X PE=2 SV=1)

HSP 1 Score: 224.557 bits (571), Expect = 4.455e-58
Identity = 213/809 (26.33%), Postives = 370/809 (45.74%), Query Frame = 1
Query:  478 IWFIVIFCVNTVLALSDKISIQMHEEIPPNSEIGSIL-----SAIPHNLRSTSLEFITESDFFIVTEEGKI-LVR------KLIDLETLCSQYKLCCGEPV---CILKANILLNNKEKEVVSSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNSFILDISQLPS----IFLKVSKKLDFEEKKQYHAKLKACD---EDNCTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKP--EIRIIADL--SSLKIQEEIP-SKLITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDK--SAVLKYQIDNYGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILN--ITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQ---MLHSGTVILLFRASDYGQPAKYSDHKLVINIFGDES 2802
            I+ +++ CV       +K +  + EE+P N  IG +L     S IP+   +T+++F       +V + G + L+R      ++        + KLC G P    C  +  + +     E+   V+I+  I D ND+ P+F      I I E S I    +L +A D D      +QNY+L +  N F LD+ + P       L V K+LD EEK  Y  K+K  D       +T  L + + D NDN P+F+     ++I E+  +G+ + Q+ A D D G    I +S         +  F++   +G I +K+ L       +   ++A D   + P +++  V + V DVND+ P  +IR I +    ++ + E IP +  I  + + D+D   NG V C  D   E  F L+    + + L +    D+E  ++    ++  D G+P L    ++ I + D N+  P F     ++   + EN+  G ++  V A D D   +A + Y +       F +D  +G++     L DRE+     FT+   D+   P T++V V ++++D NDNSP+F+ N   F + EN      VG I  TD D  +N+ ++ S+        +  +D++     TG I   +  DRE  + Y   + A D  +   +  +S   +T+ V+D ND  P +  P +N     +  +  PG  + Q+ A D D G N +VR+ I+    ++             F ++  TG + + +   +   G   +L +A+D GQP       +++N+F +ES
Sbjct:    9 IFAVLLACVVFHSGAQEK-NYTIREEMPENVLIGDLLKDLNLSLIPNKSLTTAMQFK------LVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAI--LPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGIN-GVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGG-LMPARAM--VLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTD--HEIPFRLRPVFSNQFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFT--QSFVTVSIPENNSPGIQLTKVSAMDADSGPNAKINYLLGPDAPPEFSLDCRTGMLTVVKKL-DREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSI--------LDENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGR---VSRSSSAKVTINVVDVNDNKPVFIVPPSNCSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRD------------LFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSLFS-VVIVNLFVNES 775          
BLAST of Protocadherin-9 vs. TrEMBL
Match: A0A3R7DDS9 (Protocadherin-11 Y-linked (Fragment) OS=Clonorchis sinensis OX=79923 GN=PCDH11Y PE=4 SV=1)

HSP 1 Score: 465.692 bits (1197), Expect = 3.323e-139
Identity = 342/1073 (31.87%), Postives = 529/1073 (49.30%), Query Frame = 1
Query:  433 LNKIKTTCLYYLQIMIWFIVIFCVNTVLALSDKISIQMHEEIPPNSEIGSILSAIPHNLRSTSLEFITESDFFIVT-EEGKILVRKLIDLETLCSQYKLCCGEPVCILKANILLNNKE-KEVVSSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNSFILDISQLPSIFLKVSKKLDFEEKKQYHAKLKACDEDNCTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINP-----KQSLCSVTILVEDVNDHKPEIRIIADLS----------------------------SLKIQEEIPSKLITTLQIVDQDKGPNGIVYCHLD---------PVCEGS----FELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEP-SLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKSAVLKY----------------------QIDNYG------AEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPK-TASVEVKITVLDANDNSPLFSTNLPQ----------FSIIENTGP--SQLVGQINATDADQDENALISFSL-------RNSWNGNT-MQRHDNY-----------------------------FNVLPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPD--NNILNITDTMRPGDHLLQLQATDRDVGANGKVRF-----------------------EIIKQYRK----EDGSSSFNQGSSQ-----YFI----VNSSTGALWISQMLHSGTVILLFRASDYGQPAKYSDHKLVINIFGDES-----------GNLNXXXXXXXXXXXXXXSLFLIVAIICVRRKPPKYHSPTSSILTKEQPVPDWIGLNSDESLLAYPSGNKSPYITNSHRASFSTPMNDGTI--PMRTYTPNCAQFEP 3117
            +N     C+  L +++ F    C   V     ++ +QM EE PP++ IGS+ S++P  L  T L F+T++ FF V    G++ V +LID E LC  +K+CCG   C L A++ + NKE  E  ++V ++V I D+ND+ P F +P  K+ ISE + +G  I+L  ATD D     +IQ Y L EPT +F+LD+++LPS+ L++++ LD E+ + Y A L+ACD   C  Q L I I DENDN+PIF+   Y   ++E++++G ++  + A D D+G  G + Y++    D D+  TF +   +G I+LK+ L+   R  Y F+++A   D +NP     + S   +T+LVED+N+  P I  +A  +                            SL I E  P   +  L + D D G N  V C L+         P   GS    F L   +  IYSLR+ R +D+E+E  +   V+C D G+P +L S ++I + + D+NEF+P F  +    +G V ENS  G +++T+ A D+D+ AVL+Y                       +D+ G      ++YF ++  +G+IR +   +DRE V  ++  V V DS   P  TA+  V I V+D NDN+P+F  N P           F+++EN  P  ++L  ++ A D DQ EN  + FSL       R+S  G+T ++ ++ Y                             F V P G IETL++LDREI   YIL++ A D       PL S + + + VLD ND SP W  P   +  +N+T  M+PG    +L+A D D+   G+V +                        +++   K    E   S+   G  +     Y +    +N +TG +WI+ +L  G + L  RA D G+P   +D  L IN+F D S           G LN+TII VMIT+TA++SLFLIV I+CVRR+P +Y++  S+        P                G+ + Y  + ++   +  MN GT   P+  YT    Q+ P
Sbjct:    1 MNCFGRNCI--LLLLVIFASCECAEEV-----QVHLQMREETPPHTRIGSVSSSLPVTL-GTKLHFLTDNTFFSVAPNTGEVGVARLIDRERLCPDFKICCGVLACQLDASVFITNKETGEFAATVNLKVDIQDQNDNRPAFTSPSQKVAISESAVVGTHINLVPATDADIEPVNQIQRYSLIEPTGTFVLDLTELPSVRLQLTRPLDREKTELYTATLEACDPGACARQTLEIQILDENDNKPIFKVTRYKKQLQENIKVGEVVLHLNATDLDAGDRGRVLYALHGTVDPDLSETFELVRDTGEIRLKRPLAANIRDNYRFKVIA--CDAVNPACAGDENSTAEITLLVEDINNFAPTIHTVAAGAALVSANPPPLDFAGQKPVQLSNEASFRESLSIFENTPPSQVAVLTVRDADVGENSRVTCSLNESSGDDLSRPFNGGSVSSNFILTLSAPGIYSLRTSRMYDYEIEPVVSTKVVCHDFGKPHALTSARVITVRVVDVNEFQPEFSRR--VYVGRVSENSPAGKEILTITATDRDRGAVLRYYFAPVNTEQSTWDDSGRSETATAMDDAGLSRMEASKYFVMEPETGVIRTSQITLDRETVVGVTLVVLVSDSTMPPTFTATTTVSIEVIDENDNAPIF-VNPPSESTDRVRAKPFTVMEN-APRFTRLSEKLEARDPDQGENGRVQFSLLDTYALTRSSRQGSTNIRTNEQYSDSRYKEISHQSDPIDDLGLSKRVVDQPIFRVTPDGVIETLVELDREIVPAYILKVGAQDRGAQ---PLASTIMLRIDVLDANDNSPVWVFPTPMDRTINLTTAMKPGSLAGRLRAEDADINEAGRVTYLFLGPRGEPLRGVSLGEGLLDGLTLVRNGEKPPTNEQQRSALQTGPGRPNENGYRVGPLYLNGTTGEIWIADVLTPGAINLHLRAQDRGKPVSQTDAWLTINVFVDPSDDPSFFNFTGDGTLNVTIILVMITITAIVSLFLIVGIVCVRRRPVRYNATQSNTTPNGTTSP----------------GHMTTYSADINKDYMAGTMNTGTWSSPLSVYT--AGQYYP 1038          
BLAST of Protocadherin-9 vs. TrEMBL
Match: A0A4S2LLF4 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_006337 PE=4 SV=1)

HSP 1 Score: 469.929 bits (1208), Expect = 7.564e-139
Identity = 340/1056 (32.20%), Postives = 521/1056 (49.34%), Query Frame = 1
Query:  466 LQIMIWFIVIFCVNTVLALSDKISIQMHEEIPPNSEIGSILSAIPHNLRSTSLEFITESDFFIVT-EEGKILVRKLIDLETLCSQYKLCCGEPVCILKANILLNNKE-KEVVSSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNSFILDISQLPSIFLKVSKKLDFEEKKQYHAKLKACDEDNCTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINP-----KQSLCSVTILVEDVNDHKPEIRIIADLS----------------------------SLKIQEEIPSKLITTLQIVDQDKGPNGIVYCHLD---------PVCEGS----FELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEP-SLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKSAVLKY----------------------QIDNYG------AEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPK-TASVEVKITVLDANDNSPLF---------STNLPQFSIIENTGP--SQLVGQINATDADQDENALISFSL-------RNSWNGNTMQRHD-------------------------NYFNVLPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPD--NNILNITDTMRPGDHLLQLQATDRDVGANGKVRF-----------------------EIIKQYRK----EDGSSSFNQGSSQ-----YFI----VNSSTGALWISQMLHSGTVILLFRASDYGQPAKYSDHKLVINIFGDES-----------GNLNXXXXXXXXXXXXXXSLFLIVAIICVRRKPPKYHSPTSSILTKEQPVPDWIGLNSDESLLAYPSGNKSPYITNSHRASFSTPMNDGTI--PMRTYTPNCAQFEP 3117
            L +++ F    C   V     ++ +QM EE PP++ IGS+ S++P  L  T L F+T++ FF V    G++ V +LID E LC  +K+CCG   C L A+I + NKE  E  ++V ++V I D+ND+ PIF +P  K+ ISE + +G  I+L  ATD D     +IQ Y L EPT +F+LD+++LPS+ L++++ LD E+ + Y A L+ACD   C  Q L I I DENDN+PIF+   Y   ++E++++G ++  + A+D D+G  G + Y++    D D+  TF +   +G I+LK+ L+   R  Y F+++A D+  +NP     + S   +T+LVED+N+  P I  +A  +                            SL I E  P   +  L + D D G N  V C L+         P   GS    F L   +  IYSLR+ R +D E+E  +   V+C D G+P +L S ++I + + D+NEF+P F  +    +G V ENS  G +++T  A D+D+ AVL+Y                       +D+ G      ++YF ++  +G+IR +   +DRE V  ++  V V DS   P  TA+  V I V+D NDN+P+F            +  F+++EN  P  ++L  ++ A D DQ EN  + FSL       R+S  G+  Q  D                           F V P G IETL++LDREI   YIL++ A D       PL S + + + VLD ND SP W  P   +  +N+T  M+PG    +L+A D D+   G+V +                        +++   K    E   S+   G  +     Y +    +N +TG +WI+ +L  G + L  RA D G+P   +D  L IN+F D S           G LN+TII VMIT+TA++SLFLIV I+CVRR+P +Y++  S+        P                G+ + Y  + ++   +  MN GT   P+  YT    Q+ P
Sbjct:   10 LLLLVIFASCECAEEV-----QVHLQMREETPPHTRIGSVSSSLPATL-GTKLHFLTDNTFFSVAPNTGEVGVARLIDRERLCPDFKICCGVLACQLDASIFITNKETGEFAATVNLKVDIQDQNDNRPIFTSPSQKVAISESALVGTHINLVPATDADIEPVNQIQRYSLIEPTGTFVLDLTELPSVRLQLTRPLDREKTELYTATLEACDPGACARQTLEIQILDENDNKPIFKVTRYKKQLQENIKVGEVVLHLNASDLDAGDRGRVLYALHGTVDPDLSETFELVRDTGEIRLKRPLAANIRDNYRFKVIACDA--VNPACAGDENSTAEITLLVEDINNFAPTIHTVAAGAALVSANPPPLDFAGQKPVQLSNEASFRESLSIFENTPPSQVAVLTVRDADVGENSRVTCSLNESSGDDLNRPFNGGSVSSNFILTLSAPGIYSLRTSRMYDFEIEPVVSTKVVCHDFGKPHALTSARVITVRVVDVNEFQPEFSRR--VYVGRVSENSPAGKEILTTTATDRDRGAVLRYYFAPVNTEQSTWDDSGRSESATAVDDAGLSRIEASKYFVMEPETGVIRTSQITLDRETVVGVTLVVLVSDSTMPPTFTATTTVSIEVIDENDNAPVFVNPPSESADRVKVKPFTVMEN-APRFTRLSEKLEARDPDQGENGRVQFSLLDTYALTRSSRQGSNGQYSDPRYKEISHQSDPIEDLGLSKRVVDQPIFRVTPDGVIETLVELDREIVPAYILKVGAQDRGSQ---PLASTIMLRVDVLDANDNSPVWVFPTPMDRTINLTTAMKPGSLAGRLRAEDADINEAGRVTYLFLGPRGEPLRGVSLGEGLLDSLAVVRNGEKPPTNEQQRSALQTGPGRPNENGYRVGPLYLNGTTGEIWIADVLTPGAINLHLRAQDRGKPVSQTDAWLTINVFVDPSDDPSFFNFTGDGTLNVTIILVMITITAIVSLFLIVGIVCVRRRPVRYNATQSNTTPNGTTSP----------------GHMTTYSADINKDYMAGTMNTGTWSSPLSVYT--AGQYYP 1033          
BLAST of Protocadherin-9 vs. TrEMBL
Match: A0A5J4NP92 (Protocadherin delta 1 OS=Paragonimus westermani OX=34504 GN=DEA37_0009117 PE=4 SV=1)

HSP 1 Score: 470.7 bits (1210), Expect = 7.565e-139
Identity = 329/986 (33.37%), Postives = 486/986 (49.29%), Query Frame = 1
Query:  529 KISIQMHEEIPPNSEIGSILSAIPHNLRSTSLEFITESDFFIVTEE-GKILVRKLIDLETLCSQYKLCCGEPVCILKANILLNNK-EKEVVSSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNSFILDISQLPSIFLKVSKKLDFEEKKQYHAKLKACDEDNCTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINP-----KQSLCSVTILVEDVNDHKPEIRIIAD----LSS--------------------------LKIQEEIPSKLITTLQIVDQDKGPNGIVYCHL--------DPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEP-SLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKSAVLKYQI--------------------------DNYGA-EYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPK-TASVEVKITVLDANDNSPLF----------STNLPQ------FSIIENTGP--SQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNY-------------------------------------FNVLPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTH--PDNNILNITDTMRPGDHLLQLQATDRDVGANGKV-------RFEIIKQYRKEDG--------------SSSFNQGSSQY---------------FIVNSSTGALWISQMLHSGTVILLFRASDYGQPAKYSDHKLVINIFGDES-----------GNLNXXXXXXXXXXXXXXSLFLIVAIICVRRKPPKYHSPTSSILTKEQPV 2952
            ++ +QM EE PP ++IG++  ++P NL  T L F+T+S+FF VT   G++ V +LID E LC  +KLCCG   C L A I + NK   E  +SV ++V I D+ND+ P F +P  K+ ISE S +G  ++L  ATD D     +IQ Y L EPT +FIL   +LP++ L++S+ LD E    Y A L+ACD   C  Q + IH+ DENDN+P+F T  +   + E++++G ++ Q+ A D DSG  G + YS     D D+  TF +   +G I+L++ L+   R  Y FR++A   D + P     + S   +T+LVED+N++ P I ++A     LS+                          L I E      +  L + D D G N  + C L        D      F L   +  IYSLR+ R+FD+E+E      V+C D G+P  L S ++I + + D+NEF+P F  +    +G V EN+  G +++T  A D+D+ AVL Y+                           + +G  +YF I+  SG IR +   +DRE V+S++  V V DS+  P  TA+  V I VLD NDN+P+F          ++ + Q      F ++EN  P  ++L  Q+ A D DQ +N  + FSL  ++      R D+                                      F + P G IETL++LDRE   +YIL+I   D       PL +   + + VLD ND SP+W    P +  +N+T  M+PG    +L+A D DVG  G+V       R E +K     DG              S  + QGS                    +N STG +W++Q L +G + L  RA D G P   +D  L IN+F D S           G LN+TII VMIT+TA++SLFLI+ I+CVRR+P +Y +PT +  T +  V
Sbjct:   32 QVHLQMREETPPFTKIGTVAPSLPGNL-GTKLHFMTDSNFFSVTPTVGEVRVARLIDRERLCPDFKLCCGVLACQLDARIFITNKVSGEFAASVSLKVDIQDQNDNRPTFTSPSQKVSISEASPVGTFVNLVPATDADIEPTNQIQRYNLIEPTGTFILPQDELPNVRLQLSRPLDRERIASYTATLEACDPGACARQTVEIHVMDENDNKPVFTTTRFTKRLMENIKVGDVVLQLNAADADSGERGRVIYSTSGSVDPDLLETFELVQTTGEIRLRQPLAANIRDNYRFRVIA--CDAMTPSCTGDENSTAEITLLVEDINNYAPTIHVVASGVTTLSTDSKTSDRHSVDDGMNISGGEPAYRDRLSILENTAPSQVAVLTVRDADVGENARITCSLNESTSDLSDGHSTNDFILTPSAPGIYSLRTARQFDYELEPTASTKVVCHDYGKPQQLTSARVITVRVIDVNEFQPEFSRR--VYVGRVPENAAAGMEILTTTATDRDRGAVLLYRFAAPPVQQGNWDDKRTEQSAHSGESNAEKFGVNKYFVIEPQSGTIRTSQIPLDRETVASVTLVVLVTDSELPPTFTATTTVSIEVLDENDNAPVFVNPPTEPAISASGVKQRPRTKPFVVMEN-APRFTRLSEQLEARDPDQGDNGRVHFSLLETYAFTRPVRQDHLQSQHRALLVSDGSIESDLATDFPDELGLTRKVVDQPIFRITPDGGIETLVELDREAVPIYILKIGVQDRGAQ---PLATTTLLRVEVLDANDNSPSWVFPTPTDRTINLTTAMKPGSLAGRLRAEDSDVGDAGRVDYMFLGPRGEPLKGLSLRDGLLDSLTMQKENTKESGVYTQGSVTRQPHAESGENGYRLGPLYLNGSTGEIWVAQPLTAGAINLHLRAQDRGSPRSQTDAWLTINVFVDPSDDPVFFNFGADGTLNVTIILVMITITAIVSLFLIIGIVCVRRRPVRY-TPTRTHTTADGTV 1007          
BLAST of Protocadherin-9 vs. TrEMBL
Match: G7YAD6 (Protocadherin-9 OS=Clonorchis sinensis OX=79923 GN=CLF_103782 PE=4 SV=1)

HSP 1 Score: 467.233 bits (1201), Expect = 8.186e-138
Identity = 342/1073 (31.87%), Postives = 529/1073 (49.30%), Query Frame = 1
Query:  433 LNKIKTTCLYYLQIMIWFIVIFCVNTVLALSDKISIQMHEEIPPNSEIGSILSAIPHNLRSTSLEFITESDFFIVT-EEGKILVRKLIDLETLCSQYKLCCGEPVCILKANILLNNKE-KEVVSSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNSFILDISQLPSIFLKVSKKLDFEEKKQYHAKLKACDEDNCTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINP-----KQSLCSVTILVEDVNDHKPEIRIIADLS----------------------------SLKIQEEIPSKLITTLQIVDQDKGPNGIVYCHLD---------PVCEGS----FELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEP-SLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKSAVLKY----------------------QIDNYG------AEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPK-TASVEVKITVLDANDNSPLFSTNLPQ----------FSIIENTGP--SQLVGQINATDADQDENALISFSL-------RNSWNGNT-MQRHDNY-----------------------------FNVLPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPD--NNILNITDTMRPGDHLLQLQATDRDVGANGKVRF-----------------------EIIKQYRK----EDGSSSFNQGSSQ-----YFI----VNSSTGALWISQMLHSGTVILLFRASDYGQPAKYSDHKLVINIFGDES-----------GNLNXXXXXXXXXXXXXXSLFLIVAIICVRRKPPKYHSPTSSILTKEQPVPDWIGLNSDESLLAYPSGNKSPYITNSHRASFSTPMNDGTI--PMRTYTPNCAQFEP 3117
            +N     C+  L +++ F    C   V     ++ +QM EE PP++ IGS+ S++P  L  T L F+T++ FF V    G++ V +LID E LC  +K+CCG   C L A++ + NKE  E  ++V ++V I D+ND+ P F +P  K+ ISE + +G  I+L  ATD D     +IQ Y L EPT +F+LD+++LPS+ L++++ LD E+ + Y A L+ACD   C  Q L I I DENDN+PIF+   Y   ++E++++G ++  + A D D+G  G + Y++    D D+  TF +   +G I+LK+ L+   R  Y F+++A   D +NP     + S   +T+LVED+N+  P I  +A  +                            SL I E  P   +  L + D D G N  V C L+         P   GS    F L   +  IYSLR+ R +D+E+E  +   V+C D G+P +L S ++I + + D+NEF+P F  +    +G V ENS  G +++T+ A D+D+ AVL+Y                       +D+ G      ++YF ++  +G+IR +   +DRE V  ++  V V DS   P  TA+  V I V+D NDN+P+F  N P           F+++EN  P  ++L  ++ A D DQ EN  + FSL       R+S  G+T ++ ++ Y                             F V P G IETL++LDREI   YIL++ A D       PL S + + + VLD ND SP W  P   +  +N+T  M+PG    +L+A D D+   G+V +                        +++   K    E   S+   G  +     Y +    +N +TG +WI+ +L  G + L  RA D G+P   +D  L IN+F D S           G LN+TII VMIT+TA++SLFLIV I+CVRR+P +Y++  S+        P                G+ + Y  + ++   +  MN GT   P+  YT    Q+ P
Sbjct:    1 MNCFGRNCI--LLLLVIFASCECAEEV-----QVHLQMREETPPHTRIGSVSSSLPVTL-GTKLHFLTDNTFFSVAPNTGEVGVARLIDRERLCPDFKICCGVLACQLDASVFITNKETGEFAATVNLKVDIQDQNDNRPAFTSPSQKVAISESAVVGTHINLVPATDADIEPVNQIQRYSLIEPTGTFVLDLTELPSVRLQLTRPLDREKTELYTATLEACDPGACARQTLEIQILDENDNKPIFKVTRYKKQLQENIKVGEVVLHLNATDLDAGDRGRVLYALHGTVDPDLSETFELVRDTGEIRLKRPLAANIRDNYRFKVIA--CDAVNPACAGDENSTAEITLLVEDINNFAPTIHTVAAGAALVSANPPPLDFVGQKPVQLSNEASFRESLSIFENTPPSQVAVLTVRDADVGENSRVTCSLNESSGDDLSRPFNGGSVSSNFILTLSAPGIYSLRTSRMYDYEIEPVVSTKVVCHDFGKPHALTSARVITVRVVDVNEFQPEFSRR--VYVGRVSENSPAGKEILTITATDRDRGAVLRYYFAPVNTEQSTWDDSGRSETATAMDDAGLSRMEASKYFVMEPETGVIRTSQITLDRETVVGVTLVVLVSDSTMPPTFTATTTVSIEVIDENDNAPIF-VNPPSESTDRVRAKPFTVMEN-APRFTRLSEKLEARDPDQGENGRVQFSLLDTYALTRSSRQGSTNIRTNEQYSDSRYKEISHQSDPIDDLGLSKRVVDQPIFRVTPDGVIETLVELDREIVPAYILKVGAQDRGAQ---PLASTIMLRIDVLDANDNSPVWVFPTPMDRTINLTTAMKPGSLAGRLRAEDADINEAGRVTYLFLGPRGEPLRGVSLGEGLLDGLTLVRNGEKPPTNEQQRSALQTGPGRPNENGYRVGPLYLNGTTGEIWIADVLTPGAINLHLRAQDRGKPVSQTDAWLTINVFVDPSDDPSFFNFTGDGTLNVTIILVMITITAIVSLFLIVGIVCVRRRPVRYNATQSNTTPNGTTSP----------------GHMTTYSADINKDYMAGTMNTGTWSSPLSVYT--AGQYYP 1038          
BLAST of Protocadherin-9 vs. TrEMBL
Match: A0A074ZRN8 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_06647 PE=4 SV=1)

HSP 1 Score: 467.233 bits (1201), Expect = 9.621e-138
Identity = 326/989 (32.96%), Postives = 501/989 (50.66%), Query Frame = 1
Query:  463 YLQIMIWFIVIFCVNTVLALSDKISIQMHEEIPPNSEIGSILSAIPHNLRSTSLEFITESDFFIVT-EEGKILVRKLIDLETLCSQYKLCCGEPVCILKANILLNNKE-KEVVSSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNSFILDISQLPSIFLKVSKKLDFEEKKQYHAKLKACDEDNCTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINP-----KQSLCSVTILVEDVNDHKPEIRIIADLS------------------------SLKIQEEIPSKLITTLQIVDQDKGPNGIVYCHLD---------PVCEGS----FELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEP-SLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKSAVLKY----------------------QIDNYGA------EYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPK-TASVEVKITVLDANDNSPLF---------STNLPQFSIIENTGP--SQLVGQINATDADQDENALISFSL-------RNSWNGNTMQRHDN------------------------------YFNVLPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPD--NNILNITDTMRPGDHLLQLQATDRDVGANGKVRF-----------------------EIIKQYRK----EDGSSSFNQGSSQ-----YFI----VNSSTGALWISQMLHSGTVILLFRASDYGQPAKYSDHKLVINIFGDES-----------GNLNXXXXXXXXXXXXXXSLFLIVAIICVRRKPPKYHS 2916
            Y  +++  I+  C     A   ++ +QM EE PP++ IGS+ S++P  L  T L F+T++ FF V    G++ V +LID E LC  +K+CCG   C L A++ + NKE  E  ++V ++V I D+ND+ P F +P  K+ ISE + +G  I+L  ATD D     +IQ Y L EPT +F+LD+++LPS+ L++++ LD E+ + Y A L+ACD   C  Q L I I DENDN+PIF+   Y   ++E++++G ++  + A D D+G  G + Y++    D D+  TF +   +G I+LK+ L+   R  Y F+++A D+  +NP     + S   +T+LVED+N+  P I  +A  +                        SL I E  P   +  L + D D G N  V C L+         P   GS    F L   +  IYSLR+ R +D+E+E  +   V+C D G+P +L S ++I + + D+NEF+P F  +    +G V ENS  G +++T+ A D+D+ AVL+Y                       +D+ G       +YF ++  +G+IR +   +DRE V  ++  V V DS   PK TA+  V I V+D NDN+P+F            +  F+++EN  P  ++L  ++ A D DQ EN  + FSL       R+S  G+T  R +                                F V P G IETL++LDREI   YIL++ A D       PL S + + + VLD ND SP W  P   +  +N+T  M+PG    +L+A D D+   G+V +                        +++   K    E   S+   G  +     Y +    +N +TG +WI+ +L  G + L  RA D G+P   +D  L IN+F D S           G LN+TII VMIT+TA++SLFLIV I+CVRR+P +Y++
Sbjct:    7 YCTLLLLVILASCE---CAEEVQVHLQMREETPPHTRIGSVSSSLPATL-GTKLHFLTDNTFFSVAPNTGEVGVARLIDRERLCPDFKICCGVLACQLDASVFITNKETGEFAATVNLKVDIQDQNDNRPAFTSPSQKVAISESALVGTHINLVPATDADIEPVNQIQRYSLIEPTGTFVLDLTELPSVRLQLTRPLDREKTELYTANLEACDPGACARQTLEIQILDENDNKPIFKVTRYKKQLQENIKVGEVVLHLNATDLDAGDRGRVLYALHGTVDPDLFETFELVRDTGEIRLKRPLAANIRDNYRFKVIACDA--VNPACAGDENSTAEITLLVEDINNFAPTIHTVAAGAALASANPPPPDFTGQKSSEASFRESLSIFENTPPSQVAVLTVRDADVGENSRVTCSLNESSGDDLNRPFIGGSVSPNFILTLSAPGIYSLRTSRMYDYEIEPVVSTKVVCHDFGKPHALTSARVITVRVVDVNEFQPEFSRR--VYVGRVSENSPAGKEILTITATDRDRGAVLRYYFAPVNTEQSTWDESGRSESATAMDDAGLSRIESNKYFVMEPETGVIRTSQIALDRETVVGVTLVVLVSDSTMPPKFTATTTVSIEVIDENDNAPVFVNPPAESSDRVKVKPFTVMEN-APRFTRLSEKLEARDPDQGENGRVQFSLLDTYALTRSSRQGSTNIRTNGQYSDSRYKEISHQSDPIDDLGLSKRVVDQPIFRVTPDGVIETLVELDREIVPAYILKVGAQDRGSQ---PLASTIMLRIDVLDANDNSPVWVFPTPMDRTINLTTAMKPGSLAGRLRAEDADINEAGRVTYLFLGPRGEPLRGVSLGEGLLDSLALVRNGEKPPTNEQQRSALQTGPGRPHENGYRVGPLYLNGTTGEIWIADVLTPGAINLHLRAQDRGKPVSQTDAWLTINVFVDPSDDPSFFNFTGDGTLNVTIILVMITITAIVSLFLIVGIVCVRRRPVRYNA 983          
BLAST of Protocadherin-9 vs. Ensembl Cavefish
Match: pcdh1b (protocadherin 1b [Source:ZFIN;Acc:ZDB-GENE-091015-2])

HSP 1 Score: 249.595 bits (636), Expect = 1.124e-67
Identity = 234/813 (28.78%), Postives = 377/813 (46.37%), Query Frame = 1
Query:  481 W-FIVIFCVNTVLALSDKISIQMHEEIPPNSEIGSILS--AIPHNLRSTSLEFITESDFFIVTEEGKILVRKL-IDLETLCSQYKLCCGEPVCILKANILLNNKEKEVVSS-VEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLD---EPTNSFILDIS-----QLPSIFLKVSKKLDFEEKKQYHAKLKACDEDN---CTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRI-----IADLSSLK-IQEEIP-SKLITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNRS--------KDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKS--AVLKYQI--DNYGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITDTM-RPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQML---HSGTVILLFRASDYGQPAKYSDHKLVINIFGDES 2802
            W  ++++   + LA    I+ Q+ EE PPN+ +GS+ +   +P       LE +      +  + G I    + ID ETL     L  G+P C L+  + + +  K      +E +++I D+ND+ P F +P  ++ I E + +G   S+  A DKD  S   I +YKL+   +  N F L ++     ++P +   V   LD E++  Y   +K  D       ++  L I I D NDN P FE   Y   + E+  +G  + QVKAND D G  G + YS       ++Q   +++  +G I++K  +         F + ARD+ P   K S   VTI V+D ND+ P IRI     +A    +  + E++P    +  +++ D+D+G N +V C    V  G    Q RS        K  Y L++    D+E  ++    ++  D G P+L S   + + +TD+N+  P F   S Y +    EN + G KV+ V A D D    A L Y I  D+     F+I+ N+G +R  N L DRE      F V   D        +  V + VLD NDN P F  N   FS++EN  P   VG +   DAD+ ENA +  S+    NG  + ++        TG I + +  DRE    Y   + A D    P+   +S V IT+ VLDEND +P  T P N+       +  P   + ++ A D D G N ++ + I                    F ++S+ G + +++     H+G   L+ + SD G+P++++    +++IF +E+
Sbjct:   20 WTVLLLYSCGSSLA---SITYQLREEQPPNTLVGSLAADQGLPDTGHLYKLE-VGGPYLRVDGKTGDIYTTDVPIDRETLKDCRNLFEGDP-CFLEFEVSITDLMKGSGPRLIEGRIEIQDENDNTPQFPSPILELAIPENTYVGAHYSIPVAMDKDAGSN-GIADYKLNSGSDAMNLFSLQVADNTDEKVPQLI--VLGNLDREQRDTYDLSIKVIDGGTPPRYSSALLRITITDTNDNVPKFERSHYEGEMAENTPVGQSVLQVKANDDDLGANGQVTYSFHQP-SPNVQRLLHIDHNTGIIQVKGSVDREEVPLLKFSVQARDNGP-QAKSSKAMVTITVKDRNDNAPSIRIRGFGLVAHEDGIANVSEDMPVGTPVALVEVSDKDEGENAVVTC----VVAGDVPFQLRSASASDSTSKRKYFLQTTTPLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFS-PSLYEVDFAEEN-QPGDKVLDVVATDADSGTNAELLYSIITDSATKGLFDINPNTGEVRVMNQL-DREYKERYEFHVEAADKGVPSLKGTATVVVRVLDRNDNDPKFMLNGYSFSVLENMPPLSPVGMVTVIDADKGENAHVQLSVE-PENGKFVIQNG-------TGTILSSISFDREKESTYTFRLKAVDGGDPPR---SSYVGITINVLDENDNAPYVTKPSNSSYKFLQPLTSPDTRVEKVDAEDIDTGLNAELVYSIT------------GGNPHGLFRISSTDGEITLAKEFTRKHNGLHRLVVKVSDKGKPSRHT--TALVHIFVNET 790          
BLAST of Protocadherin-9 vs. Ensembl Cavefish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 246.899 bits (629), Expect = 2.840e-66
Identity = 230/805 (28.57%), Postives = 368/805 (45.71%), Query Frame = 1
Query:  481 WFIVI-FCVNTVLALSDKISIQMHEEIPPNSEIGSILS--AIPHNLRSTSLEFITESDFFIVTEEGKILVRKL-IDLETLCSQYKLC--CGEPVCILKANI----LLNNKEKEVVSSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLD---EPTNSFILDIS-----QLPSIFLKVSKKLDFEEKKQYHAKLKACDEDNCTTQN---LIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKP--EIRIIADLSS----LKIQEEIP-SKLITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNR--------SKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKS--AVLKYQI--DNYGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQ-LQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQML---HSGTVILLFRASDYGQPAKYS 2763
            WF++    V+++ +    I   + EE PPN+ IGS+ +   +P +     LE +      +  + G+I   ++ ID ETL    K C   G+P C L+  +    L+ N+   ++   E ++++ D ND+ P F +P   + + E + +G + ++  ATD+D + +  +  Y L    E +  F L ++     +LP +   V   LD E K  Y   + A D    +  +   L + I D NDN P FE  +Y   + E+  +G  + QVKAND D G  G I+Y+I    D  +     +E  +G I +K  L     S + F ++ARD  P +PK S   V+I V D ND+ P  EIR I   +       I E++P    +  +Q+ D+D+G N +V C    V  G    Q R        +K  Y L++    D+E  +     ++  D G P+L S   + + +TD N+  P F            E ++ G KV+ V A D D    A L Y I  D+     FEID +SG +R  + L DRE      F V   D        +  V I VLD NDN P F  +   FS++EN  P   VG +   D D+ ENA +  S+        +Q          TG I + +  DRE    Y   + A D  + P+   +S V +T+ VLDEND +P  T P N+       +   D +++ ++A D D G+N ++ + I      E             F ++ S G + +++ L   H G   L+ + SD G+P++++
Sbjct:   43 WFLLFALLVDSINSALGGILYHVREEQPPNTLIGSLAADQGLPDSGHLYKLE-VGAPYLRVDGKTGEIFTTEIPIDRETL----KDCRIKGKP-CFLEFEVSVTDLIQNQSPRLI---EGRIEVQDINDNTPQFPSPVLTLSVQENAHMGATFAIPQATDRD-TERNGVLKYDLSAGPEASALFSLQMANDRGEKLPQLI--VLGNLDRELKDSYDLTINAVDGGTPSRYSSALLRVVITDANDNAPQFEKSSYEAEVSENSPVGYSVLQVKANDSDLGPNGEIEYTIHQASDP-VPKMLQIERSTGIISVKGPLDREEISSFKFHVIARDKGP-SPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTC----VVAGDVPFQLRPAGDSSVDNKKKYFLQTTTPLDYERIRDYRVEIVAVDSGNPALSSTNSLRVQVTDTNDNSPIFS--PPLFEVEFAEENQPGEKVLDVIALDADSGTNAELVYSIIADSSTRGLFEIDPSSGEVRARSPL-DREHKERYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSSYSFSVLENMPPLSPVGMVTVLDMDKGENAQVQLSVEPDVGNFVVQNG--------TGTILSSISFDREKESSYTFRLKAVDGGEPPR---SSYVGVTINVLDENDNAPVVTKPSNSSFRRLSPLAAPDSVVEVVEAEDIDYGSNAELVYSIAGGNPHE------------LFYISPSDGEIKLTKELTRKHGGLHRLVVKVSDRGKPSRHA 803          
BLAST of Protocadherin-9 vs. Ensembl Cavefish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 244.588 bits (623), Expect = 4.148e-66
Identity = 230/805 (28.57%), Postives = 368/805 (45.71%), Query Frame = 1
Query:  481 WFIVI-FCVNTVLALSDKISIQMHEEIPPNSEIGSILS--AIPHNLRSTSLEFITESDFFIVTEEGKILVRKL-IDLETLCSQYKLC--CGEPVCILKANI----LLNNKEKEVVSSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLD---EPTNSFILDIS-----QLPSIFLKVSKKLDFEEKKQYHAKLKACDEDN---CTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKP--EIRIIADLSS----LKIQEEIP-SKLITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNR--------SKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKS--AVLKYQI--DNYGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQ-LQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQML---HSGTVILLFRASDYGQPAKYS 2763
            WF++    V+++ +    I   + EE PPN+ IGS+ +   +P +     LE +      +  + G+I   ++ ID ETL    K C   G+P C L+  +    L+ N+   ++   E ++++ D ND+ P F +P   + + E + +G + ++  ATD+D + +  +  Y L    E +  F L ++     +LP +   V   LD E K  Y   + A D       ++  L + I D NDN P FE  +Y   + E+  +G  + QVKAND D G  G I+Y+I    D  +     +E  +G I +K  L     S + F ++ARD  P +PK S   V+I V D ND+ P  EIR I   +       I E++P    +  +Q+ D+D+G N +V C    V  G    Q R        +K  Y L++    D+E  +     ++  D G P+L S   + + +TD N+  P F            E ++ G KV+ V A D D    A L Y I  D+     FEID +SG +R  + L DRE      F V   D        +  V I VLD NDN P F  +   FS++EN  P   VG +   D D+ ENA +  S+        +Q          TG I + +  DRE    Y   + A D  + P+   +S V +T+ VLDEND +P  T P N+       +   D +++ ++A D D G+N ++ + I      E             F ++ S G + +++ L   H G   L+ + SD G+P++++
Sbjct:    7 WFLLFALLVDSINSALGGILYHVREEQPPNTLIGSLAADQGLPDSGHLYKLE-VGAPYLRVDGKTGEIFTTEIPIDRETL----KDCRIKGKP-CFLEFEVSVTDLIQNQSPRLI---EGRIEVQDINDNTPQFPSPVLTLSVQENAHMGATFAIPQATDRD-TERNGVLKYDLSAGPEASALFSLQMANDRGEKLPQLI--VLGNLDRELKDSYDLTINAVDGGTPSRYSSALLRVVITDANDNAPQFEKSSYEAEVSENSPVGYSVLQVKANDSDLGPNGEIEYTIHQASDP-VPKMLQIERSTGIISVKGPLDREEISSFKFHVIARDKGP-SPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTC----VVAGDVPFQLRPAGDSSVDNKKKYFLQTTTPLDYERIRDYRVEIVAVDSGNPALSSTNSLRVQVTDTNDNSPIFS--PPLFEVEFAEENQPGEKVLDVIALDADSGTNAELVYSIIADSSTRGLFEIDPSSGEVRARSPL-DREHKERYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSSYSFSVLENMPPLSPVGMVTVLDMDKGENAQVQLSVEPDVGNFVVQNG--------TGTILSSISFDREKESSYTFRLKAVDGGEPPR---SSYVGVTINVLDENDNAPVVTKPSNSSFRRLSPLAAPDSVVEVVEAEDIDYGSNAELVYSIAGGNPHE------------LFYISPSDGEIKLTKELTRKHGGLHRLVVKVSDRGKPSRHA 767          
BLAST of Protocadherin-9 vs. Ensembl Cavefish
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 221.476 bits (563), Expect = 2.085e-58
Identity = 219/799 (27.41%), Postives = 365/799 (45.68%), Query Frame = 1
Query:  478 IWFIVIFCVNTVLALSDKISIQMHEEIPPNSEIGSILSAIPHNLR-----STSLEF---ITESDFFIVTEE---GKILV-RKLIDLETLCSQYKLCCGEPVCILKANILLNNKEKEVVSSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNSFILDISQLPS----IFLKVSKKLDFEEKKQYHAKLKACDEDN---CTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEI--RIIADL--SSLKIQEEIP-SKLITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDK--SAVLKYQIDNYGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILN--ITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQ-YFIVNSSTGALWISQMLHS---GTVILLFRASDYGQPAKYSDHKLV 2778
            +  +++ C+ ++    +K    + EE P N  IG++ + +  NL      S++L+F       D  +V  E   G+I      ID E LCS       E  C  +  + +     E+   V+I+  I D ND+ P+F++    I I E + I     + SA D D      IQ+Y+L +  + F LDI + P       L V + LD E K  +  K+K  D  N    +T  L + + D NDN+P+F+     + + E+  +G+ + Q+ A D D G    I +S         +  F +++ +G I +K+ L   +   +   ++A D    +   S  +V + V DVND+ P I  R I +    ++ + E  P +  I  + + D+D   NG V C+ D   +  F L+    D + L +    D+E  ++    ++  D G+P L +  ++ I I D N+  P F      L   + EN++ GT+++ + A D D   +A++ Y +     + F ID  SG++  +  L DRE+    SFTV   D+ + P  ++V VK+ V D NDNSP F+     F + EN      VG I  TDAD  +NA+++ S+ N          DN+     TG I+  +  DRE    Y   + A DS     I  TS   +T+ V+D ND  P +  P +N     +  T  PG  + ++ A D D G N ++++ II              GS +  F ++ +TG + + + + +   G   L+ +  D GQP       LV
Sbjct:   49 VLVLILTCLVSLCWAQEK-DYTVKEEQPENVRIGNLRTDLDLNLDPNIKLSSALQFKPVYKTGDVPLVRVEASTGEIFTTANRIDRERLCSG---VFNEKRCFYEIEVAV--LPDEIFRLVKIRFLIEDINDNAPLFQSTVINISIPENTAINNRYPVPSAFDPDVGIN-GIQHYELVKSVSEFGLDIIETPEGDKWPQLIVQQNLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVNVPENAPMGTSVTQLHATDADLGSNAQIHFSFSNQISPATKRHFAIDSSTGLITVKQPLDRESNPVHKLIVLASDG---SATPSRATVIVNVTDVNDNVPSIDTRYIMNPVNGTVLLSENAPLNTKIALITVTDRDADLNGKVTCYTD--HDVPFRLKPVFNDQFLLETAAPLDYETTREYAIKIVASDSGKPPLNTSAMVLIKIKDENDNAPVFPQPEIQL--SIPENNDPGTQLIKITATDADSGSNALIIYSLGPDAPDGFNIDPRSGILSVSKRL-DREKQEKYSFTVIARDNGSNPLQSNVTVKLIVQDQNDNSPAFTHAEYNFYVPENLPLYGTVGLITVTDADAGDNAIVTLSIING--------KDNFIIDPKTGVIKPNITFDREQQSSYTFVVKAVDSG---LIQTTSYAKVTINVVDVNDNRPVFVIPSSNYSYDLVPFTTNPGSVVTRVFAIDNDTGMNAELQYSIIG-------------GSPRGLFAIDKTTGNITLQEKIANADQGLHRLVVKVKDLGQPESLHSIALV 808          
BLAST of Protocadherin-9 vs. Ensembl Cavefish
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 221.09 bits (562), Expect = 5.639e-58
Identity = 219/799 (27.41%), Postives = 364/799 (45.56%), Query Frame = 1
Query:  478 IWFIVIFCVNTVLALSDKISIQMHEEIPPNSEIGSILSAIPHNLR-----STSLEF---ITESDFFIVTEE---GKILV-RKLIDLETLCSQYKLCCGEPVCILKANILLNNKEKEVVSSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNSFILDISQLPS----IFLKVSKKLDFEEKKQYHAKLKACDEDN---CTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEI--RIIADL--SSLKIQEEIP-SKLITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKS--AVLKYQIDNYGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILN--ITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQ-YFIVNSSTGALWISQMLHS---GTVILLFRASDYGQPAKYSDHKLV 2778
            +  +++ C+ ++    +K    + EE P N  IG++ + +  NL      S++L+F       D  +V  E   G+I      ID E LCS       E  C  +  + +     E+   V+I+  I D ND+ P+F++    I I E + I     + SA D D      IQ+Y+L +  + F LDI + P       L V + LD E K  +  K+K  D  N    +T  L + + D NDN+P+F+     + + E+  +G+ + Q+ A D D G    I +S         +  F +++ +G I +K+ L   +   +   ++A D    +   S  +V + V DVND+ P I  R I +    ++ + E  P +  I  + + D+D   NG V C+ D   +  F L+    D + L +    D+E  ++    ++  D G+P L +  ++ I I D N+  P F      L   + EN++ GT+++ + A D D    A++ Y +     + F ID  SG++  +  L DRE+    SFTV   D+ + P  ++V VK+ V D NDNSP F+     F + EN      VG I  TDAD  +NA+++ S+ N          DN+     TG I+  +  DRE    Y   + A DS     I  TS   +T+ V+D ND  P +  P +N     +  T  PG  + ++ A D D G N ++++ II              GS +  F ++ +TG + + + + +   G   L+ +  D GQP       LV
Sbjct:   49 VLVLILTCLVSLCWAQEK-DYTVKEEQPENVRIGNLRTDLDLNLDPNIKLSSALQFKPVYKTGDVPLVRVEASTGEIFTTANRIDRERLCSG---VFNEKRCFYEIEVAV--LPDEIFRLVKIRFLIEDINDNAPLFQSTVINISIPENTAINNRYPVPSAFDPDVGIN-GIQHYELVKSVSEFGLDIIETPEGDKWPQLIVQQNLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVNVPENAPMGTSVTQLHATDADLGSNAQIHFSFSNQISPATKRHFAIDSSTGLITVKQPLDRESNPVHKLIVLASDG---SATPSRATVIVNVTDVNDNVPSIDTRYIMNPVNGTVLLSENAPLNTKIALITVTDRDADLNGKVTCYTD--HDVPFRLKPVFNDQFLLETAAPLDYETTREYAIKIVASDSGKPPLNTSAMVLIKIKDENDNAPVFPQPEIQL--SIPENNDPGTQLIKITATDADSGSNALIIYSLGPDAPDGFNIDPRSGILSVSKRL-DREKQEKYSFTVIARDNGSNPLQSNVTVKLIVQDQNDNSPAFTHAEYNFYVPENLPLYGTVGLITVTDADAGDNAIVTLSIING--------KDNFIIDPKTGVIKPNITFDREQQSSYTFVVKAVDSG---LIQTTSYAKVTINVVDVNDNRPVFVIPSSNYSYDLVPFTTNPGSVVTRVFAIDNDTGMNAELQYSIIG-------------GSPRGLFAIDKTTGNITLQEKIANADQGLHRLVVKVKDLGQPESLHSIALV 808          
BLAST of Protocadherin-9 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010725.1 (pep scaffold:Pmarinus_7.0:GL479425:26296:30457:-1 gene:ENSPMAG00000009713.1 transcript:ENSPMAT00000010725.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 201.445 bits (511), Expect = 3.230e-53
Identity = 206/767 (26.86%), Postives = 336/767 (43.81%), Query Frame = 1
Query:  652 IVTE-EGKILVRKLIDLETLCSQYKLCCGEP--VCILKANILLNNKEKEVVSSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNS------FILDISQLPS----------------IFLKVSKKLDFEEKKQYHAKLKACDEDNCTTQN---LIIHIKDENDNQPIF-ETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDT-DIQSTFYVETLSGRIKLK--KKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIADLS------SLKIQEEIPSKL-ITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTF-------KDKSQYLLGHVWENSEFGTKVMTVKAQDQDKS--AVLKYQIDNYG-----AEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLF-----STN-LPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNS----WNGNTMQRHDNYFNVLPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPD-NNILNITDTMRPGDHLLQLQAT--DRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQMLHS---GTVILLFRASDYG 2745
            IV E  G++ V   +D E LC +    C     +  ++   +   +    +  +++Q+ + D NDH P F  P   + ISE   +G  + L  A D D  +   IQ+Y++   +        F L  S                      L++ ++LD E    Y   L   D  N        L I + D NDN P+F +  T  + I E  ++G+ + Q++A D D+G  G I YS  T   +   Q+  +V+  +G + ++  +KL   T   +   +VARD   ++   S+ +VT+ + D ND+ P   +IA          +KI E +PS   +  + + D D G +G V   L+       EL + +K  + L++ R  D+E  Q+ +  V+  D+G P L     + I + D+N+  P F        D + Y +  + EN   GT V+ + A D D      + + +         AE F ++  +G +     L DRE+      +V   D  +  + A   V++TVLD NDN+P F     STN + QF + E T     VG ++ +D D+ +NA ++ +L       W G             P G + TL+ LDRE    Y L + A DS + P +  +  V+IT  V D ND +P  T P+ N+      T  P   L+ +  T  D D G NG+  +EII    K              F++N+ +GAL +++ + S   G   L+ R  D G
Sbjct:   75 IVNELSGELSVALRLDREALCMEEPDACRSTGFMHTVQVAAMAKGQGSSNLRLLDVQLLVRDINDHAPAFRAPHLNVSISESEAVGRRVPLPRAIDPDAGTN-SIQHYRISAASGDGLQLGPFSLVESDDDDDGGGVGVDGDGGMGHRALLELREQLDREAVPSYELLLWGEDGGNPKLSGSVLLTIVVVDANDNAPVFVDPPTRPVRITEHSKVGTSVVQLRAADPDAGPNGAIAYSFHTKLTSLATQAALHVDGTTGLVTVRNAEKLDRETMPVHRLVVVARDGGQLSRSASV-TVTVELNDDNDNAPVFEVIALQGEYLPDGGVKIVENLPSGTPVVLISVSDPDLGSSGTVDVRLE--FPTGAELASPNKVQFLLKTTRLLDYEEAQQYNVSVLAADRGTPKLSKLLNLIISVVDINDNTPVFMNPASIEGDVAVYEV-SLRENGPAGTVVLNLLATDADSGPNGAITFTLSELAGGESVAELFSLNMRTGQLTLATPL-DREKRMRYELSVEACDGGSPQRKARAIVRVTVLDENDNAPTFVGVSNSTNCMYQFFVEEETSVGTYVGTVSTSDLDEGDNARVALNLVREAGPDWIGGAGDT--------PGGVVRTLVVLDREDRVQYELSVRAVDSGR-PALSASCRVSIT--VSDTNDNAPVITSPNTNDTWKHVRTFSPAGMLVGVSVTANDIDAGDNGRPLYEIIGGNPK------------GIFLLNADSGALSLARTVSSLDEGLHRLVVRVRDRG 812          

HSP 2 Score: 92.8189 bits (229), Expect = 2.736e-19
Identity = 118/507 (23.27%), Postives = 204/507 (40.24%), Query Frame = 1
Query: 1438 LCSVTILVEDVNDHKPEIRIIADLSSLKIQE-EIPSKLITTLQIVDQDKGPNGIVYCHL-----DPVCEGSFELQNRS------------------KDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKS--AVLKYQIDN-----YGAEYFEIDQNSGLIRCTN-NLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQ--------FSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHP---DNNILNITDTMR----PGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQMLHSGTVI---LLFRASDYGQPAKYSDHKLVINIFGDESGN 2808
            L  V +LV D+NDH P  R  A   ++ I E E   + +   + +D D G N I +  +     D +  G F L                      + +  LR   + D E     + ++  +D G P L    ++ I++ D N+  P F D     +  + E+S+ GT V+ ++A D D      + Y                +D  +GL+   N   +DRE +      V   D     ++ASV V + + D NDN+P+F     Q          I+EN      V  I+ +D D   +  +   L           +   F       ++T   LD E    Y + ++A+D   +P+  L+ ++N+ + V+D ND +P + +P   + ++     ++R     G  +L L ATD D G NG + F + +    E          ++ F +N  TG L ++  L     +   L   A D G P + +   + + +  DE+ N
Sbjct:  127 LLDVQLLVRDINDHAPAFR--APHLNVSISESEAVGRRVPLPRAIDPDAGTNSIQHYRISAASGDGLQLGPFSLVESDDDDDGGGVGVDGDGGMGHRALLELR--EQLDREAVPSYELLLWGEDGGNPKLSGSVLLTIVVVDANDNAPVFVDPPTRPV-RITEHSKVGTSVVQLRAADPDAGPNGAIAYSFHTKLTSLATQAALHVDGTTGLVTVRNAEKLDRETMPVHRLVVVARDGGQLSRSASVTVTVELNDDNDNAPVFEVIALQGEYLPDGGVKIVENLPSGTPVVLISVSDPDLGSSGTVDVRLEFPTGAELASPNKVQF------LLKTTRLLDYEEAQQYNVSVLAADRG-TPK--LSKLLNLIISVVDINDNTPVFMNPASIEGDVAVYEVSLRENGPAGTVVLNLLATDADSGPNGAITFTLSELAGGES--------VAELFSLNMRTGQLTLATPLDREKRMRYELSVEACDGGSPQRKARAIVRVTVL-DENDN 610          
BLAST of Protocadherin-9 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008517.1 (pep scaffold:Pmarinus_7.0:GL476786:43429:129410:1 gene:ENSPMAG00000007697.1 transcript:ENSPMAT00000008517.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 187.963 bits (476), Expect = 4.023e-48
Identity = 167/620 (26.94%), Postives = 280/620 (45.16%), Query Frame = 1
Query:  805 EIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNSFILDISQLPSIFLKVSKKLDFEEKKQYHAKLKACDEDNCTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQ-----IGSIIGQVKANDRDSGLFGTIKYSIRTDFDTD-IQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIP-SKLITTLQIVDQDKGPNGIVYCHL---DPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGE---PSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQD--KSAVLKYQIDN----------YGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLPT-GHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQLQATDRDVGANGKVRF 2586
            ++++ + D ND+ P+F  PE ++ + E +  G  I   SATD D      +    L     +F++D +   S  L+ S++LD EE+  Y   ++A D  + T   L + ++D NDN P F    Y+  + ED         ++IG V A D DSG FG + Y++    D+D     F +  ++G + + + L   +R+ Y  R  A D   +     L    + V D ND+ P ++   D  + ++ E+ P    +  +   D D+G N  +   +   DP  EG F + N  +    L   R  D E +   + +V   D+       L S   + +I+TD+N+  P F      L     E+S  G  V TV+A D D  +++ ++Y +             G   F ++  +G +R    L DRE   S + TV  +D    P T++  + +TV DANDN+P F     + +I E+  P   V +++A D D+  N  + + +    +G+        F + P  G +     LDRE    Y L + A D    P    T+ V +TL   D ND SP +      +    +T  P   +LQ+ A D D+G++G+V +
Sbjct: 1501 QVEISVEDVNDNPPVFAVPEMELEVEENTGEGEVIFTLSATDADQGQNALVTYSVLSGSEGAFVVDAA---SGVLRASRRLDREERASYLLTVRASDGTHATDARLSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDSDWADGAFGLHPVTGALNVTRPLDRESRACYVLRARATDGGGLAATARLY---VNVLDANDNAPSVQ--NDSLAAEVPEDAPPGTSLLRISATDDDEGVNAELEFSISSGDP--EGRFAVGNDGQ----LSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFTSPRSAL---APEDSPVGAVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVREL-DREARQSYALTVLAVDKGRPPLTSTATLAVTVGDANDNAPRFPRREYEAAIAEDEPPGTEVLRLSAWDPDEGANGELRYDI---ASGDPT----GDFRLDPVLGTLAVARPLDRERTASYELAVRARDGG-GPARSDTASVRVTLS--DVNDCSPAFQLSPYTVHARENTQGPPVLILQVVARDDDLGSSGQVTY 2092          

HSP 2 Score: 182.185 bits (461), Expect = 2.214e-46
Identity = 187/685 (27.30%), Postives = 311/685 (45.40%), Query Frame = 1
Query:  808 IQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNSFILDISQLPSIFLKVSKKLDFEEKKQYHAKLKACDEDNCTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIPSKLITTLQIVDQDKGPNG-IVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHE--VEQKIDAI----VICKDQGEPS-LESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKS--AVLKYQID--NYGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTG----ALWISQMLHSGTVILLFRASDYGQP--AKYSDHKLVINIFGDESGN 2808
            + + + D  D  P F   +   V+ E    G  +   SA+  D ++         D+   SF ++ S    IF   +  +D EE+  Y  ++ A         ++ + + D N++ P+F+  +Y ++I ED  + S    V+A D+DSG  G +KY I      +    F      G++ ++ +L   TR  Y   + A D+  + P  S  +V + V DVND+KP     + +     ++E+ S L+  +Q  D D G NG + Y    P    +FEL + +  I SLR    FD E  + Q   A     V+  D G P  L+ R  + + + D+N+  P F  KS Y    V E++   T+++ V A D D+     L+Y I+  N G + F +D ++G I    +L DRE  +S +  V   DS T P  AS  V + VLD NDN P F+ +L     +E+T   +L+  + A+D D   +  + +++     GNT   H  +     TG +    +LD E   LY L + A D  + P+   T +V   + V D ND  P +  P +   +I + +  G  ++ + A D D   NG++ + I +Q         F  G+  +F ++  +G    A  I + +  G   +  RA+D   P   + S  K V  +  DE+ N
Sbjct:  644 VTITVADAQDTPPTFARDDYSFVVFENVAPGTLVGSVSASTLDLNANVTYLIVSGDQ-RGSFSIEWSG-GRIF--TANAIDREEQAFYQLRVVANSGGVAGEASVSVLVHDVNNHAPVFDRASYEVSIAEDEPVNSRFFSVRATDKDSGKNGEVKYEIGEGNGGEKFGIF----PDGQLYVRYELDRETREEYSLTVSAMDTG-VEPLSSSVTVNVTVLDVNDNKPLFNSSSYVFHFCEEQEVGS-LVGAVQATDADAGSNGGVTYSFEKPQV--NFELDSETGRIASLR---VFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFA-KSVYQ-ASVSESASNLTQLLRVTASDVDEGVNGALRYAINEGNEGGK-FTVDASTGQITLLGSL-DREETASYTLVVSATDSGTSPLAASCTVAVQVLDENDNPPRFTESLLSVDALESTRVGELLITLTASDEDTGPSGDVRYAI---VAGNT---HATFAIDRSTGSVFLARRLDFETQRLYRLNVSAEDGGRPPRSSATILV---VHVRDFNDNPPAFL-PGDVFASIMENIPIGTRVITVTARDPDADVNGELHYSIARQ---------FPPGA--HFTIDPESGEICTAAEIDREVTGGLFEVTVRATDKAIPVHTRRSALKNVTVLVTDENDN 1288          

HSP 3 Score: 176.022 bits (445), Expect = 1.528e-44
Identity = 192/735 (26.12%), Postives = 330/735 (44.90%), Query Frame = 1
Query:  667 GKILVRKLIDLETLCSQYKLCCGEPVCILKANILLNNKEKEVVSSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNSFILDISQLPSIFLKVSKK--LDFEEKKQYHAKLKACDEDNCTTQN---LIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIPSKLITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNRSKDIYSLRSVR-KFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKSAVLKYQIDNYGAEY--------FEIDQNSGLIRCTNNLIDRERV------SSISFTVHVMDSDT-EPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNV-LPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNI--TDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQMLHSGTVILLFR----ASDYGQPAKYSDHKLVINI 2787
            GK+   K +D E L  +Y L       +++A    +     + S+ ++ V + D ND++P+F   +    I E    G +++  +ATD D  +   ++ Y+L     +      Q+ ++   VS +  LD EE+  Y  ++ A D  +   ++   + I + D  D  P F  + Y+  + E+V  G+++G V A+  D  L   + Y I      D + +F +E   GRI     +    ++ Y  R+VA             SV++LV DVN+H P     +   S+   E + S+   +++  D+D G NG V   +     G          +Y    VR + D E  ++    V   D G   L S   + + + D+N+ +P F + S Y+  H  E  E G+ V  V+A D D  +       N G  Y        FE+D  +G I  +  + DRE +      +S SF+V   D    +P      V++ V D NDN P F+ ++ Q S+ E+      + ++ A+D D+  N  + +++     G         F V   TG I  L  LDRE    Y L + A+DS  S   PL +   + ++VLDEND  P +T    ++L++   ++ R G+ L+ L A+D D G +G VR+ I+               +   F ++ STG++++++ L   T   L+R    A D G+P + S   LV+++
Sbjct:  504 GKVTTLKSLDREEL-EEYPL-------VVQAQ---DRGSPPLGSTAKVTVVVGDLNDNHPVFYPVQYFASILENEPGGTAVTTVTATDPDRGANGTVR-YQLTAGDAARF----QVNAVTGAVSTRVSLDREERAVYQLQVTALDGGHLRARSPAIVTITVADAQDTPPTFARDDYSFVVFENVAPGTLVGSVSASTLD--LNANVTYLI---VSGDQRGSFSIEWSGGRIFTANAIDREEQAFYQLRVVANSGG----VAGEASVSVLVHDVNNHAPVFDRASYEVSIAEDEPVNSRFF-SVRATDKDSGKNGEVKYEIGEGNGGEKFGIFPDGQLY----VRYELDRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLF-NSSSYVF-HFCEEQEVGSLVGAVQATDADAGS-------NGGVTYSFEKPQVNFELDSETGRI-ASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAKSVYQASVSESASNLTQLLRVTASDVDEGVNGALRYAINEGNEGGK-------FTVDASTGQITLLGSLDREETASYTLVVSATDSGTS---PLAASCTVAVQVLDENDNPPRFTE---SLLSVDALESTRVGELLITLTASDEDTGPSGDVRYAIVA------------GNTHATFAIDRSTGSVFLARRLDFETQ-RLYRLNVSAEDGGRPPRSSATILVVHV 1172          

HSP 4 Score: 173.711 bits (439), Expect = 8.872e-44
Identity = 186/716 (25.98%), Postives = 309/716 (43.16%), Query Frame = 1
Query:  526 DKISIQMHEEIPPNSEIGSILSAIPHNLRSTSLEFITESD----FFIVTEEGKILVRKLIDLETLCSQYKLCCGEPVCILKANILLNNKEKEVVSSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNSFILDISQLPSIFLKVSKKLDFEEKKQYHAKLKACD---EDNCTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTR---------SRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIPSKLITTLQIV--DQDKGPNGIVYCHLDPVCEGS-FELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDK--SAVLKYQI--DNYGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLP-TGHIETLLKLDREIC-DLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITDTMR--PGDHLLQLQATDRDVGANGKVRFEI 2592
            D  S  + E + P + +GS+ SA   +L +     I   D    F I    G+I     ID E     Y+L            ++ N+    V     + V + D N+H P+F+    ++ I+E   +        ATDKD      ++ Y++ E        I   P   L V  +LD E +++Y   + A D   E   ++  + + + D NDN+P+F + +Y     E+ ++GS++G V+A D D+G  G + YS         Q  F +++ +GRI     L  F R         + + F +VA D     P Q   +V + V+DVND+ P+       +S+    E  S L   L++   D D+G NG +   ++   EG  F +   +  I  L S    D E       +V   D G   L +   + + + D N+  P F +    L     E++  G  ++T+ A D+D   S  ++Y I   N  A  F ID+++G +     L D E        V   D    P++++  + + V D NDN P F       SI+EN      V  + A D D D N  + +S+   +          +F + P +G I T  ++DRE+   L+ + + A+D A       +++ N+T+ V DEND +P +  P      + D +R   G  +  LQA+D D   N  VR+ +
Sbjct:  661 DDYSFVVFENVAPGTLVGSV-SASTLDLNANVTYLIVSGDQRGSFSIEWSGGRIFTANAIDREEQAF-YQL-----------RVVANSGG--VAGEASVSVLVHDVNNHAPVFDRASYEVSIAEDEPVNSRFFSVRATDKDSGKNGEVK-YEIGEGNGGEKFGI--FPDGQLYVRYELDRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLFNSSSYVFHFCEEQEVGSLVGAVQATDADAGSNGGVTYSFEKP-----QVNFELDSETGRI---ASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAKSVYQASVS---ESASNLTQLLRVTASDVDEGVNGALRYAINEGNEGGKFTVDASTGQITLLGS---LDREETASYTLVVSATDSGTSPLAASCTVAVQVLDENDNPPRFTES--LLSVDALESTRVGELLITLTASDEDTGPSGDVRYAIVAGNTHAT-FAIDRSTGSVFLARRL-DFETQRLYRLNVSAEDGGRPPRSSATILVVHVRDFNDNPPAFLPGDVFASIMENIPIGTRVITVTARDPDADVNGELHYSIARQFPPGA------HFTIDPESGEICTAAEIDREVTGGLFEVTVRATDKAIPVHTRRSALKNVTVLVTDENDNAPRFVTP---TAILVDGLRAAAGSVVGTLQASDPDEAENAAVRYAV 1331          

HSP 5 Score: 167.933 bits (424), Expect = 5.142e-42
Identity = 178/664 (26.81%), Postives = 302/664 (45.48%), Query Frame = 1
Query:  808 IQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNSFILDISQLPSIFLKVS--KKLDFEEKKQYHAKLKACDEDN---CTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIPSKLITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQD--KSAVLKYQI-DNYGAEYFEIDQNSGL-IRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLPTGHIETLLKLDREI------CDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQML---HSGTVILLFRASDYG 2745
            + V +LD ND  P+F   +      E S  G+ +   SA D D      ++ Y  D    +   ++ +L S+  KV+  K LD EE ++Y   ++A D  +    +T  + + + D NDN P+F    Y  +I E+   G+ +  V A D D G  GT++Y + T  D    + F V  ++G +  +  L    R+ Y  ++ A D   +  + S   VTI V D  D  P      D S +  +   P  L+ ++     D   N + Y  +     GSF ++     I++  ++   D E EQ    + +  + G  + E+   + +++ D+N   P F D++ Y +  + E+    ++  +V+A D+D  K+  +KY+I +  G E F I  +  L +R     +DRE     S TV  MD+  EP ++SV V +TVLD NDN PLF+++   F   E      LVG + ATDAD   N  +++S          +   N+     TG I +L   DRE          +   ++A+D  + P+ PL     + + V D ND  P +        +++++      LL++ A+D D G NG +R+ I          +  N+G    F V++STG + +   L    + +  L+  A+D G
Sbjct:  432 LTVTLLDVNDEPPLFTQTKYVATAVENSLPGLFVVSVSAADSDLGENGTVR-YNFDPDMPAQYREMFRLDSLTGKVTTLKSLDREELEEYPLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHPVFYPVQYFASILENEPGGTAVTTVTATDPDRGANGTVRYQL-TAGDA---ARFQVNAVTGAVSTRVSLDREERAVYQLQVTALDGGHLRAR-SPAIVTITVADAQDTPPTF-ARDDYSFVVFENVAPGTLVGSVSASTLDLNAN-VTYLIVSGDQRGSFSIEWSGGRIFTANAI---DRE-EQAFYQLRVVANSGGVAGEAS--VSVLVHDVNNHAPVF-DRASYEV-SIAEDEPVNSRFFSVRATDKDSGKNGEVKYEIGEGNGGEKFGIFPDGQLYVRYE---LDRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLFNSSSYVFHFCEEQEVGSLVGAVQATDADAGSNGGVTYSFE--------KPQVNFELDSETGRIASLRVFDREALIRQGGAASFSFSVVATDGGR-PK-PLQDRATVQVFVQDVNDNPPQFAKSVYQA-SVSESASNLTQLLRVTASDVDEGVNGALRYAI----------NEGNEGGK--FTVDASTGQITLLGSLDREETASYTLVVSATDSG 1053          

HSP 6 Score: 160.229 bits (404), Expect = 1.257e-39
Identity = 173/650 (26.62%), Postives = 289/650 (44.46%), Query Frame = 1
Query:  487 IVIFCVNTVLALSDKIS--IQMHEEIPPNSEIGSILSAIPHNLRSTSLEF-ITESDF---FIVTEEGKILVRKLIDLETLCSQYKLCCGEPVCILKANILLNNKEKEVVSSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNSFILDISQLPSIFLKVSKKLDFEEK---KQYHAKLKACD-------EDNCTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIP-SKLITTLQIVDQDKGPNGIV-YCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDK--SAVLKYQIDNY---GAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTE-----PKTASVEVKITVLDANDNSPLFSTNLPQFSIIEN--TGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLPTGHIETLLKLDRE 2346
            +++  VN    + D+ S  + + E+ P NS   S+ +    + ++  +++ I E +    F +  +G++ VR  +D ET   +Y L              ++   + + SSV + V +LD ND+ P+F +        E  ++G  +    ATD D  S   +  Y  ++P  +F LD        L+V  +     +     +   + A D       +D  T Q   + ++D NDN P F    Y  ++ E     + + +V A+D D G+ G ++Y+I    + +    F V+  +G+I L   L     + Y   + A DS   +P  + C+V + V D ND+ P  R    L S+   E     +L+ TL   D+D GP+G V Y  +      +F +   +  ++     R+ D E ++     V  +D G P   S  I+ + + D N+  P F      +   + EN   GT+V+TV A+D D   +  L Y I      GA +F ID  SG I CT   IDRE V+   F V V  +D        ++A   V + V D NDN+P F T  P   +++        +VG + A+D D+ ENA + +++    +   + R D       TG IET  +LDRE
Sbjct:  746 VLVHDVNNHAPVFDRASYEVSIAEDEPVNSRFFSVRATDKDSGKNGEVKYEIGEGNGGEKFGIFPDGQLYVRYELDRETR-EEYSLTVSA----------MDTGVEPLSSSVTVNVTVLDVNDNKPLFNSSSYVFHFCEEQEVGSLVGAVQATDADAGSNGGV-TYSFEKPQVNFELDSETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQ---VFVQDVNDNPPQFAKSVYQASVSESASNLTQLLRVTASDVDEGVNGALRYAIN---EGNEGGKFTVDASTGQITLLGSLDREETASYTLVVSATDSG-TSPLAASCTVAVQVLDENDNPP--RFTESLLSVDALESTRVGELLITLTASDEDTGPSGDVRYAIVAGNTHATFAIDRSTGSVF---LARRLDFETQRLYRLNVSAEDGGRPPRSSATILVVHVRDFNDNPPAFLPGD--VFASIMENIPIGTRVITVTARDPDADVNGELHYSIARQFPPGA-HFTIDPESGEI-CTAAEIDRE-VTGGLFEVTVRATDKAIPVHTRRSALKNVTVLVTDENDNAPRFVT--PTAILVDGLRAAAGSVVGTLQASDPDEAENAAVRYAV-TGGDAAILFRLDRR-----TGIIETSTELDRE 1358          

HSP 7 Score: 155.221 bits (391), Expect = 4.033e-38
Identity = 170/656 (25.91%), Postives = 283/656 (43.14%), Query Frame = 1
Query:  805 EIQVQILDKNDHNPIFETPET-KIVISEFSQIGISISLTSATDKD------HSSQYRI----QNYKLDEPTNSFILDISQLPSIFLKVSKKLDFEEKKQYHAKLKACDEDNCTTQNLI---IHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQS-LCSVTILVEDVNDHKPEIRII----ADLSSLKIQEEIPSKLITTLQIVDQDK-GPNGIVYCHLDPVCE-GSFELQNRS-KDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKI-IPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKS--AVLKYQI---DNYGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNG--NTMQRHDNYFNVLPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGAL 2682
            E++V + D ND+ P F  P   ++   E + +G  + L +A D+D      +   Y+I    +  +L  P       +++   + L  +  LD E    Y   ++A D  +      +   + ++D NDN P FE   Y  ++ ED  +G+ +       RD  L    +  +   FD            +G +  ++ L    R +Y   +  R +D  NP  S   +  I + DVND+ P IR +    A  S+   +   P  +   + + D D    NG +   +    E G F L       +  L+   + D E     +  ++  D G+P   S    + + + D+N+  P F   +      + E +  G+ V  V A D D    A L+Y I   ++ G  +F +D+++GL+  T+  +DRE  SS+   +   D   +PKTA   + +T+LD ND  PLF+      + +EN+ P   V  ++A D+D  EN  + ++           M R D+      TG + TL  LDRE  + Y L + A D   SP  PL S   +T+ V D ND  P + +P     +I +    G  +  + ATD D GANG VR+++               G +  F VN+ TGA+
Sbjct:    8 EVRVVVGDVNDNAPSFPEPGVMEVAFKEDAAVGRQVLLDTAVDRDVGPNGVNHHAYKIVSGNEEGRLVPPR-----PVTKRAFLHLATTGPLDREANPSYALAVQAEDGGSPRRYGRLQVNVTVQDANDNPPAFEKPAYRASVAEDSPVGAAL-------RD--LLHRGRGPLAVPFDPK----------TGMVSTRQPLDFEARRQYTLSL--RAADGGNPPLSGRATAVIQLLDVNDNDPAIRFVYLPPAARSASVDESAAPGTVAALVTVTDADSPTANGELSVSIVGGNERGHFVLHAPGVPGLRVLKVASQLDRERIPMYNLTILASDNGKPVARSATASLVVYVNDVNDHAPRFALSAYAA--ALSEGAPAGSYVKDVTAMDADSGLNAKLRYSIVSGNDLG--WFSVDESTGLV-TTDGKVDREVASSVVLNISAQDQGAQPKTAYTSLTVTLLDVNDEPPLFTQTKYVATAVENSLPGLFVVSVSAADSDLGENGTVRYNFDPDMPAQYREMFRLDSL-----TGKVTTLKSLDREELEEYPLVVQAQDRG-SP--PLGSTAKVTVVVGDLNDNHPVF-YPVQYFASILENEPGGTAVTTVTATDPDRGANGTVRYQLTA-------------GDAARFQVNAVTGAV 610          

HSP 8 Score: 144.821 bits (364), Expect = 6.364e-35
Identity = 147/568 (25.88%), Postives = 241/568 (42.43%), Query Frame = 1
Query: 1126 IHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIPSKLITTLQIV------DQDKGPNGIVYCHLDPV-----CEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKS--AVLKYQIDNYGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPK---TASVEVKITVLDANDNSPLFSTNLPQFSIIENTGP-SQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDN----YFNVLPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQML---HSGTVILLFRASDYGQPAK 2757
            I ++D NDN P+F      L ++E+   G +I  + A D D G    + YS+ +      +  F V+  SG ++  ++L    R+ Y   +  R SD  +   +  SV   V D ND+ P  R      S  + E+      TT  ++      D D GP G V   L P       +G+F L   +    +L   R  D E            D G  +  +R  + ++  D N+  P+ ++ S  L   V E++  GT ++ + A D D+   A L++ I +   E      N G +     L DRER S  +  V V D    P    +++V V + + D NDN+P F++  P+ ++     P   +V  + A D D   N+ + ++L                    N + TG +  + +LDRE    Y L ++A D  + P   LTS   + + V D ND +P +   +     I +   PG  +L+L A D D GANG++R++I       D            F ++   G L +++ L    + +  L  RA D G PA+
Sbjct: 1504 ISVEDVNDNPPVFAVPEMELEVEENTGEGEVIFTLSATDADQGQNALVTYSVLSG----SEGAFVVDAASGVLRASRRLDREERASYLLTV--RASDGTHATDARLSVA--VRDANDNSP--RFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDSDWADGAFGLHPVTG---ALNVTRPLDRESRACYVLRARATDGGGLAATARLYVNVL--DANDNAPSVQNDS--LAAEVPEDAPPGTSLLRISATDDDEGVNAELEFSISSGDPEGRFAVGNDGQLSVARAL-DRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFTS--PRSALAPEDSPVGAVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTV-TGEVRLVRELDREARQSYALTVLAVDKGRPP---LTSTATLAVTVGDANDNAPRFPRREYEAA-IAEDEPPGTEVLRLSAWDPDEGANGELRYDIASGDPTGD------------FRLDPVLGTLAVARPLDRERTASYELAVRARDGGGPAR 2034          

HSP 9 Score: 140.969 bits (354), Expect = 8.006e-34
Identity = 127/469 (27.08%), Postives = 207/469 (44.14%), Query Frame = 1
Query: 1027 LKVSKKLDFEEKKQYHAKLKACDEDN-CTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPF--RIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIPSKLITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNRSKDIYSL-------RSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKSA--VLKYQI---DNYGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENT-GPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLPTGHIETLLKLDREICDLYILEIMASD 2385
            L V++ LD E +  Y  + +A D      T  L +++ D NDN P  + ++    + ED   G+ + ++ A D D G+   +++SI +    D +  F V    G++ + + L    +S Y    R+  R   P     S   V++++ DVND+ P     +  S+L  ++     ++ T+Q VD D G N  V   L    E            ++L       R VR+ D E  Q     V+  D+G P L S   + + + D N+  P F  + +Y    + E+   GT+V+ + A D D+ A   L+Y I   D  G   F +D   G +     L DRER +S    V   D     ++ +  V++T+ D ND SP F  +       ENT GP  L+ Q+ A D D   +  ++++                F+V P GH+  L  LDRE    ++L I A+D
Sbjct: 1683 LNVTRPLDRESRACYVLRARATDGGGLAATARLYVNVLDANDNAPSVQNDSLAAEVPEDAPPGTSLLRISATDDDEGVNAELEFSISSG---DPEGRFAVGN-DGQLSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAF--TSPRSALAPEDSPVGAVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVDKGRPPLTSTATLAVTVGDANDNAPRFP-RREYEAA-IAEDEPPGTEVLRLSAWDPDEGANGELRYDIASGDPTGD--FRLDPVLGTLAVARPL-DRERTASYELAVRARDGGGPARSDTASVRVTLSDVNDCSPAFQLSPYTVHARENTQGPPVLILQVVARDDDLGSSGQVTYA-------AAGGNDGGAFSVSPDGHVHLLRSLDREAQPQHVLIITATD 2133          

HSP 10 Score: 127.102 bits (318), Expect = 1.754e-29
Identity = 173/695 (24.89%), Postives = 279/695 (40.14%), Query Frame = 1
Query:  634 TESDFFIVTEEGKILVRKLIDLETLCSQYKLCCGEPVCILKANILLNNKEKEVVSSVEIQV-QILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDE---PTNSFILD-----ISQLPSIFLKVSKKLDFEEKKQYHAKLKACDEDNCTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFT-RSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSS----LKIQE-EIPSKLITTLQIVDQDKGPNGIVYCHLDPVCEG-------------SFELQNR------SKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKS--AVLKYQIDNYGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPS-----QLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLP-TGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQLQATDRDVGANGKVRFEI 2592
            T + F I    G + + + +D ET    Y+L           N+   +  +   SS  I V  + D ND+ P F   +    I E   IG  +   +A D D      +  Y +     P   F +D     I     I  +V+  L FE   +   K           +N+ + + DENDN P F T T  L        GS++G ++A+D D      ++Y++ T  D  I   F ++  +G I+   +L   +    +   +VA ++    P+      TI+   +  + P  R   D  S    L+ Q   +PS  +     +D +     + +  L  V  G             SF+L  R      S  + SLR     D+     I           P + S   + I + D+N+  P F      L   V EN+  G  + T+ A D D+   A++ Y + +     F +D  SG++R +  L DRE  +S   TV   D           + + V DANDNSP FS +   F + E+  P       ++G + A DAD      ++++L  S + +     D  F + P TG +     LDRE    Y+L   A+D        L +   + + VLD ND +P+  + D+    + +   PG  LL++ ATD D G N ++ F I
Sbjct: 1121 THATFAIDRSTGSVFLARRLDFET-QRLYRL-----------NVSAEDGGRPPRSSATILVVHVRDFNDNPPAFLPGDVFASIMENIPIGTRVITVTARDPDADVNGELH-YSIARQFPPGAHFTIDPESGEICTAAEIDREVTGGL-FEVTVRATDKAIPVHTRRSALKNVTVLVTDENDNAPRFVTPTAILVDGLRAAAGSVVGTLQASDPDEAENAAVRYAV-TGGDAAI--LFRLDRRTGIIETSTELDRESGHGAFTLEVVAVEAKAAAPRTQRAENTIIANSMTFNHPLPRFPQDYESPINLLQGQTIPMPSSYLFLRHHLDWEPEGQLVFFTLLLGVTRGHGVINPLDAPWRVSFDLTARCMFIVFSSLLSSLR-----DNGAGSFI----------RPPMSSFNQVEISVEDVNDNPPVFAVPEMEL--EVEENTGEGEVIFTLSATDADQGQNALVTYSVLSGSEGAFVVDAASGVLRASRRL-DREERASYLLTVRASDGT---HATDARLSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDSDWA---DGAFGLHPVTGALNVTRPLDRESRACYVLRARATDGGG-----LAATARLYVNVLDANDNAPSVQN-DSLAAEVPEDAPPGTSLLRISATDDDEGVNAELEFSI 1768          

HSP 11 Score: 106.686 bits (265), Expect = 2.470e-23
Identity = 123/477 (25.79%), Postives = 206/477 (43.19%), Query Frame = 1
Query: 1426 PKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIP-SKLITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTK-----VMTVKAQDQDKS-------AVLKYQIDNYGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQML---HSGTVILLFRASDYGQPAKYSDHKLVINIFGDESGN 2808
            P  S   V I VEDVND+ P +  + ++  L+++E     ++I TL   D D+G N +V   +    EG+F +   S     LR+ R+ D E E+    + +    G  + ++R  + + + D N+  P F   +      V E++    K     + TV A D D         A+   +  ++    F +   +G +  T  L DRE  S   + +    +D     A+  + + VLDANDN+P    +     + E+  P   + +I+ATD D+  NA + FS+    +G+   R    F V   G +     LDRE    Y L +  SD A+ P   L+S V ++L + D ND +P +T P + +      +  G  +  +QA D D G N  V + +     +              F +N+ TG + + + L      +  L   A D G+P   S   L + + GD + N
Sbjct: 1495 PMSSFNQVEISVEDVNDNPP-VFAVPEM-ELEVEENTGEGEVIFTLSATDADQGQNALVTYSVLSGSEGAFVVDAASG---VLRASRRLDRE-ERASYLLTVRASDGTHATDAR--LSVAVRDANDNSPRFSRHAYSF--DVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDSDWADGAFGLHPVTGALNVTRPL-DRE--SRACYVLRARATDGGGLAATARLYVNVLDANDNAPSVQNDSLAAEVPEDAPPGTSLLRISATDDDEGVNAELEFSIS---SGDPEGR----FAVGNDGQLSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFTSPRSALAPEDSPV--GAVVATVQAVDPDSGRNSYVEYALATDGEE---GGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVDKGRPPLTSTATLAVTV-GDANDN 1945          

HSP 12 Score: 95.9005 bits (237), Expect = 5.797e-20
Identity = 94/390 (24.10%), Postives = 167/390 (42.82%), Query Frame = 1
Query:  790 VVSSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQ-NYKLDEPTNSFILDISQLPSIFLKVSKKLDFEEKKQYHAKLKACDEDNCTTQNLIIHIK------DENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTD------FDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIPSKLITTLQIVDQDKGPNGIVYCHL---DPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVK--AQDQD 1905
            + ++  + V +LD ND+ P  +       + E +  G S+   SATD D      ++ +    +P   F +         L V++ LD E +  Y+  ++  D        L   ++      D NDN P F +    L   ED  +G+++  V+A D DSG    ++Y++ TD              F + T++G ++L ++L    R  Y   ++A D     P  S  ++ + V D ND+ P      +  +   ++E P   +  L   D D+G NG +   +   DP   G F L      + +L   R  D E     +  V  +D G P+      + + ++D+N+  P F+  S Y + H  EN++ G  V+ ++  A+D D
Sbjct: 1709 LAATARLYVNVLDANDNAPSVQNDSLAAEVPEDAPPGTSLLRISATDDDEGVNAELEFSISSGDPEGRFAVGNDGQ----LSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFTSPRSALA-PEDSPVGAVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVDKG-RPPLTSTATLAVTVGDANDNAPRFP-RREYEAAIAEDEPPGTEVLRLSAWDPDEGANGELRYDIASGDPT--GDFRLD---PVLGTLAVARPLDRERTASYELAVRARDGGGPARSDTASVRVTLSDVNDCSPAFQ-LSPYTV-HARENTQ-GPPVLILQVVARDDD 2083          
BLAST of Protocadherin-9 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006996.1 (pep scaffold:Pmarinus_7.0:GL476780:2096:143714:1 gene:ENSPMAG00000006222.1 transcript:ENSPMAT00000006996.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 186.422 bits (472), Expect = 1.219e-47
Identity = 187/658 (28.42%), Postives = 304/658 (46.20%), Query Frame = 1
Query:  763 ILLNNKEKEVVSSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNSFILDISQLPSIFLKVSKKLDFEEKKQYHAKLKACDEDNCTTQNLI-IHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYP-----FRIVARD--SDPINPKQSLCSVTILVE--DVNDHKPEIRIIADLSSLKIQEEIPSKLITTLQIV-----DQDKGPNGIVYCHLDPV--CEGS--FELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIIT--DLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQD--KSAVLKYQIDNYGAEYFEIDQNSGLIRCTNNLIDRERVSSISFT------VHVMDSDTEPKTASVEVKITVL--DANDNSPLFSTNLP-QFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQG 2640
            +  N    E   S  + + ++++ND+ PIF  P   + + E + +G S+    ATD D +  +   +Y   + ++ F LD +   S  + V+  LDFE   ++   + A D     T   + I++ D NDN P+F+ ++Y  T +E+    + + +V+A D DS     I YSI     T   S+++  T+SG   +          + P       I+A D  S P+N      +VT +VE  D ND+ P    I D +S  I   IP  ++    ++     D D+ P    Y  L  +   EGS  F +  RS DI    S    D E   +   IV   D G+ + +   I  + IT  D+N+  P ++D    +   + EN+  GT + TV A D D  ++  L Y ID     ++ I+  SG IR T   +DRE ++ ISF       V   D  + P+ A+    +TVL  D NDN P F   LP    ++E    +  + Q+ ATD D+  N  +++S+  +     + R D   +   TG I TL++LDRE    Y L ++A+D        L+S   ++L VLD ND +PT+ HP  + +++ +++     ++ L  TD D G N ++ F I    +    S  F  G
Sbjct:    1 LFANETSGEHWGSARVHITLINENDNRPIFSLPLYNVSVWENATLGTSVVQVLATDLD-AGVFGQVSYHFSDDSDKFSLDPA---SGLISVAAALDFEATPRFTVTVMARDGGGQETAGRVRINLLDVNDNTPVFQRDSYVGTARENDNSLTPVVRVRATDEDSPPNNQITYSI---LPTSAYSSYFSITVSGGYGVVTLARALDYEKIPGGTISLTIMALDGGSPPLN-----STVTAIVEVFDENDNSP----IFDRNSYSIA--IPENILAGATVLYVNATDGDQSPE---YGQLSLIYSLEGSTQFRINARSGDI---TSTTLLDREAVSQYILIVRAVDGGDGNDQKTGIATVNITLLDVNDNDPAWRDLPYAVT--IVENTPGGTDIFTVSAADPDLNENGTLVYAIDPPN-PFYRINAASGKIRTTGLQLDREDLNPISFASMRSIVVSGADRGSPPRRATASATVTVLLQDVNDNEPSF-VGLPYALQVLEGLPANSTLFQVTATDPDEGANGNVTYSMTAA-----LPRPDFQLDA-ATGLITTLVQLDREAVAAYQLRLVATDRGTP---ALSSTTTLSLVVLDVNDNAPTF-HPARSAVSLMESVARDSVVISLNCTDADSGLNAELSFFITGGNQDGQFSVGFRDG 620          

HSP 2 Score: 151.369 bits (381), Expect = 6.290e-37
Identity = 176/713 (24.68%), Postives = 300/713 (42.08%), Query Frame = 1
Query:  649 FIVTEEGKILVRKLIDLETLCSQYKLCCGEPVCILKANILLNNKEKEVVSSVEIQVQILDKNDHNPIFETPETKIV-ISEFSQIGISISLTSATDKDHSSQ----YRIQNYKLDEPTNSFILDISQLPSIFLKVSKKLDFEEKKQYHAKLKACDEDN-----CTTQNLIIHIKDENDNQPIFET-ETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSG------------RIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCS-VTILVEDVNDHKPEIRIIADLSSLKIQEEIP-SKLITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQD--KSAVLKYQIDNYGA------EYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVE-VKITVLDANDNSPLFSTNLP-------QFSIIENTGPSQLVGQIN-ATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLPTGHIETLLKLDREICDLYILEIMASDSAK-SPQIPLT---------SIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQLQATDRDVGANGKVRFEIIK-QYRKEDGSSS 2628
             I   +G+I  +  +D E   S             +A  +L NK    V      V + D+ND++P FE     +V + E +  G  +++  ATD+D  S      R   +        +IL I     + +    K DF EK       +    D       TT NL + + D NDN PIF +   Y +++ E    G+++  V A D D+G  G              Q TF +E+  G            R+     +   TR+ Y   +VA D    NP  S  + V +LV+DVND +P    +A + ++ + E +     + T++  +  KG N      +  + + +F +   S  + S R ++ +     ++ +   +  D G P L  +  + + + D+N+ RP F       + ++ E      +++ V A D D  ++  ++Y   + G       E F I+  SG+I  T   +DRE  +  S  +   D        S + +++ + D +DN P+F   LP        FSI E++ P   VG ++ A DAD   NA++ + +     GN        FN+   G +  L  LDRE+   Y + + AS +   +P +            ++  + + + D ND+ P +T+ +       D  + G  LLQL+A DRDVG N  V + I+   Y K   +SS
Sbjct: 1777 LIAALQGEITTQAALDREATDSYMLTVLSRDGGPREAIAVLTNKPGAYV-----YVNVTDENDNSPEFEAGSATLVEVRESAAPGTLLTVLHATDRDAGSNGTVSARAHTHTGTRIPPQYILIIQNESGVTIVDVAKADFVEKTSQFILFRIVALDGGSPPRSTTFNLSVIVLDVNDNVPIFLSPGGYAVSVVELGAPGTLVASVWATDADAGPNG--------------QVTFRIESGGGDKLSIGPSDGIIRVAPGANIDRETRAAYTLMVVAVDRG--NPPLSGSAIVRVLVDDVNDERPAF--LAPVQTVSVLESLSVGSFVATVKATENYKGHNTKYTYKIAGIGKNAFTVHATSGLVTSTRLLKSY-----ERFNLTAVATDHGRPPLWGQAGLYVEVLDVNDHRPVFVLPPNGTVVNITEVMPVVIRIVEVLAVDGDEGQNGAVRYSFLHAGGVGSRDWESFRINATSGII-STARALDRESQAVYSLILLASDQGQPVSYESTQPLQVVLDDIDDNEPVFIV-LPDGGAPYQSFSIPEHSPPGTAVGNVSGAVDADVGANAIVYYFIAAGNEGNK-------FNLSRWGLLVVLSDLDREVSPYYAIIVKASSNPNWTPAVTTGPEFDPSKDRTLREVRVYLEDINDQWPVFTNHEYTAGVAVDA-KVGSELLQLEAVDRDVGNNSIVLYRILSILYIKHSSNSS 2451          

HSP 3 Score: 148.673 bits (374), Expect = 4.714e-36
Identity = 172/658 (26.14%), Postives = 279/658 (42.40%), Query Frame = 1
Query:  805 EIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNS----FILDISQLPSIFLKVSKKLDFEEKKQYHAKLKACDEDNCT-----TQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRD-SGLFGTIK--YSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDS-DPINPKQSLCSVTILVEDVNDHKPEIRIIADLS-SLKIQEEIPSKL-ITTLQIVDQDKGPNGIVYCHLDP-------------VCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEP--SLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKSAVLKYQIDNYGA---EYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNV-LPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTG 2676
             +++ +LD ND+ P+F+         E       +    ATD+D     +I    L  PT++    F + +S    + + +++ LD+E+       L     D  +     T   I+ + DENDN PIF+  +Y++ I E++  G+ +  V A D D S  +G +   YS+         + F +   SG I     L     S+Y   + A D  D  + K  + +V I + DVND+ P  R   DL  ++ I E  P    I T+   D D   NG +   +DP             +     +L     +  S  S+R            +V   D+G P     +   + +++ D+N+  P+F      L   V E     + +  V A D D+ A          A     F++D  +GLI     L DRE V++    +   D  T   +++  + + VLD NDN+P F       S++E+     +V  +N TDAD   NA +SF +       T    D  F+V    G + T++ LDRE    Y L I A D+  +     T    + + VLD ND  P +      + ++ + +  G  +LQ+QATD D G NG+V + II     +DG+          F+VN S+G
Sbjct:  116 RVRINLLDVNDNTPVFQRDSYVGTARENDNSLTPVVRVRATDEDSPPNNQITYSIL--PTSAYSSYFSITVSGGYGV-VTLARALDYEKIPGGTISLTIMALDGGSPPLNSTVTAIVEVFDENDNSPIFDRNSYSIAIPENILAGATVLYVNATDGDQSPEYGQLSLIYSLEG------STQFRINARSGDITSTTLLDREAVSQYILIVRAVDGGDGNDQKTGIATVNITLLDVNDNDPAWR---DLPYAVTIVENTPGGTDIFTVSAADPDLNENGTLVYAIDPPNPFYRINAASGKIRTTGLQLDREDLNPISFASMRSI----------VVSGADRGSPPRRATASATVTVLLQDVNDNEPSFVGLPYAL--QVLEGLPANSTLFQVTATDPDEGANGNVTYSMTAALPRPDFQLDAATGLITTLVQL-DREAVAAYQLRLVATDRGTPALSSTTTLSLVVLDVNDNAPTFHPARSAVSLMESVARDSVVISLNCTDADSGLNAELSFFI-------TGGNQDGQFSVGFRDGLVRTVVSLDRETKASYSLVIEAIDNGPAGS-RRTGTTTLDVLVLDVNDNRPLFLEGSYEV-SVPENVTRGAIILQVQATDIDEGINGRVWYRIISG--NQDGN----------FLVNVSSG 727          

HSP 4 Score: 148.288 bits (373), Expect = 5.489e-36
Identity = 177/787 (22.49%), Postives = 326/787 (41.42%), Query Frame = 1
Query:  538 IQMHEEIPPNSEIGSILSAIPHNLRSTSLEFITESDFFIVTEEGK----ILVRKLIDLETLCSQYKLCCGEPVCILKANILLNNKEKEVVSSVEIQVQILDKNDHNPIFE-TPETKIVISEFSQIGISISLTSATDKD------HSSQYRIQN-----YKLDEPTNSFILDISQLPSIFLKVSKKLDFEEKKQYHAKLKACDED---NCTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDS--------GLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCS-----VTILVEDVNDHKPEIRIIADLSSLKIQEEI-PSKLITTLQIVDQDKGPNGIV----YCHLDPVCEGSFELQNRSKDIYSLRSVRKFD--HEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKS--AVLKYQIDNYGAEYFEIDQNSGLIRCTNNL-IDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNN-ILNITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQML---HSGTVILLFRASDYGQPAKY 2760
            +    EIP NS  G++L+ +   + ++  +F   +        G     ++ R   ++     Q     G P   L+  IL+ +  +   ++V + V +LD ND+ P F  T +T  V+     +G S+ +  A D+D       + +Y I +     + +DE T    L ++  P         +D+E + +Y   + A D+    +  +  L + +++E D +  F    Y   + E    G+++ +V A    +         +     +  +     +  +   +  L G I  +  L       Y   +++RD  P      L +     V + V D ND+ PE       + ++++E   P  L+T L   D+D G NG V    + H        + L  +++   ++  V K D   +  Q I   ++  D G P   +   + +I+ D+N+  P F     Y +  V E    GT V +V A D D      + ++I++ G +   I  + G+IR      IDRE  ++ +  V  +D    P + S  V++ V D ND  P F   +   S++E+      V  + AT+  +  N   ++ +             N F V  T  + T  +L +   + + L  +A+D  +    PL     + + VLD ND  P +  P N  ++NIT+ M     ++++ A D D G NG VR+  +  +    GS  +     + F +N+++G +  ++ L         L+  ASD GQP  Y
Sbjct: 1503 VTYEAEIPENSPNGTVLTVLNGPIYASDADFGVNATLAYSLLGGSSAYFLIDRDRGNVSMALGQGLDREGIPGGRLELTILVQDGGRRN-ATVRLGVTVLDVNDNTPTFNVTSQTAHVLENSPAVGTSVIVVKAMDRDLGVCDAGTVRYSIASGGNDTFGIDESTG---LIVTVAP---------IDYETRPEYLLMVVATDQAPPFHTASCELRVSLQNELDEKLSFSLAAYQAALSEAAVPGTVVVRVAAPQMKAPPKLPLPLAILVQKWHEDKRHKQQESDNAELIAALQGEITTQAALDREATDSYMLTVLSRDGGPREAIAVLTNKPGAYVYVNVTDENDNSPEFEA-GSATLVEVRESAAPGTLLTVLHATDRDAGSNGTVSARAHTHTGTRIPPQYILIIQNESGVTIVDVAKADFVEKTSQFILFRIVALDGGSPPRSTTFNLSVIVLDVNDNVPIFLSPGGYAVS-VVELGAPGTLVASVWATDADAGPNGQVTFRIESGGGDKLSIGPSDGIIRVAPGANIDRETRAAYTLMVVAVDRGNPPLSGSAIVRVLVDDVNDERPAFLAPVQTVSVLESLSVGSFVATVKATENYKGHNTKYTYKIAGIGK--------NAFTVHATSGLVTSTRLLKS-YERFNLTAVATDHGRP---PLWGQAGLYVEVLDVNDHRPVFVLPPNGTVVNITEVMPVVIRIVEVLAVDGDEGQNGAVRYSFL--HAGGVGSRDW-----ESFRINATSGIISTARALDRESQAVYSLILLASDQGQPVSY 2255          

HSP 5 Score: 143.665 bits (361), Expect = 1.646e-34
Identity = 159/577 (27.56%), Postives = 257/577 (44.54%), Query Frame = 1
Query: 1126 IHIK--DENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIPSKLITTLQIVDQDKGPNG-IVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEV--EQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKS-----AVLKYQIDNYGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDS--DTEPKTASVEVKITVLDANDNSPLFSTNLP-QFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLPTGHIETL-LKLDRE----ICDLYILEIMASDSAK-SPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQMLHSGTVI---LLFRASDYGQPAKYSDHKLVINIF 2790
            +HI   +ENDN+PIF    YN+++ E+  +G+ + QV A D D+G+FG + Y    D D      F ++  SG I +   L      R+   ++ARD      +++   V I + DVND+ P  +  + + + +  +   + ++  ++  D+D  PN  I Y  L      S+     S     +   R  D+E      I   ++  D G P L S     + + D N+  P F D++ Y +  + EN   G  V+ V A D D+S       L Y ++  G+  F I+  SG I  T  L+DRE VS     V  +D     + KT    V IT+LD NDN P +  +LP   +I+ENT     +  ++A D D +EN  + +++      N   R +       +G I T  L+LDRE    I    +  I+ S + + SP    T+   +T+ + D ND  P++       L + + +     L Q+ ATD D GANG V + +     + D            F ++++TG +     L    V    L   A+D G PA  S   L + + 
Sbjct:   16 VHITLINENDNRPIFSLPLYNVSVWENATLGTSVVQVLATDLDAGVFGQVSYHFSDDSD-----KFSLDPASGLISVAAALDFEATPRFTVTVMARDG---GGQETAGRVRINLLDVNDNTPVFQRDSYVGTARENDNSLTPVV-RVRATDEDSPPNNQITYSILPTSAYSSYFSITVSGGYGVVTLARALDYEKIPGGTISLTIMALDGGSPPLNSTVTAIVEVFDENDNSPIF-DRNSYSIA-IPENILAGATVLYVNATDGDQSPEYGQLSLIYSLE--GSTQFRINARSGDITST-TLLDREAVSQYILIVRAVDGGDGNDQKTGIATVNITLLDVNDNDPAWR-DLPYAVTIVENTPGGTDIFTVSAADPDLNENGTLVYAIDPP---NPFYRIN-----AASGKIRTTGLQLDREDLNPISFASMRSIVVSGADRGSPPRRATASATVTVLLQDVNDNEPSFVGLP-YALQVLEGLPANSTLFQVTATDPDEGANGNVTYSMTAALPRPD------------FQLDAATGLITTLVQLDREAVAAYQLRLVATDRGTPALSSTTTLSLVVL 556          

HSP 6 Score: 140.969 bits (354), Expect = 9.318e-34
Identity = 167/659 (25.34%), Postives = 291/659 (44.16%), Query Frame = 1
Query:  550 EEIPPNSEIGSILSAIPHNLRSTSLEFITESDFFIVTEEGKILVRKLIDLETLCSQYKLCCGEPVCILKANILLNNKEKEVVSSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQN--YKLDEPT----NSFILDISQLPSIFLKVSKKLDFEEKKQYHAKLKACDEDNCTTQ-----NLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFY-VETLSGRIKL------KKKLS--TFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIPSKLITTLQI--VDQDKGPNG-IVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKS--AVLKYQIDNYGAE-YFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSD--TEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLPTGHI-ETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLR 2439
            E+ PPN++I    S +P +  S+         + +VT     L R L         Y+   G  + +    + L+     + S+V   V++ D+ND++PIF+     I I E    G ++   +ATD D S +Y   +  Y L+  T    N+   DI+         +  LD E   QY   ++A D  +   Q      + I + D NDN P +    Y +TI E+   G+ I  V A D D    GT+ Y+I      D  + FY +   SG+I+       ++ L+  +F   R      A    P     +  +VT+L++DVND++P    +    +L++ E +P+   T  Q+   D D+G NG + Y     +    F+L   +  I +L    + D E        ++  D+G P+L S   + +++ D+N+  PTF      +   + E+    + V+++   D D    A L + I     +  F +    GL+R   +L DRE  +S S  +  +D+      +T +  + + VLD NDN PLF     + S+ EN     ++ Q+ ATD D+  N  + + +    +GN   +  N+   + +G I      LDRE   L+ L++ A +   +  + L+S++ +  R
Sbjct:  158 EDSPPNNQI--TYSILPTSAYSSYFSITVSGGYGVVT-----LARAL--------DYEKIPGGTISLTI--MALDGGSPPLNSTVTAIVEVFDENDNSPIFDRNSYSIAIPENILAGATVLYVNATDGDQSPEYGQLSLIYSLEGSTQFRINARSGDITS--------TTLLDREAVSQYILIVRAVDGGDGNDQKTGIATVNITLLDVNDNDPAWRDLPYAVTIVENTPGGTDIFTVSAADPDLNENGTLVYAI------DPPNPFYRINAASGKIRTTGLQLDREDLNPISFASMRSIVVSGADRGSPPRRATASATVTVLLQDVNDNEPS--FVGLPYALQVLEGLPAN-STLFQVTATDPDEGANGNVTYSMTAALPRPDFQLDAATGLITTL---VQLDREAVAAYQLRLVATDRGTPALSSTTTLSLVVLDVNDNAPTFHPARSAV--SLMESVARDSVVISLNCTDADSGLNAELSFFITGGNQDGQFSVGFRDGLVRTVVSL-DRETKASYSLVIEAIDNGPAGSRRTGTTTLDVLVLDVNDNRPLFLEGSYEVSVPENVTRGAIILQVQATDIDEGINGRVWYRI---ISGN---QDGNFLVNVSSGLISRGATPLDRETVALHALQVEAFN---NDSVGLSSVIRVRSR 767          

HSP 7 Score: 123.25 bits (308), Expect = 2.561e-28
Identity = 138/560 (24.64%), Postives = 249/560 (44.46%), Query Frame = 1
Query:  796 SSVEIQVQILDKNDHNPIFETPETKIVISEF-SQIGISISLTSATDKDHSSQYRIQNYKLDEPTNSFILDISQLPSIFLKVSKKLDFE-EKKQYHAKLKACDEDN------CTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKK--KLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIPSKLITTLQIVDQDKGPNGIVYCHLDPV--CEG--SFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRK---IIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTV-----KAQDQD--KSAVLKYQIDNYGAEYFEIDQNSGLIRCT-NNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENT---GPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLPTGHIETLLKLDREICDLYILEIMASDSA 2391
            ++  + ++I D+ND+ P F     +++++E  S  G++++  +A+D D     R+  Y +     +    I     +   V K LDFE     Y   + A D+         +T  + +H+ D ND  P F           + Q G  I    A+D+DSGL G ++YSI    D D ++ F +    G +++++  +L   T++ Y   I+A+D     P  S  +V + V DV+D+ P    +   +SL     + + +++ ++  D ++G N        P   C G  +F   +++  +Y     R  D E   +    +  +D  +    +RK   I+ + I D N+  P F   +      + ENS  GT V+TV      A D D   +A L Y +    + YF ID++ G +       +DRE +      + ++  D   + A+V + +TVLD NDN+P F+       ++EN+   G S +V +    D    +   + +S+ +  N       D +     TG I T+  +D E    Y+L ++A+D A
Sbjct: 1154 ATTSVLIRITDENDNAPAFGAATYEVLLTEGPSTAGVAVANVTASDPDEGDNARVV-YAIVSGNTAATFGIDNGTGVLTAV-KALDFEVSAGLYLLVVTATDQPRDPARRLTSTATVSVHVADVNDVTPWFLRSYEGPIDVSEGQPGPRIATFMASDQDSGLNGELEYSI---IDGDPRNEFVISPADGDLRVRRYVELDRETQAFYNLTIMAKDMG-TPPLNSTLTVGVRVLDVHDNDPVFLNLPANASLSEAAAVLA-IVSRVRASDANEGRNCAALLQHSPTSFCNGERAFYADSQTGLVYV---NRPLDRERVAEYRLTLTVRDNPDNPSYARKDSDIMIVTILDENDNSPVFSQVTYE--AEIPENSPNGT-VLTVLNGPIYASDADFGVNATLAYSLLGGSSAYFLIDRDRGNVSMALGQGLDREGIPGGRLELTILVQDGGRRNATVRLGVTVLDVNDNTPTFNVTSQTAHVLENSPAVGTSVIVVKAMDRDLGVCDAGTVRYSIASGGN-------DTFGIDESTGLIVTVAPIDYETRPEYLLMVVATDQA 1693          

HSP 8 Score: 91.6633 bits (226), Expect = 9.567e-19
Identity = 124/505 (24.55%), Postives = 208/505 (41.19%), Query Frame = 1
Query: 1219 IGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIPSKLITTLQIVDQDKGPNG-IVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVI-CKDQ-GEPS--LESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKS--AVLKYQI-DNYGAEYFEIDQNSGLIRCTNNL-IDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLP-QFSIIENTGPSQLVGQINATDADQDEN--ALISFSLRNSWNGNTMQRHDNYFNVLPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTH-------PDNNILNITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTG 2676
            I Q++A    SG  G +  +   +    I+ T   + L  ++ +K+  S  TR      + A       P Q+  SV I + D ND+ P          L          +  +   D D+G N  +VY  +      +F + N +     L +V+  D EV   +  +V+   DQ  +P+  L S   + + + D+N+  P F    +  +       + G ++ T  A DQD      L+Y I D      F I    G +R    + +DRE  +  + T+   D  T P  +++ V + VLD +DN P+F  NLP   S+ E      +V ++ A+DA++  N  AL+  S  +  NG      D+      TG +     LDRE    Y L +   D+  +P         + + +LDEND SP ++        P+N+      T+  G     + A+D D G N  + + ++              GSS YF+++   G
Sbjct: 1092 ISQIEAAVTISGASGVLSEAT-LNKQASIKITTITQRLCTKVLVKRAASASTRG---ICLTA------TPAQATTSVLIRITDENDNAPAFGAATYEVLLTEGPSTAGVAVANVTASDPDEGDNARVVYAIVSGNTAATFGIDNGTG---VLTAVKALDFEVSAGLYLLVVTATDQPRDPARRLTSTATVSVHVADVNDVTPWFLRSYEGPID--VSEGQPGPRIATFMASDQDSGLNGELEYSIIDGDPRNEFVISPADGDLRVRRYVELDRETQAFYNLTIMAKDMGTPPLNSTLTVGVRVLDVHDNDPVF-LNLPANASLSEAAAVLAIVSRVRASDANEGRNCAALLQHSPTSFCNGERAFYADSQ-----TGLVYVNRPLDRERVAEYRLTLTVRDNPDNPSYARKDSDIMIVTILDENDNSPVFSQVTYEAEIPENSPNGTVLTVLNG----PIYASDADFGVNATLAYSLLG-------------GSSAYFLIDRDRG 1558          

HSP 9 Score: 55.8398 bits (133), Expect = 8.493e-8
Identity = 64/257 (24.90%), Postives = 110/257 (42.80%), Query Frame = 1
Query: 2074 ASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLP-TGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDH----LLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYF--IVNSSTGALWISQMLH-----SGTVILLFRASDYGQPAKYSDHKLVINIFGDESGN 2808
             S  V IT+++ NDN P+FS  L   S+ EN      V Q+ ATD D      +S+   +           + F++ P +G I     LD E    + + +MA D          +   + + +LD ND +P +        +   T R  D+    +++++ATD D   N ++ + I+        +S++    S YF   V+   G + +++ L       GT+ L   A D G P   S    ++ +F DE+ N
Sbjct:   12 GSARVHITLINENDNRPIFSLPLYNVSVWENATLGTSVVQVLATDLDAGVFGQVSYHFSDD---------SDKFSLDPASGLISVAAALDFEATPRFTVTVMARDGGGQ-----ETAGRVRINLLDVNDNTPVFQRD-----SYVGTARENDNSLTPVVRVRATDEDSPPNNQITYSILP-------TSAY----SSYFSITVSGGYGVVTLARALDYEKIPGGTISLTIMALDGGSPPLNSTVTAIVEVF-DENDN 237          
BLAST of Protocadherin-9 vs. Ensembl Sea Lamprey
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 184.496 bits (467), Expect = 1.221e-47
Identity = 184/704 (26.14%), Postives = 317/704 (45.03%), Query Frame = 1
Query:  802 VEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKL--DEPT--NSFILDISQLPSI----FLKVSKKLDFEEKKQYHAKLKACDED---NCTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDI-----QSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDP-----------INPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIPSKLITTLQIVDQDKGPNGIVYCHL-DPVCEGSFELQNRS-KDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKA--QDQDKSAVLKYQIDNYGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLP-TGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILN--ITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQML---HSGTVILLFRASDYGQPAKYSDHKLVINIFGDES 2802
            +E+++ + D ND+ P F  P   + + E +  G    +  A D D S    ++ Y+L   +P   ++F L +++  +     +L V K LD EE++ Y   L+A D     +  +  L I++ D NDN P+F+    N+ I E+  +G+ + Q+ A+DRD+G    + Y + T           +  F ++  SG + +   L+      Y   I+A D  P                +  S TI + D+      +  I++ S + +    P  LIT   + D D G NG V C++ +P  E  F+L+  +  + Y L +    D+E + +    +   D G  SL     + I + D N+  P F + +  +   V EN+  G  ++TV A  +D DK+A + Y +       F +D  +G+I  T  L DRE+ ++ SFT+   D        +  V + VLD NDN P FS     F + EN      VG +   D+D+ EN  +  S+  + N          F++ P +G I + +  DRE    Y+LE+ A+D  +  +   +S V + + V+D ND SP    P +N     +     PG  + ++ A D D   N ++R+ I+       G +  N      F ++   G + + + L   H G   L+ R SD G   ++    LV ++F +E+
Sbjct:  137 IEVRINVEDINDNAPAFAAPVLTVSVPENAPAGKRFPIQPANDPD-SEANGVRRYELLPSDPATVSAFELSVTETANGEKVPYLVVRKSLDREERQLYEMNLRAVDGGSPPHSGSAVLRINVTDTNDNSPVFDQAEVNVEIPENSPVGTHVVQLHASDRDAGSNAEVVYRLGTSTGGAGSGQGGKRLFRLDQNSGLVTVNGLLNREESPVYRIIILATDKGPEPVPATATVTVTVTDVNDNSPTIEIRDIVAPVNGVIYISEASHVNL----PVALIT---VSDPDIGANGAVTCYIYNP--EVPFQLKKLTYPNQYLLETRETLDYETKNEYVVQIKAADAGATSLSRTMSVTIKLLDSNDNAPVFTEPTYKV--SVPENNVIGKHLITVSATDRDMDKNAEMVYFLGPDAPTMFHMDPETGIISLTEQL-DREKKANYSFTILAKDQGIPVLEGNATVIVNVLDVNDNRPRFSLAEFDFYVNENVPKHSTVGMVTVADSDEGENGRVRLSILGTDN-------RQLFSIDPESGMIRSNVGFDREQRHYYVLEVQATDGGEPVR---SSTVKVVIHVMDINDNSPIVLMPPSNTTYKFVVPRTLPGTIVTEVSAVDNDAEINAELRYHIV-------GGNPHN-----LFHIDPVIGNITLMEPLTETHHGLHRLVVRVSDIGIAVQHHAVALV-HVFVNET 804          

HSP 2 Score: 97.8265 bits (242), Expect = 1.044e-20
Identity = 141/587 (24.02%), Postives = 254/587 (43.27%), Query Frame = 1
Query:  796 SSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQ----YRIQNYKLDEPTNSFILDISQLP--SIFLKVSKKLDFEEKKQYHAKLKACD---EDNCTTQNLIIHIKDENDNQPIFETE------TYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIK-YSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKI---QEEIPSKLITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTF--KDKSQYLLGHVWENSEFGTKVMTVKAQDQDKSAVLKYQI---DNYGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLF---STNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLPT-GHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTW 2472
             S  +++ + D ND++P+F+  E  + I E S +G  +    A+D+D  S     YR+        +      + +L   S  + V+  L+ EE   Y   + A D   E    T  + + + D NDN P  E           + I E   +   +  +  +D D G  G +  Y    +    ++   Y       ++ ++ L   T++ Y  +I A D+   +  +++ SVTI + D ND+ P    +    + K+   +  +  K + T+   D+D   N  +   L P     F +   +  I SL    + D E +      ++ KDQG P LE    + + + D+N+ RP F   +   Y+  +V ++S  G  ++TV   D+ ++  ++  I   DN   + F ID  SG+IR +N   DRE+       V   D     ++++V+V I V+D NDNSP+     +N     ++  T P  +V +++A D D + NA + + +     GN      N F++ P  G+I  +  L      L+ L +  SD   + Q    ++V++ +    EN     W
Sbjct:  249 GSAVLRINVTDTNDNSPVFDQAEVNVEIPENSPVGTHVVQLHASDRDAGSNAEVVYRLGTSTGGAGSGQGGKRLFRLDQNSGLVTVNGLLNREESPVYRIIILATDKGPEPVPATATVTVTVTDVNDNSPTIEIRDIVAPVNGVIYISEASHVNLPVALITVSDPDIGANGAVTCYIYNPEVPFQLKKLTYPNQY--LLETRETLDYETKNEYVVQIKAADAGATSLSRTM-SVTIKLLDSNDNAP----VFTEPTYKVSVPENNVIGKHLITVSATDRDMDKNAEMVYFLGPDAPTMFHMDPETG-IISL--TEQLDREKKANYSFTILAKDQGIPVLEGNATVIVNVLDVNDNRPRFSLAEFDFYVNENVPKHSTVG--MVTVADSDEGENGRVRLSILGTDNR--QLFSIDPESGMIR-SNVGFDREQRHYYVLEVQATDGGEPVRSSTVKVVIHVMDINDNSPIVLMPPSNTTYKFVVPRTLPGTIVTEVSAVDNDAEINAELRYHI---VGGNP----HNLFHIDPVIGNITLMEPLTETHHGLHRLVVRVSDIGIAVQHHAVALVHVFVNETLENATYIEW 813          

HSP 3 Score: 88.9669 bits (219), Expect = 4.816e-18
Identity = 130/504 (25.79%), Postives = 219/504 (43.45%), Query Frame = 1
Query: 1417 PINPKQ--SLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIPSKLITTLQIV-DQDKGPNGIVYCHL---DPVCEGSFELQ-----NRSKDIYSLRSVRK-FDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKS--AVLKYQIDNYGA---------EYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTN---LPQFSIIENTGPSQL---VGQINATDADQDENALISFSLRN---SWNGNTMQRHDNYFNVLPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTH-------PDNNILNITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQML-------HSGTVILLFRASDYGQPAKYSDHKLVINIF 2790
            P+ P     L  V I VED+ND+ P     A + ++ + E  P+     +Q   D D   NG+    L   DP    +FEL      N  K  Y +  VRK  D E  Q  +  +   D G P      ++ I +TD N+  P F D+++  +  + ENS  GT V+ + A D+D    A + Y++                F +DQNSGL+   N L++RE        +   D   EP  A+  V +TV D NDNSP         P   +I  +  S +   V  I  +D D   N  ++  + N    +    +   + Y        +ET   LD E  + Y+++I A+D+  +    L+  +++T+++LD ND +P +T        P+NN++        G HL+ + ATDRD+  N ++ +     +   D  + F+        ++  TG + +++ L       +S T++    A D G P    +  +++N+ 
Sbjct:  127 PVQPGPFFKLIEVRINVEDINDNAPA--FAAPVLTVSVPENAPAGKRFPIQPANDPDSEANGVRRYELLPSDPATVSAFELSVTETANGEKVPYLV--VRKSLDREERQLYEMNLRAVDGGSPPHSGSAVLRINVTDTNDNSPVF-DQAEVNV-EIPENSPVGTHVVQLHASDRDAGSNAEVVYRLGTSTGGAGSGQGGKRLFRLDQNSGLV-TVNGLLNREESPVYRIIILATDKGPEPVPATATVTVTVTDVNDNSPTIEIRDIVAPVNGVIYISEASHVNLPVALITVSDPDIGANGAVTCYIYNPEVPFQLKKLTYPNQYL-------LETRETLDYETKNEYVVQIKAADAGAT---SLSRTMSVTIKLLDSNDNAPVFTEPTYKVSVPENNVI--------GKHLITVSATDRDMDKNAEMVY-----FLGPDAPTMFH--------MDPETGIISLTEQLDREKKANYSFTIL----AKDQGIPVLEGNATVIVNVL 588          

HSP 4 Score: 65.0846 bits (157), Expect = 9.179e-11
Identity = 67/261 (25.67%), Postives = 108/261 (41.38%), Query Frame = 1
Query: 1855 NSEFGTKVMTVKAQDQDKSAVLKYQIDNYGAEYFEIDQNSGLIRCTNNLIDRERVSS---------ISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLPTGHIETL------LKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQLQATDRDVGANGKVRFEI 2592
            N E   KVM  KA+D     V              ++  +G +      +DRE +           +   V V+     P    +EV+I V D NDN+P F+  +   S+ EN    +      A D D + N +  + L  S +  T+   +   +V  T + E +        LDRE   LY + + A D    P    +    + + V D ND SP +   + N+  I +    G H++QL A+DRD G+N +V + +
Sbjct:   66 NLELTYKVMLSKAEDAAPPLV-------------RVNPRTGELFAAGRKMDREALCGGQDPGDECHVDVQVGVLPVQPGPFFKLIEVRINVEDINDNAPAFAAPVLTVSVPENAPAGKRFPIQPANDPDSEANGVRRYELLPS-DPATVSAFE--LSVTETANGEKVPYLVVRKSLDREERQLYEMNLRAVDGGSPPH---SGSAVLRINVTDTNDNSPVFDQAEVNV-EIPENSPVGTHVVQLHASDRDAGSNAEVVYRL 306          
BLAST of Protocadherin-9 vs. Ensembl Sea Lamprey
Match: si:ch211-199f5.1 (protocadherin 8 [Source:HGNC Symbol;Acc:HGNC:8660])

HSP 1 Score: 177.178 bits (448), Expect = 1.662e-45
Identity = 178/697 (25.54%), Postives = 303/697 (43.47%), Query Frame = 1
Query:  532 ISIQMHEEIPPNSEIGSILSAIPHNLR---STSLEFITESDFFIVTEE---GKILVRKLIDLETLCSQYKLCCGEPVCILKANILLNNKEKEVVSSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNSFILDISQLPS----IFLKVSKKLDFEEKKQYHAKLKACDEDN---CTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPIN-PKQSLCSVTILVEDVNDHKPEIRIIADLSS----LKIQEEIP-SKLITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDK--SAVLKYQI---DNYGAE---YFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFS-----TNLPQFSIIENTGPSQLVGQINATDADQDENALISFSL-----RNSWNGNTM--QRHDNYFNVLPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHP-DNNILNI 2502
            +   ++EE P  + +G +   +   +    S     +   DF +V  E   G +  R++ID E  C Q       P C+++ ++L     + +   V  +V++LD NDH P F   E  + ISE   +G  + L  A D D      ++ Y LDE    F L +           L V  +LD E++ +Y  +L A D  +     T  + I + D NDN P+F   + N+T++ED   G+++  + A D D G  G + YS  +  D +++  F ++  +G++ LK +L     S Y   I ARD  P + P    C V + VED+ND+ PEI++   + S    + + E       +  + + D D   NG+V CHL       F+L    +D Y + +    D E       ++   D G P   + +   + + D N+  P F  +S Y    + EN+  G  V TV A D D   + ++ Y +   +  GA    Y  I+ +SG I     L D E ++S++F V   D    P   +  V + ++D NDN+P+ +            +  + G   LV  + A D+D + N  +S+ +     RN +  N +  +   N  +V       T           + L +M  D   SP +  T+ + I +    + D+    T P D ++L +
Sbjct:   31 VKYALYEEQPAGTLVGRLSDDLQGRVAEHPSRHFRLMRRDDFSLVHVEEADGTVSAREVIDREQQCGQ------APSCVIRFDVLCT-LPRGLFQLVHAEVELLDINDHAPDFARSEMHVEISESVALGTRVPLEGARDLDVGGNA-LRAYHLDE-NERFGLALRARTDGAKYAELVVKSRLDREQEGEYTLQLTAWDGGDPPRSGTTLVRITVLDSNDNSPVFAQTSCNVTVREDATPGTVLLTLNATDVDEGPNGEVVYSFSSPVDAEVRRLFQLDPKTGKLSLKGQLDHELNSEYEISIQARDMGPSSIPAH--CKVLVHVEDINDNAPEIKLDFIMQSRGDTVFVSEGAAYESFVGLVTVSDIDSAENGLVACHLR--GHPHFKLLP-YRDDYVVVTNSSLDREQMADYFLVLEASDGGTPPRVAARQFTVRLLDENDNEPRFH-RSTY-EASLLENNSPGAYVTTVTAWDADAEHNGMIAYNVVESEVAGASVSTYVSINPSSGAIYALRPL-DYEAMTSLTFQVQARDDGVPPLVTNATVSVRIVDENDNAPVVTHPPLRNGTGVVRLPRDAGLGYLVTVVRARDSDSEANGELSYRIVQGNERNLFRINRLGGEVFTNAASVTDAAASAT----------RHSLVVMVRDRG-SPALSATAAIEIRVGAHGDGDDGADETQPLDASMLAV 699          

HSP 2 Score: 137.117 bits (344), Expect = 5.696e-33
Identity = 146/584 (25.00%), Postives = 260/584 (44.52%), Query Frame = 1
Query: 1126 IHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGR---IKLKKKLSTFTRSRYPFRIVARDS-DPINPKQSLCSVTILVEDVNDHKPEIRIIADLS-SLKIQEEI-PSKLITTLQIVDQDKGPNG-IVYCHLDPV---CEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFK----DKSQYLLGHVWENSEFGTKVMTVKAQDQDKSAVLKYQIDNYGAEYFEI-DQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNS-WNGNTMQRHDNYFNVLP-TGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITDTMR-PGDHLLQ-----LQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQMLHSGTVILLFRASDYGQPAKYSDHKLVINIFGDESGN 2808
            + + D ND+ P F     ++ I E V +G+ +    A D D G  G    +   D +          T   +   + +K +L       Y  ++ A D  DP     +L  +T+L  D ND+ P   + A  S ++ ++E+  P  ++ TL   D D+GPNG +VY    PV       F+L  ++  + SL+   + DHE+  + +  +  +D G  S+ +   + + + D+N+  P  K     +S+     V E + + + V  V   D D +          G  +F++       +  TN+ +DRE+++     +   D  T P+ A+ +  + +LD NDN P F  +  + S++EN  P   V  + A DAD + N +I++++  S   G ++     Y ++ P +G I  L  LD E       ++ A D       PL +   +++R++DEND +P  THP   + N T  +R P D  L      ++A D D  ANG++ + I++    E      N+   + F   +S      S   HS  ++++ R  D G PA  +   + I +     G+
Sbjct:  124 VELLDINDHAPDFARSEMHVEISESVALGTRVPLEGARDLDVG--GNALRAYHLDENERFGLALRARTDGAKYAELVVKSRLDREQEGEYTLQLTAWDGGDPPRSGTTLVRITVL--DSNDNSP---VFAQTSCNVTVREDATPGTVLLTLNATDVDEGPNGEVVYSFSSPVDAEVRRLFQLDPKTGKL-SLKG--QLDHELNSEYEISIQARDMGPSSIPAHCKVLVHVEDINDNAPEIKLDFIMQSRGDTVFVSEGAAYESFVGLVTVSDIDSAENGLVACHLRGHPHFKLLPYRDDYVVVTNSSLDREQMADYFLVLEASDGGTPPRVAARQFTVRLLDENDNEPRFHRSTYEASLLENNSPGAYVTTVTAWDADAEHNGMIAYNVVESEVAGASVS---TYVSINPSSGAIYALRPLDYEAMTSLTFQVQARDDGVP---PLVTNATVSVRIVDENDNAPVVTHPP--LRNGTGVVRLPRDAGLGYLVTVVRARDSDSEANGELSYRIVQG--NERNLFRINRLGGEVFTNAASVTDAAASATRHS--LVVMVR--DRGSPALSATAAIEIRVGAHGDGD 683          
BLAST of Protocadherin-9 vs. Ensembl Nematostella
Match: EDO46189 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQM0])

HSP 1 Score: 234.572 bits (597), Expect = 2.060e-62
Identity = 210/721 (29.13%), Postives = 331/721 (45.91%), Query Frame = 1
Query:  637 ESDFFIVTEEGKILVRKLIDLETLCSQYKLCCGEPVCILKANILLNNKEKEVVSSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQ-NYKLDEPTNSFILDISQLPSIFLKVSKKLDFEEKKQYHAKLKACDEDN---CTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSD-PINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIP-----SKLITTLQIVDQDKGPNG-IVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKSAV--LKYQIDNYGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQMLHSGTV---ILLFRASDYGQP 2751
            ++ +F V  +G I  +   D ET  S Y++        L+A    +           ++++ILD ND+ P+F + +    + E   IG ++   +A+DKD+ +   ++ ++      ++F LD     +  + VS+ LDFE++  Y   L   D  +     T +L+I++ D NDN P+F    Y   +KE+   G+   QV A DRDS   G + + I    D  +   F ++  +G I + K      ++RY   + ARD   P+  K     VTI +EDVNDH P        S     ++IP        + T+   D D GP G + Y  +    +G+F +   S    S+R   + D E        V  +D G  S  S   + I + D+N+  P F+    Y+   V E+S  G ++  V A D D S+   ++Y + +   + F I+ ++GLI     L D E+ +    TV   D  T  +++   VK+ V D NDN P F+ +L   ++ EN      V  + ATDAD   N  IS+S+  S N N     D +     TG I T + LDRE    Y L I A D +    +   +   + + + DEND  PT+T P     NI++    G  + QL ATDRD+G NG V + II          S NQG+S  F ++  +G L +   L   T+    L+ +ASD G P
Sbjct:  211 DTSYFTVDSQGVIRTKGAFDRETKAS-YQVA-------LRAQ---DGGSPSRSGQATVEIEILDVNDNRPVFSSAQYTASVDEDVAIGAAMVTVTASDKDNGNNADLRYSFTSGNTNHAFTLD---AVTGVVTVSRSLDFEQRSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPPVFSPSAYQSRVKENTPAGT---QVSATDRDSSTNGALVFGIIKGNDDGV---FTIDGSTGIISIAKSPDYENKTRYDLTVQARDRGVPV--KYDTAQVTIFIEDVNDHSPV------FSPSNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYRLISGNVKGAFNIDANSG---SIRVSSELDRETTPSYSLQVEARDGGSTSRSSSTRVTIALQDINDNSPIFQ--GPYVF-RVSESSSPGHQIGQVAATDADDSSNGDVRYALSD-NTDVFSINTSTGLITLKTQL-DYEKKTQYMVTVTAKDGGTPSRSSLTVVKVMVDDVNDNPPQFAKSLYTCTVGENLAAGVAVCYVTATDADSGANGKISYSIL-SGNENMAFAMDRF-----TGEITTRVPLDRETIASYSLTINADDGS---LVRFMAATTVNISIADENDNQPTFTGPSR--FNISEDSPTGTRVGQLTATDRDIGPNGAVTYAII----------SGNQGNS--FQLDPRSGILSVRSTLDRETIPSYTLVVKASDAGSP 872          

HSP 2 Score: 197.208 bits (500), Expect = 9.251e-51
Identity = 200/719 (27.82%), Postives = 322/719 (44.78%), Query Frame = 1
Query:  667 GKILVRKLIDLETLCSQYKLCCGEPVCILKANILLNNKEKEVV---SSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKL--DEPTNSFILDISQLPSIFLKVSKKLDFEEKKQYHAKLKACDEDN---CTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIPSKLITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKS--AVLKYQIDNYGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNV-LPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQMLHSGTV---ILLFRASDYGQPAKYSDHKLVI 2781
            G+I  R  +D ET+ S Y L              +N  +  +V   ++  + + I D+ND+ P F  P ++  ISE S  G  +   +ATD+D      +  Y +      NSF LD     S  L V   LD E    Y   +KA D  +     T ++ + + D NDN P FE   ++  I+ED  + S + QVK  D+D G  G I  S+  +        F +++ +G +  K  L   T + Y   + ARD    + K +   V I + +VND+ P     A ++S+     I + ++  L   D D  P  + +  ++     SF++ ++S  + S+   ++ D E       +V   + G           I + D+N+  P F   S     H  EN   G  V  V A D+D+   A + Y++       FE++  +GL+  T   +DRE  +S S  V  MD     ++A   + +T+ D NDNSP FS +    ++ ENT     + ++ A+D D   N  +++S+    +GN    H N F +   TG I  +  +DRE    Y L I A DS   P +  T+ V IT  V DEND SP +   + +   I + +  G  +  + ATDRD G+N +V + I++             G +  F +N+  G L + + ++  TV    L  RASD G P   SD +L +
Sbjct:  740 GEITTRVPLDRETIAS-YSLT-------------INADDGSLVRFMAATTVNISIADENDNQPTFTGP-SRFNISEDSPTGTRVGQLTATDRDIGPNGAVT-YAIISGNQGNSFQLDPR---SGILSVRSTLDRETIPSYTLVVKASDAGSPQQSITASIHVSVLDVNDNAPRFEKSLFSGEIREDASVHSTVLQVKVEDKDEGSNGAITLSLSGEG----SDNFTIDS-TGFVLSKTPLDYETTAAYQLTVTARDGGSPS-KSATAQVKITIINVNDNVPSFVSPAQVTSIPEDVAINTHVVK-LNATDSDGTP--LTFDIVEGNAGSSFKI-DQSSGLISV--AKRLDRETTANYTLVVRATETGSQGESVYNNATIRVLDVNDNAPVFNPGSYAKSLH--ENLPIGQTVAKVTATDRDEGENAKVTYELSVGDTSKFEVNPATGLV-TTKRPLDREDQASYSLRVTAMDHGKPSQSAVAAITLTINDLNDNSPQFSQSKYTLTVTENTANGSNILRVLASDPDAGANGRVTYSI---ISGN----HGNAFRIDSTTGRITVVGVVDREALASYNLTISAKDSGVPPWVS-TAFVAIT--VADENDNSPIFASNETS-YGIDEGVSIGSRVAVVTATDRDEGSNAQVFYSIVR-------------GDTSAFAINAMNGVLTVKKEINRETVPTYTLTIRASDRGSPMMTSDKELTV 1400          

HSP 3 Score: 186.808 bits (473), Expect = 1.372e-47
Identity = 193/683 (28.26%), Postives = 308/683 (45.10%), Query Frame = 1
Query:  808 IQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKL--DEPTNSFILDISQLPSIFLKVSKKLDFEEKKQYHAKLKACDEDN---CTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSI-RTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQ-SLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIPSKLITTLQIVDQDKGPNGIV-YCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKSAVLKYQI-DNYGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGD----HLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQML---HSGTVILLFRASDYGQPAKYSDHKLVINIFGDESGN 2808
            I + I D ND++P F   +  + ++E +  G +I    A+D D  +  R+  Y +      N+F +D +   +  + V   +D E    Y+  + A D       +T  + I + DENDN PIF +   +  I E V IGS +  V A DRD G    + YSI R D      S F +  ++G + +KK+++  T   Y   I  R SD  +P   S   +T++V DVND+ P     + + S++ +    S  + T+   D D G N ++ Y  +    E  F++ + S  I +       D E + +    V   D       ++  + I + +LN+  P F    Q     V ENS   T V+ V A D+D    L Y I     ++ F IDQ SG+I  T +++DRE VS  +  V V D+   P +    V I +LD NDNSP F ++    SI+EN+ PS    ++ ATDAD+  NA I+++L          R+D +     +G I     LDRE    Y L I A D    PQ    S + I + V+D ND  P       N  ++  ++R       H++++ A+D D G N ++ F ++    K              F ++++TG +     L         L    +D G P+  S   ++I++  DE  N
Sbjct: 1189 ITLTINDLNDNSPQFSQSKYTLTVTENTANGSNILRVLASDPDAGANGRVT-YSIISGNHGNAFRIDST---TGRITVVGVVDREALASYNLTISAKDSGVPPWVSTAFVAITVADENDNSPIFASNETSYGIDEGVSIGSRVAVVTATDRDEGSNAQVFYSIVRGD-----TSAFAINAMNGVLTVKKEINRETVPTYTLTI--RASDRGSPMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVR-ENSAQSTSVLTVAADDSDVGANAVLRYSIISGNDEKRFKINSTSGVIMT---TTPLDFEEKSQYGLEVTATDS---KYTAKTNVTIRVINLNDITPAFT--QQNYTASVRENSPTSTSVVKVSASDRDSFGSLSYSIVGGKDSDKFSIDQRSGII-STADVLDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKFDSSSYSSSILENSAPSSFSFKLAATDADEGTNARITYNL---------SRNDAFMIGASSGVITLAQPLDRENKSTYDLAIQARDHGTPPQ---ASSITIRVTVIDINDHRPLI-----NSSSLRGSVRENQPKETHVMRILASDADTGLNAELTFSLLSNEHK------------SVFTLDNTTGDISTKVPLDREQQAVYTLRIGVADKGNPSLSSVADVIIDVI-DEDDN 1820          

HSP 4 Score: 169.088 bits (427), Expect = 3.481e-42
Identity = 174/649 (26.81%), Postives = 303/649 (46.69%), Query Frame = 1
Query:  646 FFIVTEEGKILVRKLIDLETLCSQYKLCCGEPVCILKANILLNNKEKEV---VSSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNSFILDISQLPSIFLKVSKKLDFEEKKQYHAKLKACDEDN---CTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIPSKLITTLQIVDQDKGPNG-IVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENS---EFGTKVMTVKAQDQDKSAVLKYQIDNYGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNV-LPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQLQATDRD 2559
            F I +  G+I V  ++D E L S               N+ ++ K+  V   VS+  + + + D+ND++PIF + ET   I E   IG  +++ +ATD+D  S  ++    +   T++F   I+ +  + L V K+++ E    Y   ++A D  +    + + L + + D NDN P+F +++Y  +++E+    + +  V A+D D G    ++YSI +  D   +  F + + SG I     L    +S+Y   + A DS       +  +VTI V ++ND  P         +  ++E  P+   + +++   D+   G + Y  +       F +  RS  I S   V   D E+       V   D G P L +   + I I D N+  P F   S      + ENS    F  K+    A D+  +A + Y +    A  F I  +SG+I     L DRE  S+    +   D  T P+ +S+ +++TV+D ND+ PL +++  + S+ EN      V +I A+DAD   NA ++FSL +         H + F +   TG I T + LDRE   +Y L I  +D        L+S+ ++ + V+DE+D  P +   + N+  I++++  G  ++Q+ A D D
Sbjct: 1251 FRIDSTTGRITVVGVVDREALASY--------------NLTISAKDSGVPPWVSTAFVAITVADENDNSPIFASNETSYGIDEGVSIGSRVAVVTATDRDEGSNAQVFYSIVRGDTSAFA--INAMNGV-LTVKKEINRETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSIISGND---EKRFKINSTSGVIMTTTPLDFEEKSQYGLEVTATDS----KYTAKTNVTIRVINLNDITPAF--TQQNYTASVRENSPTS-TSVVKVSASDRDSFGSLSYSIVGGKDSDKFSIDQRSG-IISTADV--LDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKFDSSSYSS--SILENSAPSSFSFKLAATDA-DEGTNARITYNLSRNDA--FMIGASSGVITLAQPL-DRENKSTYDLAIQARDHGTPPQASSITIRVTVIDINDHRPLINSSSLRGSVRENQPKETHVMRILASDADTGLNAELTFSLLS-------NEHKSVFTLDNTTGDISTKVPLDREQQAVYTLRIGVADKGNPS---LSSVADVIIDVIDEDDNCPRFQPTEYNV-TISESLPRGASIVQVTARDID 1852          

HSP 5 Score: 150.214 bits (378), Expect = 2.128e-36
Identity = 170/658 (25.84%), Postives = 281/658 (42.71%), Query Frame = 1
Query:  808 IQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNSFILDISQLPSIFLKVSKKLDFEEKKQYHAKLKACDEDNCTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARD-SDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIPSKLITTLQIVDQDKGPNG-IVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKSAVLKYQIDNYGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNV-LPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQML---HSGTVILLFRASDYGQPAKYS 2763
            + + + D+ND+ P F        I E +     +++ +ATD+D  +   I  Y L    N F+++ S+   I  +    LD E K  Y  ++ A D  + T   LI  + D NDN P F    Y   + EDV +GSI+ Q+ A D D G+   + YS+ +       ++++     G I+ K      T++ Y   + A+D   P    Q+   + IL  DVND++P        +S+     I + ++ T+   D+D G N  + Y         +F L   +  +   RS    D E        +   D+G P L     + I + D+N+  P F   S Y    V EN+  GT+V           A++   I       F ID ++G+I    +  D E  +    TV   D     K  + +V I + D ND+SP+FS +     I E+T     V  + ATD D      + + L    +GN        FN+   +G I    +LDRE    Y L++ A D   + +   +S   +T+ + D ND SP +  P   +  ++++  PG  + Q+ ATD D  +NG VR+ +                ++  F +N+STG + +   L        ++   A D G P++ S
Sbjct:   56 VVIDVKDENDNAPEFPLNSYVFNIRENTPAA-QVAIVTATDRDSGTNAAIT-YSLFSGENKFMMN-SKTGEI--RTVTPLDHETKDSYTMRISAFDGKHTTFVPLIT-VDDVNDNAPFFALSVYKTGVYEDVAVGSIVRQLTAVDLDVGINARLSYSLVSG-----DTSYFTVDSQGVIRTKGAFDRETKASYQVALRAQDGGSPSRSGQATVEIEIL--DVNDNRPVFSSAQYTASVDEDVAIGAAMV-TVTASDKDNGNNADLRYSFTSGNTNHAFTLDAVTGVVTVSRS---LDFEQRSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPPVFS-PSAY-QSRVKENTPAGTQVSATDRDSSTNGALVFGIIKGNDDGVFTIDGSTGIISIAKSP-DYENKTRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVFSPSNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYRL---ISGNVK----GAFNIDANSGSIRVSSELDRETTPSYSLQVEARDGGSTSR---SSSTRVTIALQDINDNSPIFQGP--YVFRVSESSSPGHQIGQVAATDADDSSNGDVRYAL--------------SDNTDVFSINTSTGLITLKTQLDYEKKTQYMVTVTAKDGGTPSRSS 667          

HSP 6 Score: 127.102 bits (318), Expect = 2.986e-29
Identity = 144/534 (26.97%), Postives = 227/534 (42.51%), Query Frame = 1
Query:  640 SDFFIVTEEGKILVRKLIDLETLCSQYKLCC-----GEPVCILKANILLNNKEKEVVSSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNSFILDISQLPSIFLKVSKKLDFEEKKQYHAKLKACDEDNCTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQS-LCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIPSKLITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKS--AVLKYQI-DNYGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDAD 2214
            S F I    G + V+K I+ ET+ + Y L       G P+               + S  E+ V + D ND+ P+F +      + E S    S+ LT A D        +  Y +    +     I+    + +  +  LDFEEK QY  ++ A D       N+ I + + ND  P F  + Y  +++E+    + + +V A+DRDS  FG++ YSI    D+D    F ++  SG I     L     S Y  ++  R +D  NP  S L  VTI + D ND+ P+    +  SS+ ++   PS     L   D D+G N  +  +L         +   S  + +L   +  D E +   D  +  +D G P   S   I + + D+N+ RP     S  L G V EN    T VM + A D D    A L + +  N     F +D  +G I  T   +DRE+ +  +  + V D      ++  +V I V+D +DN P F       +I E+      + Q+ A D D
Sbjct: 1353 SAFAINAMNGVLTVKKEINRETVPT-YTLTIRASDRGSPM---------------MTSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSV-LTVAADDSDVGANAVLRYSIISGNDEKRFKINSTSGVIMTTTP-LDFEEKSQYGLEVTATDSKYTAKTNVTIRVINLNDITPAFTQQNYTASVRENSPTSTSVVKVSASDRDS--FGSLSYSIVGGKDSD---KFSIDQRSGIISTADVLDRELVSLYAIQV--RVTDAGNPPLSNLTWVTIKILDENDNSPKFDSSSYSSSI-LENSAPSSFSFKLAATDADEGTNARITYNL---SRNDAFMIGASSGVITL--AQPLDRENKSTYDLAIQARDHGTPPQASSITIRVTVIDINDHRPLINSSS--LRGSVRENQPKETHVMRILASDADTGLNAELTFSLLSNEHKSVFTLDNTTGDI-STKVPLDREQQAVYTLRIGVADKGNPSLSSVADVIIDVIDEDDNCPRFQPTEYNVTISESLPRGASIVQVTARDID 1852          

HSP 7 Score: 89.3521 bits (220), Expect = 9.626e-18
Identity = 85/287 (29.62%), Postives = 118/287 (41.11%), Query Frame = 1
Query: 1954 FEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITDT-----MRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQMLHSGTVI---LLFRASDYGQPAKYSDHKLVINIF 2790
            F ID ++G I  T    DRE  S    TV   D+          V I V D NDN+P F  N   F+I ENT P+  V  + ATD D   NA I++SL +  N   M           TG I T+  LD E  D Y + I A D   +  +PL       + V D ND +P +       L++  T     +  G  + QL A D DVG N ++ + ++              G + YF V+S  G +         T     +  RA D G P++     + I I 
Sbjct:   12 FTIDSSTGSITTTGRKFDRESESRYRLTVLAQDAANRCHKGRTVVVIDVKDENDNAPEFPLNSYVFNIRENT-PAAQVAIVTATDRDSGTNAAITYSLFSGENKFMMNSK--------TGEIRTVTPLDHETKDSYTMRISAFDGKHTTFVPL-------ITVDDVNDNAPFFA------LSVYKTGVYEDVAVGSIVRQLTAVDLDVGINARLSYSLV-------------SGDTSYFTVDSQ-GVIRTKGAFDRETKASYQVALRAQDGGSPSRSGQATVEIEIL 262          
BLAST of Protocadherin-9 vs. Ensembl Nematostella
Match: EDO35412 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLK9])

HSP 1 Score: 207.608 bits (527), Expect = 4.613e-54
Identity = 200/687 (29.11%), Postives = 335/687 (48.76%), Query Frame = 1
Query:  802 VEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKL--DEPTNSFILDISQLP--SIFLKVSKK-LDFEEKKQYHAKLKACDEDNCTTQN---LIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQST--FYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRII------ADLSSLKIQEEIPSKLITTLQIVDQDKGPNGIVYCHL-DPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKS--AVLKYQI---DNYGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGAL-WISQMLHSGTVI--LLFRASDYGQPAKYSDHKLVINI 2787
            + +QVQ+ D ND+ P F T    + I E   +  +  + +ATD D  +   + +Y +   + T +F L  +  P  S    ++KK LD E    Y   + A D           + I I DEND+ P+F   +Y  +I E+ + G  I +V A DRDSG  G IKY+I  D+D  IQS   F +++ +G I+ K+ L    ++ Y F ++A D   +  K  L +VTI V D ND+ P+++I        D  +++ +  + +  I  + + D+D   N      + +   EG F+++      Y ++  +  D E+    +  +   D+G PS  +   + I +TD+N+  P F   S     ++ E ++ G+ V+ + A D D+     + Y I   ++ G  +F++D  SGL+  T   +DRE+VSS++ T+   D  + PKT S  V +T++D NDN P F  +  + +I E       V Q++ATD D  +N  I++ + +S      Q +  +     TG + T  +LDRE   LY   ++A D    PQ  L S V + L + D ND +P + +P     +I +   PG  LLQ+ ATD D G N  + ++II       G+++ N      F ++SSTG +  ++ + H       L+  A D G   KY+    V+N+
Sbjct:   79 ISVQVQVDDINDNEPRFPTLYYTLRIRESMDVNTTNPINTATDPDAGNNGTV-DYTIASGDNTATFSLGTTACPTGSTLCVITKKPLDRETTDFYQLNITATDRGTPALMGYCLINITILDENDHAPVFTQNSYLGSIAENTKPGVSILRVSAADRDSGSNGDIKYAI--DWDA-IQSNSIFDLDSSTGVIRTKQNLDFEVKNSYTFNVIASDGG-VPSKNDLATVTINVLDTNDNSPQLKITYLPPHNGD-KAIRSENSLINTNIAYILVTDKDSNTNSQTELKITNGDDEGCFKVEFLG--FYFIQLQKPLDRELVPFYNLTLNVTDKGVPSRSTLGFVLIDVTDVNDNSPAFT--SNAYTANISELAQNGSYVLQLNATDPDEGDNGTVSYSITGGNDLG--WFQVDFQSGLV-TTAKPLDREQVSSVTITITAQDHGSAPKTGSTTVTVTIIDGNDNKPRFMKSSYKGTISEGASIGATVLQVSATDVDSGDNGRITYEISSS----DAQVNGLFELNTQTGVLWTKSQLDRETKSLYSFTVLAKDHGD-PQ--LMSSVKVELTISDINDNAPVF-YPVEYFASIMENEPPG-KLLQVTATDADEGTNAVISYDIIG------GNNNGN------FSIDSSTGVISTLASLDHEVEEFFSLIISAKDGGN--KYAAKTAVVNV 729          

HSP 2 Score: 178.718 bits (452), Expect = 4.108e-45
Identity = 184/685 (26.86%), Postives = 306/685 (44.67%), Query Frame = 1
Query:  760 NILLNNKEKEVVSSVEIQ---VQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNSFILDISQLPSIFLKVSKKLDFEEKKQYHAKLKACDEDNC---TTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARD-SDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIPSKLITTLQIVDQDKGPNGIV-YCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKSAVLKYQI-DNYGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQI----NATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLPTGHIETLLKLDREICD----LYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQML---HSGTVILLFRASDYGQPA 2754
            N+ LN  +K V S   +    + + D ND++P F +      ISE +Q G  +   +ATD D      + +Y +    +     +    S  +  +K LD E+       + A D  +     +  + + I D NDN+P F   +Y  TI E   IG+ + QV A D DSG  G I Y I +  D  +   F + T +G +  K +L   T+S Y F ++A+D  DP     S   V + + D+ND+ P    +   +S+ ++ E P KL+  +   D D+G N ++ Y  +     G+F + + +  I +L S+   DHEVE+    I+  KD G        ++ + + +  +  P F  +       V+EN   GT V  V A  +DK+  + Y I        F +D   G+I+  N  +DRE  +     V       +P +A   V I VLD NDN+P FST+    S+I +   + LVGQ+     A D D  +N L+ + L ++  G           +L       ++KL R++ D     Y ++++ASDS   PQ   T  ++ITL +    +  P +T   + + ++  +         + A D+D G NG++ + I              QG+ +        G L+I + L     G+  L+ RA+D G P+
Sbjct:  392 NLTLNVTDKGVPSRSTLGFVLIDVTDVNDNSPAFTSNAYTANISELAQNGSYVLQLNATDPDEGDNGTV-SYSITGGNDLGWFQV-DFQSGLVTTAKPLDREQVSSVTITITAQDHGSAPKTGSTTVTVTIIDGNDNKPRFMKSSYKGTISEGASIGATVLQVSATDVDSGDNGRITYEISSS-DAQVNGLFELNTQTGVLWTKSQLDRETKSLYSFTVLAKDHGDP--QLMSSVKVELTISDINDNAPVFYPVEYFASI-MENEPPGKLLQ-VTATDADEGTNAVISYDIIGGNNNGNFSIDSSTGVISTLASL---DHEVEEFFSLIISAKDGGNKYAAKTAVVNVTVLNKADNLPVFLYEMYNFT--VYENVPKGTLVGRVYATTKDKNGSISYAIVSGDPTNLFLVDSTGGIIKI-NGDMDREEKAQYLLAVIARVGTVKPLSAQATVNIEVLDRNDNAPQFSTS----SVIVDIDGTWLVGQVVYNAAAVDLDAGKNGLVRYQLTSNAEG-----------LLWINSTSGVIKLARKLTDGDETQYTVQVLASDSGSPPQHS-TMTIHITLSI----NHPPKFTL-SSYVTHVLASQPLSYQFFYVVAVDQDSGKNGQLFYSI-------------PQGNEEGLFGIFPGGKLYIRKSLLQALKGSYDLIVRATDGGVPS 1029          

HSP 3 Score: 157.918 bits (398), Expect = 9.576e-39
Identity = 192/737 (26.05%), Postives = 326/737 (44.23%), Query Frame = 1
Query:  646 FFIVTEEGKILVRKLIDLETLCSQYKLCCGEPVCILKANILLNNKEKEVVSSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNSFILDISQLPSIFLKVSKKLDFEEKKQYHAKLKACDEDN---CTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIR---IIADLSSLKIQEEIPSKLITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQD--KSAVLKYQIDNYGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNV-LPTGHIETLLKLDRE------ICDLYIL--EIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQMLHSGTVI---LLFRASDYGQPAKYSDHKLVINIFGD 2796
            F + T+ G +  +  +D ET  S Y              +  ++ + +++SSV++++ I D ND+ P+F   E    I E    G  + +T ATD D  +   I +Y +    N+    I     +   ++  LD E ++ +   + A D  N     T  + + + ++ DN P+F  E YN T+ E+V  G+++G+V A  +D    G+I Y+I +   T++   F V++  G IK+   +    +++Y   ++AR    + P  +  +V I V D ND+ P+     +I D+    +  ++    +     VD D G NG+V   L    EG   + + S  I   +  RK     E +    V+  D G P   S   I I ++ +N   P F   S Y+  HV  +     +   V A DQD  K+  L Y I     E        G +    +L+   +  S    V   D      +ASV V I + D+ND+  LF  N  +F++ EN+ P  LVG + A   D      I +SL +S         +++F V + +G I T ++LDRE        ++YI+  E M +D+       +     + + V D ND +P ++     I  +++   PG  + +++A D D G N K  + ++              G  ++FI NSSTG L +S+ L   T     L+ +A+D      YS  K+ I + GD
Sbjct:  580 FELNTQTGVLWTKSQLDRET-KSLYSFTV----------LAKDHGDPQLMSSVKVELTISDINDNAPVFYPVEYFASIMENEPPGKLLQVT-ATDADEGTNAVI-SYDIIGGNNNGNFSIDSSTGVISTLAS-LDHEVEEFFSLIISAKDGGNKYAAKTAVVNVTVLNKADNLPVFLYEMYNFTVYENVPKGTLVGRVYATTKDKN--GSISYAIVSGDPTNL---FLVDSTGGIIKINGDMDREEKAQYLLAVIAR-VGTVKPLSAQATVNIEVLDRNDNAPQFSTSSVIVDIDGTWLVGQV----VYNAAAVDLDAGKNGLVRYQLTSNAEGLLWINSTSGVI---KLARKLTDGDETQYTVQVLASDSGSPPQHSTMTIHITLS-INH-PPKFT-LSSYVT-HVLASQPLSYQFFYVVAVDQDSGKNGQLFYSIPQGNEEGLFGIFPGGKLYIRKSLLQALK-GSYDLIVRATDGGVPSFSASVPVTIYIQDSNDHRSLFVNNTFRFAVAENSSPGTLVGTLVAHALDHSRTKDIVYSLISS---------ESHFAVDVRSGQITTRVRLDREELIKNTGSNVYIMQAEAMYNDTTIKRDKAI-----VIVTVTDLNDNAPVFSRAVYAI-TVSELSLPGSPVFRIKAMDADEGDNAKFFYSLVS-----------GTGMDKFFI-NSSTGELHLSKTLDRETTSSYNLVVKATDASNANLYSTAKIEITV-GD 1256          

HSP 4 Score: 148.673 bits (374), Expect = 5.989e-36
Identity = 170/665 (25.56%), Postives = 284/665 (42.71%), Query Frame = 1
Query:  514 LALSDKISIQMHEEIPPNSEIGSILSAIPHNLRSTSLEFI---TESDFFIVTEEGKILVRKLIDLETLCSQYKLCCGEPVCILKANILLNNKEKEVVSSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPT--NSFILDISQLPSIFLKVSKKLDFEEKKQYHAKLKACDEDNC---TTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIPSKL-ITTLQIVDQDKGPNG-IVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEV----EQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKSAVLK--YQIDNYGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVL-PTGHIETLLKLDRE-ICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDEN 2454
            L +++     + E   P + +G++++    + R+  + +    +ES F +    G+I  R  +D E L        G  V I++A  + N+   +   ++ I V + D ND+ P+F      I +SE S  G  +    A D D     +   Y L   T  + F ++ S      L +SK LD E    Y+  +KA D  N    +T  + I + D ND +P+F    Y + I ED  IGS++  + A+D+D G  G IKYSI    + ++ + F VE+ +GR+ + K L   T   Y   I A+D   I P  S  +VT+ V DVND+ P         +L ++E + +   +      D+D G N  I +         +F + + + +I ++ ++   D E           +V+  DQG P L +RK I + +TD N+  P F        G           VMT+ A+D D+++  K  Y I +    YF +  ++G ++  + + D   +  +  T+   D     +     V +         P FS+   Q S+ EN      V  + A       N  I + L       T       F V+  TG ++T   +DRE +   + L + A D  K      TS   +T+ V D N
Sbjct: 1049 LFVNNTFRFAVAENSSPGTLVGTLVAHALDHSRTKDIVYSLISSESHFAVDVRSGQITTRVRLDREELIKN----TGSNVYIMQAEAMYNDTTIKRDKAIVI-VTVTDLNDNAPVFSRAVYAITVSELSLPGSPVFRIKAMDADEGDNAKFF-YSLVSGTGMDKFFINSSTGE---LHLSKTLDRETTSSYNLVVKATDASNANLYSTAKIEITVGDSNDQRPVFPESDYTVNITEDALIGSLVINLNASDKDIGQNGLIKYSIS---NGNLAAMFDVESATGRLIVAKSLDFETTQLYELTITAQDHGLI-PLSSTVNVTVNVLDVNDNAPLFP--TQPVTLTVRENVNTGFPVGRCTASDRDTGTNAHIAFSMYSQTPSKTFSVNSATCEITTIAAI---DLETMPAGRDSFQLVVMATDQGSPKLSTRKSITVQVTDENDNSPGFVSPPAAAAGSSL-------NVMTITAEDPDRNSNGKVTYSIISGNNGYFNLHPSTGQLQMIHQIPDNPTIYQL--TIQASDGGQPSRQTQTVVSVFKEGPIGGGPTFSSADYQGSVTENKVAGTSVVTVLAAYPQSSLNGNIEYYL-------TSDSSKGGFEVVKSTGVVKTTRGIDREGMGASFNLVVYAVD--KQGPSARTSSATVTITVQDVN 1677          

HSP 5 Score: 147.902 bits (372), Expect = 1.171e-35
Identity = 162/618 (26.21%), Postives = 280/618 (45.31%), Query Frame = 1
Query: 1012 LPSIFLKVSKKLDFEEKKQYHAKLKACDEDN---CTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKL------STFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQE-EIPSKLITTLQIVDQDKGPNG-IVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQD--KSAVLKYQIDNYG-AEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLPTGHIETLLKLDREIC----DLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHL--LQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQMLH----SGTVI-LLFRASDYGQPAKYSDHKLVINIF 2790
             P   L + K L    K  Y   ++A D        +  + I+I+D ND++ +F   T+   + E+   G+++G + A+  D      I YS+ +      +S F V+  SG+I  + +L           + Y  +  A  +D    K+    V + V D+ND+ P       + ++ + E  +P   +  ++ +D D+G N    Y  +       F + + + +   L   +  D E     + +V   D    +L S   I I + D N+ RP F + S Y + ++ E++  G+ V+ + A D+D  ++ ++KY I N   A  F+++  +G +    +L D E       T+   D    P +++V V + VLD NDN+PLF T     ++ EN      VG+  A+D D   NA I+FS+ +     T   +        T  I T+  +D E      D + L +MA+D   SP+  L++  +IT++V DEND SP +  P             G  L  + + A D D  +NGKV + II              G++ YF ++ STG L   QM+H    + T+  L  +ASD GQP++ +  + V+++F
Sbjct:  997 FPGGKLYIRKSLLQALKGSYDLIVRATDGGVPSFSASVPVTIYIQDSNDHRSLFVNNTFRFAVAENSSPGTLVGTLVAHALDHSRTKDIVYSLISS-----ESHFAVDVRSGQITTRVRLDREELIKNTGSNVYIMQAEAMYND-TTIKRDKAIVIVTVTDLNDNAPVFS--RAVYAITVSELSLPGSPVFRIKAMDADEGDNAKFFYSLVSGTGMDKFFINSSTGE---LHLSKTLDRETTSSYNLVVKATDASNANLYSTAKIEITVGDSNDQRPVFPE-SDYTV-NITEDALIGSLVINLNASDKDIGQNGLIKYSISNGNLAAMFDVESATGRLIVAKSL-DFETTQLYELTITAQDHGLIPLSSTVNVTVNVLDVNDNAPLFPTQPVTLTVRENVNTGFPVGRCTASDRDTGTNAHIAFSMYSQTPSKTFSVNS------ATCEITTIAAIDLETMPAGRDSFQLVVMATDQG-SPK--LSTRKSITVQVTDENDNSPGFVSP--------PAAAAGSSLNVMTITAEDPDRNSNGKVTYSIIS-------------GNNGYFNLHPSTGQL---QMIHQIPDNPTIYQLTIQASDGGQPSRQT--QTVVSVF 1565          

HSP 6 Score: 113.62 bits (283), Expect = 2.959e-25
Identity = 122/410 (29.76%), Postives = 180/410 (43.90%), Query Frame = 1
Query: 1420 INPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIPSKLITTLQIV-DQDKGPNGIV-YCHLDPVCEGSFELQNRSKDIYSLRSV---RKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKSAV--LKYQIDNYGAE---YFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSP-LFSTNLPQFSI-----IENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLPTG--HIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITL-RVLDENDESPTWTHPDNNILNITDTMRPGDHLLQLQATDRDVGANGKVRFEI 2592
            +NP     SV + V+D+ND++P    +    +L+I+E +       +    D D G NG V Y         +F L   +    S   V   +  D E        +   D+G P+L    +I I I D N+  P F   S   LG + EN++ G  ++ V A D+D  +   +KY ID    +    F++D ++G+IR   NL D E  +S +F V   D     K     V I VLD NDNSP L  T LP  +       EN+  +  +  I  TD D + N+     + N          +  F V   G   I+    LDRE+   Y L +  +D      +P  S +   L  V D ND SP +T  +    NI++  + G ++LQL ATD D G NG V + I
Sbjct:   72 LNPSNQPISVQVQVDDINDNEPRFPTL--YYTLRIRESMDVNTTNPINTATDPDAGNNGTVDYTIASGDNTATFSLGTTACPTGSTLCVITKKPLDRETTDFYQLNITATDRGTPALMGYCLINITILDENDHAPVFTQNS--YLGSIAENTKPGVSILRVSAADRDSGSNGDIKYAIDWDAIQSNSIFDLDSSTGVIRTKQNL-DFEVKNSYTFNVIASDGGVPSKNDLATVTINVLDTNDNSPQLKITYLPPHNGDKAIRSENSLINTNIAYILVTDKDSNTNSQTELKITNG-------DDEGCFKVEFLGFYFIQLQKPLDRELVPFYNLTLNVTDKG----VPSRSTLGFVLIDVTDVNDNSPAFTS-NAYTANISELAQNGSYVLQLNATDPDEGDNGTVSYSI 464          
BLAST of Protocadherin-9 vs. Ensembl Nematostella
Match: EDO48237 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKF4])

HSP 1 Score: 193.356 bits (490), Expect = 1.662e-49
Identity = 168/592 (28.38%), Postives = 281/592 (47.47%), Query Frame = 1
Query:  844 PIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTN---SFILDISQLPSIFLKVSKKLDFEEKKQYHAKLKACDEDNCTTQ---NLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARD-SDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIP-SKLITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKSAVLKYQIDNYGAEY-FEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQLQATDRDVGANGKVRFEI 2592
            P F   +    +SE +++G  ++  SA+D D  S   I+ Y +    N   +    I Q+  + +   + LD E   ++  ++KA D    + +   +L I++ D NDN PIFE   Y   I ED  IG  +  V+A+D DSG  G +KY I  + D D  S F +  +SG + + KKL       Y  ++ A+D  +P  P+ +  +V I + DVND  P+      + S  I+E++P ++L+TT++  D D+G NG V+  +    + +F   NR      +R  +K D+E+    + +V  +D+G+P L ++  + I + D+N+  P F   S +    + EN   G +   V+A D+D     +        +  F I++N+G I     L DRE+V   +F +   D     K  + ++ IT+LD NDN P FS      SI EN+     V Q+ A D D     ++ +S+ +S        HD  F + P G I     L+     +Y+  + ASD        L+S   + + V D N  +P +     +   + +    G  +L + ATDRD G+N K+ + I
Sbjct:   18 PQFSRLQEDASVSEDAEVGTVVATVSASDPDSGSNGMIR-YSMSPSQNLMSATYFSIDQITGV-ITTKRGLDREFLDRHFFRVKAEDGGEPSLEGYMDLTINVLDVNDNGPIFERNIYAADIPEDKSIGDFVLAVRASDADSGSNGEVKYCI-LNSDGD-NSAFSIGEVSGAVTVMKKLDREKVPTYTLQVQAQDQGNP--PRSATVTVKITLLDVNDCTPQFS--KKVYSATIREDVPVNQLVTTVRATDCDQGSNGEVFFEIVSGNDMNFFSINRING--EVRVKQKLDYEMIGVFNLLVTAQDKGQPFLYNQTTVDIALIDVNDNAPQF--VSSHFQTMIPENYAVGQEFYRVQAYDKDHGTNGEITFSFMQNDLPFSINENTGGISIKEEL-DREKVPKFTFGIKARDKGVPFKEGTAQITITLLDINDNPPKFSQEEYHTSIAENSRWGTSVLQVKAIDPDSGPTNVV-YSIVSS------SGHDRCFRINPQGLITLSCTLNYNTKHVYVFSVSASDGM------LSSTALVYVNVTDSNTHAPEFKRRSYSA-EVKEDASLGTSVLTVLATDRDTGSNAKISYSI 582          

HSP 2 Score: 160.229 bits (404), Expect = 2.426e-39
Identity = 171/630 (27.14%), Postives = 289/630 (45.87%), Query Frame = 1
Query:  802 VEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNSFILDISQLPSIFLKVSKKLDFEEKKQYHAKLKACDEDN---CTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARD-SDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIPSKLITTLQIVDQDKGPNG-IVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDK--SAVLKYQIDNYGAEY-FEIDQNSGLI--RCTNNLIDRE-RVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFI 2658
            +++ + +LD ND+ PIFE       I E   IG  +    A+D D  S   ++   L+   ++    I ++ S  + V KKLD E+   Y  +++A D+ N     T  + I + D ND  P F  + Y+ TI+EDV +  ++  V+A D D G  G + + I +  D +    F +  ++G +++K+KL       +   + A+D   P    Q+  +V I + DVND+ P+  + +   ++  +     +    +Q  D+D G NG I +  +    +  F +   +  I S++   + D E   K    +  +D+G P  E    I I + D+N+  P F  +  +    + ENS +GT V+ VKA D D   + V+   + + G +  F I+   GLI   CT N   +   V S+S +  ++ S     TA V V +T  D+N ++P F        + E+      V  + ATD D   NA IS+S+       ++           TG I+T   LDRE  D Y  E+ A+D    PQ+   S V I   + D ND  P +  P      + + +RPG  ++++ A+D D+G N ++ +         DG  +F   S+Q  I
Sbjct:  112 MDLTINVLDVNDNGPIFERNIYAADIPEDKSIGDFVLAVRASDADSGSNGEVKYCILNSDGDNSAFSIGEV-SGAVTVMKKLDREKVPTYTLQVQAQDQGNPPRSATVTVKITLLDVNDCTPQFSKKVYSATIREDVPVNQLVTTVRATDCDQGSNGEVFFEIVSGNDMNF---FSINRINGEVRVKQKLDYEMIGVFNLLVTAQDKGQPFLYNQT--TVDIALIDVNDNAPQF-VSSHFQTMIPENYAVGQEFYRVQAYDKDHGTNGEITFSFMQN--DLPFSINENTGGI-SIK--EELDREKVPKFTFGIKARDKGVPFKEGTAQITITLLDINDNPPKFSQEEYHT--SIAENSRWGTSVLQVKAIDPDSGPTNVVYSIVSSSGHDRCFRINPQ-GLITLSCTLNYNTKHVYVFSVSASDGMLSS-----TALVYVNVT--DSNTHAPEFKRRSYSAEVKEDASLGTSVLTVLATDRDTGSNAKISYSIATLVPEFSVDE--------TTGVIKTAGSLDREKVDTYRFEVTATDHG-IPQLKAKSFVYI--HIADVNDNDPVFLKPSYEA-KVREDIRPGGRVIEVSASDADIGKNAQIIYSFASN---GDGQGTFTIDSTQGII 704          

HSP 3 Score: 144.821 bits (364), Expect = 1.127e-34
Identity = 159/637 (24.96%), Postives = 284/637 (44.58%), Query Frame = 1
Query:  796 SSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNSFILDISQLPSIFLKVSKKLDFEEKKQYHAKLKACDED-----NCTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIPSKLITTLQIVDQDKGPNGIVYCHLDPVC-EGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQD--KSAVLKYQIDNYGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGAL 2682
            ++V +++ +LD ND  P F        I E   +   ++   ATD D  S   +  +++    +     I+++    ++V +KLD+E    ++  + A D+      N TT +  I + D NDN P F +  +   I E+  +G    +V+A D+D G  G I +S       D+   F +   +G I +K++L      ++ F I ARD   +  K+    +TI + D+ND+ P+       +S+       + ++  ++ +D D GP  +VY  +     +  F +    + + +L     ++ +        V      +  L S  ++ + +TD N   P FK +S      V E++  GT V+TV A D+D   +A + Y I     E F +D+ +G+I+   +L DRE+V +  F V   D       A   V I + D NDN P+F     +  + E+  P   V +++A+DAD  +NA I +S  ++ +G      D+       G I TL  LDRE    Y L ++A+D    P     + V + + + D  D  P +  P   +    DT  P   ++ ++A  +D+     + + I++              S Q F +N +TGA+
Sbjct:  216 ATVTVKITLLDVNDCTPQFSKKVYSATIREDVPVNQLVTTVRATDCDQGSNGEV-FFEIVSGNDMNFFSINRINGE-VRVKQKLDYEMIGVFNLLVTAQDKGQPFLYNQTTVD--IALIDVNDNAPQFVSSHFQTMIPENYAVGQEFYRVQAYDKDHGTNGEITFSF---MQNDLP--FSINENTGGISIKEELDREKVPKFTFGIKARDKG-VPFKEGTAQITITLLDINDNPPKFSQEEYHTSIAENSRWGTSVLQ-VKAIDPDSGPTNVVYSIVSSSGHDRCFRIN--PQGLITLSCTLNYNTK-----HVYVFSVSASDGMLSSTALVYVNVTDSNTHAPEFKRRS--YSAEVKEDASLGTSVLTVLATDRDTGSNAKISYSIATLVPE-FSVDETTGVIKTAGSL-DREKVDTYRFEVTATDHGIPQLKAKSFVYIHIADVNDNDPVFLKPSYEAKVREDIRPGGRVIEVSASDADIGKNAQIIYSFASNGDGQGTFTIDS-----TQGIIRTLKPLDRETIPEYELTVVATDQGTPPG---QASVKVKVILEDVKDSPPLFEKPLYEVTVPEDT-PPRSPVITVKAKSQDLSPETGMMYSIVR------------GNSPQVFDINPNTGAI 809          

HSP 4 Score: 125.946 bits (315), Expect = 6.255e-29
Identity = 125/455 (27.47%), Postives = 205/455 (45.05%), Query Frame = 1
Query: 1474 DHKPEIRIIADLSSLKIQEEIPSKLITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNRSKDIY--------SLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKS--AVLKYQIDNYGAE--YFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNV-LPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQMLHSGTV---ILLFRASDYGQPAKYSDHKLVINIF 2790
            ++ P+   + + +S+    E+ + ++ T+   D D G NG++   + P        QN     Y         + + R  D E   +    V  +D GEPSLE    + I + D+N+  P F +++ Y    + E+   G  V+ V+A D D      +KY I N   +   F I + SG +     L DRE+V + +  V   D    P++A+V VKIT+LD ND +P FS  +   +I E+   +QLV  + ATD DQ  N  + F +    +GN M    N+F++    G +    KLD E+  ++ L + A D  + P +   + V+I L  +D ND +P +       + I +    G    ++QA D+D G NG++ F             SF Q     F +N +TG + I + L    V       +A D G P K    ++ I + 
Sbjct:   15 NNPPQFSRLQEDASVSEDAEVGT-VVATVSASDPDSGSNGMIRYSMSPS-------QNLMSATYFSIDQITGVITTKRGLDREFLDRHFFRVKAEDGGEPSLEGYMDLTINVLDVNDNGPIF-ERNIYA-ADIPEDKSIGDFVLAVRASDADSGSNGEVKYCILNSDGDNSAFSIGEVSGAVTVMKKL-DREKVPTYTLQVQAQDQGNPPRSATVTVKITLLDVNDCTPQFSKKVYSATIREDVPVNQLVTTVRATDCDQGSNGEVFFEIV---SGNDM----NFFSINRINGEVRVKQKLDYEMIGVFNLLVTAQDKGQ-PFLYNQTTVDIAL--IDVNDNAPQFVSSHFQTM-IPENYAVGQEFYRVQAYDKDHGTNGEITF-------------SFMQNDLP-FSINENTGGISIKEELDREKVPKFTFGIKARDKGVPFKEGTAQITITLL 433          

HSP 5 Score: 125.946 bits (315), Expect = 6.864e-29
Identity = 131/486 (26.95%), Postives = 212/486 (43.62%), Query Frame = 1
Query: 1147 DNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIP-SKLITTLQIVDQDKGPNGIV-YCHLDPVCEGS-FELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKSA---VLKYQIDNYGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLP------TGHIETLLKLDREICDLYILEIMASDSAKSPQIPLT-SIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQLQATDRDVG 2565
            +N P F     + ++ ED ++G+++  V A+D DSG  G I+YS+    +    + F ++ ++G I  K+ L      R+ FR+ A D    + +  +  +TI V DVND+ P      ++ +  I E+      +  ++  D D G NG V YC L+   + S F +   S    ++  ++K D E        V  +DQG P   +   + I + D+N+  P F  K       + E+      V TV+A D D+ +   V    +      +F I++ +G +R    L D E +   +  V   D           V I ++D NDN+P F ++  Q  I EN    Q   ++ A D D   N  I+FS         MQ      N LP      TG I    +LDRE    +   I A D      +P       IT+ +LD ND  P ++  + +  +I +  R G  +LQ++A D D G
Sbjct:   15 NNPPQFSRLQEDASVSEDAEVGTVVATVSASDPDSGSNGMIRYSMSPSQNLMSATYFSIDQITGVITTKRGLDREFLDRHFFRVKAEDGGEPSLEGYM-DLTINVLDVNDNGPIFE--RNIYAADIPEDKSIGDFVLAVRASDADSGSNGEVKYCILNSDGDNSAFSIGEVSG---AVTVMKKLDREKVPTYTLQVQAQDQGNPPRSATVTVKITLLDVNDCTPQFSKK--VYSATIREDVPVNQLVTTVRATDCDQGSNGEVFFEIVSGNDMNFFSINRINGEVRVKQKL-DYEMIGVFNLLVTAQDKGQPFLYNQTTVDIALIDVNDNAPQFVSSHFQTMIPENYAVGQEFYRVQAYDKDHGTNGEITFSF--------MQ------NDLPFSINENTGGISIKEELDREKVPKFTFGIKARDKG----VPFKEGTAQITITLLDINDNPPKFSQEEYHT-SIAENSRWGTSVLQVKAIDPDSG 472          

HSP 6 Score: 114.775 bits (286), Expect = 1.865e-25
Identity = 127/488 (26.02%), Postives = 213/488 (43.65%), Query Frame = 1
Query:  796 SSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNSFILDISQL---------PSIFLKVSKKLDFEEKKQYHAKLKACDEDNCTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEI-PSKLITTLQIVDQDKGPNG-IVYCHL-DPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQD---KSAVLKYQIDNYGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDAD 2214
             + +I + +LD ND+ P F   E    I+E S+ G S+    A D D              PTN     +S           P   + +S  L++  K  Y   + A D    +T  + +++ D N + P F+  +Y+  +KED  +G+ +  V A DRD+G    I YSI T     +   F V+  +G IK    L       Y F + A D   I   ++   V I + DVND+ P    +      K++E+I P   +  +   D D G N  I+Y    +   +G+F + +    I   R+++  D E   + +  V+  DQG P  ++   + +I+ D+ +  P F +K  Y +  V E++   + V+TVKA+ QD   ++ ++   +     + F+I+ N+G I+    L D E  S    TV    S   P      V + + D NDN+P+        ++ E   P +   +I A D D
Sbjct:  424 GTAQITITLLDINDNPPKFSQEEYHTSIAENSRWGTSVLQVKAIDPDSG------------PTNVVYSIVSSSGHDRCFRINPQGLITLSCTLNYNTKHVYVFSVSASDGMLSSTALVYVNVTDSNTHAPEFKRRSYSAEVKEDASLGTSVLTVLATDRDTGSNAKISYSIAT-----LVPEFSVDETTGVIKTAGSLDREKVDTYRFEVTATDHG-IPQLKAKSFVYIHIADVNDNDPV--FLKPSYEAKVREDIRPGGRVIEVSASDADIGKNAQIIYSFASNGDGQGTFTIDSTQGII---RTLKPLDRETIPEYELTVVATDQGTPPGQASVKVKVILEDVKDSPPLF-EKPLYEV-TVPEDTPPRSPVITVKAKSQDLSPETGMMYSIVRGNSPQVFDINPNTGAIQTLMKL-DYETQSEYRLTVRATLS---PFFTETTVMVYLKDINDNTPVLEAFHMNINVQEGKVPPEARYKIPAYDPD 882          

HSP 7 Score: 94.7449 bits (234), Expect = 2.050e-19
Identity = 102/421 (24.23%), Postives = 186/421 (44.18%), Query Frame = 1
Query:  796 SSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNSFILDISQLPSIFLKVSKKLDFEEKKQYHAKLKACDED--NCTTQNLI-IHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIPSKL-ITTLQIVDQDKGP-NGIVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKSAVLKYQI-DNYGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTV 2040
            S+  + V + D N H P F+       + E + +G S+    ATD+D  S  +I +Y +      F +D +   +  +K +  LD E+   Y  ++ A D        ++ + IHI D NDN P+F   +Y   ++ED++ G  + +V A+D D G    I YS  ++ D   Q TF +++  G I+  K L   T   Y   +VA D     P Q+   V +++EDV D  P       L  + + E+ P +  + T++   QD  P  G++Y  +       F++   +  I +L    K D+E + +    V  +    P      ++ + + D+N+  P    ++ ++  +V E          + A D D S  L +++ +    E+  ++  SG +     LI   + ++I   V
Sbjct:  525 STALVYVNVTDSNTHAPEFKRRSYSAEVKEDASLGTSVLTVLATDRDTGSNAKI-SYSIATLVPEFSVDET---TGVIKTAGSLDREKVDTYRFEVTATDHGIPQLKAKSFVYIHIADVNDNDPVFLKPSYEAKVREDIRPGGRVIEVSASDADIGKNAQIIYSFASNGDG--QGTFTIDSTQGIIRTLKPLDRETIPEYELTVVATDQG-TPPGQASVKVKVILEDVKDSPPLFE--KPLYEVTVPEDTPPRSPVITVKAKSQDLSPETGMMYSIVRGNSPQVFDINPNTGAIQTL---MKLDYETQSEYRLTV--RATLSPFFTETTVM-VYLKDINDNTPVL--EAFHMNINVQEGKVPPEARYKIPAYDPDVSDKLTFKVMEGNAKEWVTLNATSGELSVNKKLIQASKPANIKIAV 928          
BLAST of Protocadherin-9 vs. Ensembl Nematostella
Match: EDO41767 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3G3])

HSP 1 Score: 186.037 bits (471), Expect = 3.489e-47
Identity = 195/702 (27.78%), Postives = 315/702 (44.87%), Query Frame = 1
Query:  727 CCGEPVCILKANILLNNKEKEVVSSVEIQVQILDK--NDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNSFILDISQLPSIFLKVSKKLDFEEKKQYHAKLKACDEDNCTTQN------LIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEE-IPSKLITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSL--ESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKSAVLKYQ-IDNYGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLP-TGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNI-LNITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQMLHSG-TVILLFRASDYGQPAKYSDHKLVINI 2787
            C   P   L A  L   +E++  SS++  +    K  N H+P+F + +  I ISE + I   +S   ATD+D      +  Y + E     + +I+      L V+  LD E    Y   + A D   C          L + I D ND  P+F+   Y +T+ E++ +G  +  V A+D+D G  G I Y I  DF       F V  +SG + +   L    +  Y   I A DS   N K     V + + D+ND+ P ++      ++ +QE+ + + ++T++   D D GP G +   L P     F + ++S  I   R  ++ D E +   +  V   D+G P+L  +   ++ ++  + N   P F    + L   + ENS  GT V++ KA DQD S  LKY  ID  G + F ID ++G IR    L D E       TV   D ++ P   ++ V I ++D ND +P F+ +     + EN      V Q+ A D D    +L+ +++       T     N F + P +G I TL  LDRE    Y L + ASD   +P  P+++ V  T+++ DEND  P +      + +           L Q+ ATD D+G+N  +R+ I K  R               FI++S +G ++ +  L  G +  L   A D G P   +   ++I++
Sbjct:  646 CVDSP---LYAKALKIKQEQKSYSSLQPLIFATAKLHNRHHPVFRSHDQNIHISESTPIATVVSQFMATDEDKGYNGLVL-YSIVEGDVDSVFNINMFTG-ELTVAMPLDRETISSYTLNISAVD---CGKHRKSAYTILNVKITDVNDCSPVFDKTVYEVTLPENITVGQTVTHVHASDKDQGTNGFITYQIVNDFG----GKFRVNRISGVVSVGDYLDYEEQEMYKIEIQAMDSSVDNQKVGSTHVIVTLLDINDNSPIVK--PKKFNVTVQEDLLVNAVVTSIHASDPDSGPGGEIEFSL-PESTRKFNIDSKSGVI---RLRQRLDFEQKSTYNLTVRVTDKGSPALFTDVEVVVNVLDVNENSLAPVFS-GGRILETSINENSPVGTVVISPKATDQD-SWYLKYAIIDGTGVDKFIIDPDTGAIRTAGEL-DHEVADHYWLTVQAKDGESYPLYTNIPVLINIVDLNDEAPYFAPSTYYPVLAENLPSGSSVVQVTAKDPDSG-GSLLRYTI-------TKGNEQNNFVIDPQSGLITTLRPLDREFKSEYKLTVSASDGG-TP--PVSTDVTFTVKITDENDNQPEFKEKQYVVGVFARQATSKSFGLYQVVATDEDIGSNADLRYSITKGNRDNK------------FIIDSRSGEIFTNVSLVDGESYDLTIVAEDNGLPKLSTSTNVLIDV 1303          

HSP 2 Score: 165.622 bits (418), Expect = 5.509e-41
Identity = 177/670 (26.42%), Postives = 298/670 (44.48%), Query Frame = 1
Query:  580 SILSAIPHNLRSTSLEFITESD----FFIVTEEGKILVRKLIDLETLCSQYKLCCGEPVCILKANILLNNKEKEVVSSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNSFILDISQLPSIFLKVSKKLDFEEKKQYHAKLKACD-EDNCTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIP-SKLITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKS--AVLKYQI-DNYGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDEN-ALISFSLRNSWNGNTMQRHDNYFNVLPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQLQATDRD 2559
            + ++A   +L +    FI   D    F I  + G I V   +D E++ S               ++ ++  +    S  ++++ I D ND+ PI         I E + +G ++    ATD D      +      +   +F +D +   +  ++    LD E +  Y+  + A D        N+ IH+ D NDN+P+F   +Y   + ED  +  ++ QVKA+D D G+   + YS+     TD   TF +ET +G I L+K L+   +  Y   +   D     P  S+ +V I V ++ND  PE      +    + E+ P    +  ++ V ++   + I Y  L     G F +  ++  I+     RK D+E  +     V   D G P L S   + I +TD N+  P F +K       V ENS  GT V+ V A D+D    A +KY I +   A+ F+I + +G+I+ + + IDRE V+S    V   D    P+ A   V I V D NDNSP FS+      + E++ P+  V  +   D D   N A   F+L  S + +  + H N       G I  +  +       Y L ++ +D+   PQ   ++ V+IT+++  E+   P   HP    +N+  +   G  + +++ATD+D
Sbjct: 2883 TTITATDEDLNTELYYFILSGDPQARFGIERKTGVIFVHGSLDRESVGSY--------------DLNISASDGLFTSFAQMKIDIEDANDNPPICTQSIYVEHIKENTPLGSTVLTVGATDADVGVNAELTYSVFGQGFGTFAVDKNGKMTNLVE----LDRETRPFYNFMVSAADIGGQACYSNISIHLDDVNDNRPLFSQSSYFTAVYEDAPLKKVLLQVKADDADVGVNRKLTYSLV----TDAGGTFTIETGTGIISLEKPLNRELKENYTLNVEVMDGG-TPPLSSIATVQIKVLNINDVPPEFS--HSIYHGNVSEDAPIGNEVVRVRAVSRESSNDVITYAILRGADSGLFSIDRKNGTIH---VNRKLDYETTKLYTLTVEASDAGPPVLRSTSYVRISVTDSNDNGPEFSEKR--YSAKVDENSALGTFVLQVFATDRDSGTNAQIKYSIAEGNDAKKFKIVEETGVIKVSGD-IDREEVASYRLKVRAQDQGLPPQVADTVVDIEVTDVNDNSPEFSSTNLTTVLSESSLPNAAVIHLRPHDRDALGNGAPYQFTLI-SGDASRFKLHSN-------GLITKIGDVSHSDGQ-YRLRVLVADNGHPPQ---STEVSITVKIA-ESKTHPPNVHPLTVYVNLYGSNLNGGVIGRVKATDKD 3508          

HSP 3 Score: 161.384 bits (407), Expect = 1.159e-39
Identity = 204/764 (26.70%), Postives = 341/764 (44.63%), Query Frame = 1
Query:  556 IPPNSEIGS-ILSAIPHNLRSTSLEFIT----------ESDFFIVTEEGKILVRKLIDLETLCS-QYKLCCGEPVCILKANILLNNKEKEVVSSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQ--YRIQNYKLDEPTNSFILDISQLPSIFLKVSKKLDFEEKKQYHAKLKACDEDNCTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIP-SKLITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKSA-VLKYQIDNYGAE--YFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQLQATDRDVGANGK-VRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQMLHS-GTVILLFRASDYGQPAKYSDHKLVINI 2787
            IP N +IGS +L     +L S S   +T          +  F I    G I  R  +D E   S ++++               +N    + S   ++  +LD ND  P F   E    + E + IG S++  +ATD+D +++  Y I +    +P   F ++  +   IF  V   LD E    Y   + A D    +   + I I+D NDN PI     Y   IKE+  +GS +  V A D D G+   + YS+   F      TF V+  +G++    +L   TR  Y F + A D   I  +    +++I ++DVND++P     +  ++  + E+ P  K++  ++  D D G N  +   L     G+F ++  +  I SL   +  + E+++     V   D G P L S   + I + ++N+  P F     +  G+V E++  G +V+ V+A  ++ S  V+ Y I   GA+   F ID+ +G I   N  +D E     + TV   D+      ++  V+I+V D+NDN P FS       + EN+     V Q+ ATD D   NA I +S+     GN  ++   +  V  TG I+    +DRE    Y L++ A D    PQ+  T +V+I   V D ND SP ++  +   + ++++  P   ++ L+  DRD   NG   +F +I              G +  F ++S+     I  + HS G   L    +D G P + ++  + + I
Sbjct: 2765 IPENIDIGSKVLRVFAEDLDSGSNGMVTYALVSKDKLVKEKFDIDQHTGWITTRGALDREKQPSFEFQVRA------------TDNGTTRLTSLTTVRAIVLDVNDTPPKFSQSEFMASVKEDALIGQSVTTITATDEDLNTELYYFILS---GDPQARFGIE-RKTGVIF--VHGSLDRESVGSYDLNISASDGLFTSFAQMKIDIEDANDNPPICTQSIYVEHIKENTPLGSTVLTVGATDADVGVNAELTYSV---FGQGF-GTFAVDK-NGKMTNLVELDRETRPFYNFMVSAAD---IGGQACYSNISIHLDDVNDNRPLFSQSSYFTA--VYEDAPLKKVLLQVKADDADVGVNRKLTYSLVTDAGGTFTIETGTG-IISLE--KPLNRELKENYTLNVEVMDGGTPPLSSIATVQIKVLNINDVPPEFSHSIYH--GNVSEDAPIGNEVVRVRAVSRESSNDVITYAILR-GADSGLFSIDRKNGTIHV-NRKLDYETTKLYTLTVEASDAGPPVLRSTSYVRISVTDSNDNGPEFSEKRYSAKVDENSALGTFVLQVFATDRDSGTNAQIKYSI---AEGNDAKK---FKIVEETGVIKVSGDIDREEVASYRLKVRAQDQGLPPQVADT-VVDI--EVTDVNDNSPEFSSTNLTTV-LSESSLPNAAVIHLRPHDRDALGNGAPYQFTLI-------------SGDASRFKLHSNGLITKIGDVSHSDGQYRLRVLVADNGHPPQSTEVSITVKI 3470          

HSP 4 Score: 136.732 bits (343), Expect = 3.783e-32
Identity = 174/718 (24.23%), Postives = 300/718 (41.78%), Query Frame = 1
Query:  796 SSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNSFILDI-SQLPSIFLKVSKKLDFEEKKQYHAKLKACD-----EDNCTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQST-FYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINP--KQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIP-SKLITTLQIVDQD--KGPNGIVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAI-----------VICKDQGEPSLESRKII------------------------------PIIITDL---NEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKS---AVLKYQIDNYGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQML---HSGTVILLFRASDYGQPAKYS 2763
             S  ++V +LD+ND+NP F        +SE + I   +    ATDKD  S   I  Y +         +I S+   I+ K    LD+E ++++   + A D         +T  ++++I D ND+ P F+   Y   + ED+  G+ +  V A D DSG  G ++YS+      +++   F +E  +G I+    L   T       +  R SD   P  +++   V + V+++ND+ P ++      ++ +    P   LITT+  +D D       ++Y         +F L  ++ ++ + RS+R    E    I A            VI K       ++RK+                               P+I       N   P F+   Q +  H+ E++   T V    A D+DK     VL   ++      F I+  +G +     L DRE +SS +  +  +D     K+A   + + + D ND SP+F   + + ++ EN    Q V  ++A+D DQ  N  I++ + N + G    R +    V+  G       LD E  ++Y +EI A DS+   Q   ++ V +TL  LD ND SP    P    + + + +     +  + A+D D G  G++ F + +  RK              F ++S +G + + Q L      T  L  R +D G PA ++
Sbjct:  301 GSYVLRVNVLDENDNNPEFNQSRYITNLSELAPIHTPVLRVLATDKDAGSNGNIM-YVITRGNELGKFEINSKTGQIYTK--GDLDYESRQRFDLTVAALDGVPLQSRKISTVPVVVNILDANDHDPEFKAPEYRKDLYEDLTPGTSVFTVSAEDLDSGGNGKVRYSL-----ANLRPVPFEIEPDTGIIRTTTNLDRDTGLPEFINLQVRASDFGTPLRRETETLVKMRVKEMNDNAPVLKQFK--CNILVDRNAPVGVLITTVTAIDIDISDKDQSLMYKSTFGNTGKAFSLDPKTGELRTARSLRGLQREFTLIIKATDGIQESPDTHPVILKISIVGGRQARKLQNHVSTKCVDSPLYAKALKIKQEQKSYSSLQPLIFATAKLHNRHHPVFRSHDQNI--HISESTPIATVVSQFMATDEDKGYNGLVLYSIVEGDVDSVFNINMFTGELTVAMPL-DRETISSYTLNISAVDCGKHRKSAYTILNVKITDVNDCSPVFDKTVYEVTLPENITVGQTVTHVHASDKDQGTNGFITYQIVNDFGGKF--RVNRISGVVSVGDY-----LDYEEQEMYKIEIQAMDSSVDNQKVGSTHVIVTL--LDINDNSPI-VKPKKFNVTVQEDLLVNAVVTSIHASDPDSGPGGEIEFSLPESTRK--------------FNIDSKSGVIRLRQRLDFEQKSTYNLTVRVTDKGSPALFT 981          

HSP 5 Score: 133.65 bits (335), Expect = 3.368e-31
Identity = 146/514 (28.40%), Postives = 238/514 (46.30%), Query Frame = 1
Query: 1027 LKVSKKLDFEEKKQYHAKLKACDEDNCTTQNLI-----IHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSD--PINPKQSL-CSVTILVEDVNDHKPEIRIIADLSSLKIQEEIPSKLITTLQIVDQDKGPNG------IVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQ-KIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKS--AVLKYQIDNYGAEY--FEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSD--TEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLP-TGHIETLLKLDRE--ICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNIL 2496
            +K SK+L+ E    Y  +L    +D  T + L      I + D NDN+PIF  + Y  TI ED+ + + I +++A D D G  G I YS +     +  ++F +  +SG + + +KLS   R  +   +VARD    P  PK S  C + + V+ VN   PE  +   L +  + E     +  TL I+D+DKG NG      I   +LD    G+F +++   D Y+++ ++  D E+     +  +   D+G P      ++ + + D N+  P F ++S+Y+  ++ E +   T V+ V A D+D      + Y I   G E   FEI+  +G I    +L D E       TV  +D       K ++V V + +LDAND+ P F     +  + E+  P   V  ++A D D   N  + +SL N             F + P TG I T   LDR+  + +   L++ ASD     +    ++V   +RV + ND +P       NIL
Sbjct:   57 IKTSKRLNRESVASY--ELNVVVQDKRTKRTLDRTKVNITVDDSNDNRPIFLKKKYLKTIPEDIPMHTSIARIEAVDADVGPNGLIYYSFK-----EKTTSFAINPISGVVSVAQKLSNSARI-HRLTVVARDRALPPSKPKSSRNCQLIVNVQAVNQFSPEFSVKTQLQN--VSEGTSGIVYATLGIIDKDKGSNGDIDRVEITSGNLD----GAFSIKSSPND-YAVQVIKPLDRELAPFGYNVTLTAYDKGTPVRNGSYVLRVNVLDENDNNPEF-NQSRYIT-NLSELAPIHTPVLRVLATDKDAGSNGNIMYVI-TRGNELGKFEINSKTGQIYTKGDL-DYESRQRFDLTVAALDGVPLQSRKISTVPVVVNILDANDHDPEFKAPEYRKDLYEDLTPGTSVFTVSAEDLDSGGNGKVRYSLAN--------LRPVPFEIEPDTGIIRTTTNLDRDTGLPEFINLQVRASDFGTPLRRETETLVK--MRVKEMNDNAPVLKQFKCNIL 541          

HSP 6 Score: 129.413 bits (324), Expect = 6.354e-30
Identity = 164/629 (26.07%), Postives = 285/629 (45.31%), Query Frame = 1
Query:  622 LEFITESDFFIVTEEGKILVRKLIDLETLCSQYKLCCGEPVCILKANILLNNKEKEVVSSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNSFILDISQLPSIFLKVSKKLDFEEKKQYHAKLKACDE--DN--CTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLK--IQEEIP-SKLITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKSA-VLKYQIDNYGAEY--FEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVG--QINATDADQDENALISFSLRNSWNGNTMQRHDNYFNV-LPTGHIETLLKL-DREICDLYILEIMASDSAKSPQIP-LTSIVNITLRVLDENDES 2463
            +E   +S F I    G++ V   +D ET+ S Y L      C          K ++   ++ + V+I D ND +P+F+    ++ + E   +G +++   A+DKD  +   I    +++    F   ++++  + + V   LD+EE++ Y  +++A D   DN    + ++I+ + D NDN PI + + +N+T++ED+ + +++  + A+D DSG  G I++S+      +    F +++ SG I+L+++L    +S Y   +  R +D  +P        ++     +      + +    L+  I E  P   ++ + +  DQD     + Y  +D      F +     D  ++R+  + DHEV       V  KD     L +   + I I DLN+  P F   + Y +  + EN   G+ V+ V A+D D    +L+Y I   G E   F ID  SGLI  T   +DRE  S    TV   D  T P +  V   + + D NDN P F        +      S+  G  Q+ ATD D   NA + +S+       T    DN F +   +G I T + L D E  DL I+       A+   +P L++  N+ + V+  N  S
Sbjct:  726 VEGDVDSVFNINMFTGELTVAMPLDRETI-SSYTLNISAVDC---------GKHRKSAYTI-LNVKITDVNDCSPVFDKTVYEVTLPENITVGQTVTHVHASDKDQGTNGFITYQIVNDFGGKF--RVNRISGV-VSVGDYLDYEEQEMYKIEIQAMDSSVDNQKVGSTHVIVTLLDINDNSPIVKPKKFNVTVQEDLLVNAVVTSIHASDPDSGPGGEIEFSL-----PESTRKFNIDSKSGVIRLRQRLDFEQKSTY--NLTVRVTDKGSPALFTDVEVVVNVLDVNENSLAPVFSGGRILETSINENSPVGTVVISPKATDQDSWY--LKYAIIDGTGVDKFIID---PDTGAIRTAGELDHEVADHYWLTVQAKDGESYPLYTNIPVLINIVDLNDEAPYFAPSTYYPV--LAENLPSGSSVVQVTAKDPDSGGSLLRYTITK-GNEQNNFVIDPQSGLI-TTLRPLDREFKSEYKLTVSASDGGTPPVSTDVTFTVKITDENDNQPEFKEKQYVVGVFARQATSKSFGLYQVVATDEDIGSNADLRYSI-------TKGNRDNKFIIDSRSGEIFTNVSLVDGESYDLTIV-------AEDNGLPKLSTSTNVLIDVIQGNKPS 1310          

HSP 7 Score: 129.028 bits (323), Expect = 9.609e-30
Identity = 158/674 (23.44%), Postives = 288/674 (42.73%), Query Frame = 1
Query:  793 VSSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQ-------------NYKLDEPTNSFILDISQLPSIFLKVSKKLDFEEKKQYHAKLKACDEDNCTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIP-SKLITTLQIVDQDKGPNGIVYCHLDPVCE--GSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENS--EFGTKVMTVKAQDQDKSAVLKYQI-DNYGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLPTGHIETLLKLDREICDLYILE--IMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQMLHSGTVILLFRASDYGQP 2751
            V+   + VQ++D+ND+ P+F      IV+      G  I    ATD D  S   ++             + K  E      LD  ++P +F  + +  D   + +   K+K  D++                  P+F+  +++  + ED  IGS +  V A   +      I YSI      D  + F ++  +G + L   L   TR++Y  ++V R +D      S  +V + V DVND  P       L++  I E  P    + T++ +D D G N  +   +  V      F++  +S  ++  +S    D+E     + I++  D+G+PSL     + +++ D N+  P F DKS Y    +   S  +F T+++     D+  +  L+Y I    G ++F+ID  SG+I  +  ++  ++       V V DS      ++ +V++ + D ND+SP+FS ++ + S  EN      V  ++ATD D    A +++S+ +S +     R D       +G + + L  DRE     I+   I A+D        +     + + ++DEND  P +    N    I+ ++  G  +L   A+D D  +N  + + I+               +   F +N++TG + +S+     +        D G P
Sbjct: 2016 VAQAAVHVQVIDRNDNQPVFINSPYFIVLQLGVAQGTIIGQAQATDADIGSNANLRYDLIGGDPGYFSISRKTGEVVVRRTLDDVKVPRLFTLMVEATDGLFRTEAVVKIKVVDKET-----------------PVFDQLSFSKVLAEDTPIGSEVTSVTARSPNG---AGILYSIT---GGDPVNQFSIDFKTGVVTLVSSLDYETRTKY--KLVVRATDARTSSHSDVAVDVTVTDVNDVAPAFNRSLYLAT--ISESTPVDTAVVTVKAIDGDSGINKEINYFIQNVSRVGAFFKIDKKSGVVFVAKS---LDYESRVVHEMIIVAADEGKPSLTGETRVRVVLMDANDNAPRF-DKSMYAASILGSASPGQFVTRILATDP-DEGDAKKLRYSITGGQGRQHFQIDSQSGVITLS-RVVGIKQGKVYGLDVEVSDS---VHVSTSKVRVIIGDTNDHSPIFSEDVYKVSFNENYPEGTFVTMVSATDLDSGNYAHLTYSI-DSVDAMRKFRID-----ADSGMLYSRLMFDRENSSQAIMSVPIRATDGGGRFGFCV-----VEVHLIDENDNQPIF-ELKNYDTTISRSVTMGTPVLMTSASDPDASSNAALTYVIV------------GHQTPPVFTINAATGVIQVSREPEVKSYNFFVLVKDGGNP 2629          

HSP 8 Score: 107.842 bits (268), Expect = 2.407e-23
Identity = 136/542 (25.09%), Postives = 235/542 (43.36%), Query Frame = 1
Query: 1027 LKVSKKLDFEEKKQYHAKLKACDED---NCTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEE---IPSKLITTLQIVDQDKGPN--GIVY--CHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKS--AVLKYQIDNYG--AEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVM-----DSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLPTGHIETLLK-LDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQLQATDRDVGANGKVRFEI 2592
            ++    LD E    Y   ++A D+    N     + + + D NDNQP+F    Y + ++  V  G+IIGQ +A D D G    ++Y    D        F +   +G + +++ L      R  F ++   +D +   +++  + ++         E  +   LS  K+  E   I S++ +        + PN  GI+Y     DPV + S + +     + +L  V   D+E   K   +V   D    S  S   + + +TD+N+  P F ++S Y L  + E++   T V+TVKA D D      + Y I N      +F+ID+ SG++    +L    RV      VH M     D      T    V++ ++DANDN+P F  ++   SI+ +  P Q V +I ATD D+ +    +  LR S  G   ++H   F +     + TL + +  +   +Y L++  SDS         S   + + + D ND SP ++  D   ++  +    G  +  + ATD D G    + + I
Sbjct: 1987 IRAGFDLDRESIDAYQVIVQARDDSVPPNVAQAAVHVQVIDRNDNQPVFINSPYFIVLQLGVAQGTIIGQAQATDADIGSNANLRY----DLIGGDPGYFSISRKTGEVVVRRTLDDVKVPRL-FTLMVEATDGLFRTEAVVKIKVV-------DKETPVFDQLSFSKVLAEDTPIGSEVTSVTA-----RSPNGAGILYSITGGDPVNQFSIDFKT---GVVTL--VSSLDYETRTKYKLVVRATD-ARTSSHSDVAVDVTVTDVNDVAPAF-NRSLY-LATISESTPVDTAVVTVKAIDGDSGINKEINYFIQNVSRVGAFFKIDKKSGVVFVAKSLDYESRV------VHEMIIVAADEGKPSLTGETRVRVVLMDANDNAPRFDKSMYAASILGSASPGQFVTRILATDPDEGD----AKKLRYSITGGQGRQH---FQIDSQSGVITLSRVVGIKQGKVYGLDVEVSDSVH------VSTSKVRVIIGDTNDHSPIFSE-DVYKVSFNENYPEGTFVTMVSATDLDSGNYAHLTYSI 2483          

HSP 9 Score: 102.064 bits (253), Expect = 1.202e-21
Identity = 162/654 (24.77%), Postives = 278/654 (42.51%), Query Frame = 1
Query:  808 IQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSA-----TDKDHSSQYRI------QNYKLDEPTNS-------------FILDISQLPSI---------FLKVSKKLDFEEKK-QYHAKLKACD--------------EDNCTTQNLIIHI-KDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIP-SKLITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDK--SAVLKYQIDNYGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNS--PLFSTN-LPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNS-WNGNTMQRHDNYFNVLP-TGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQLQATDRDVGANGKVRFEIIK 2598
            +++++ + ND+ P+ +  +  I++   + +G+ I+  +A     +DKD S  Y+       + + LD  T               F L I     I          LK+S     + +K Q H   K  D              +   + Q LI    K  N + P+F +   N+ I E   I +++ Q  A D D G  G + YSI    + D+ S F +   +G + +   L   T S Y   I A D    + K +   + + + DVND  P       +  + + E I   + +T +   D+D+G NG +   +     G F + NR   + S+     ++ +   KI+   +        + S  +I + + D+N+  P  K K   +   V E+      V ++ A D D      +++ +       F ID  SG+IR    L D E+ S+ + TV V D  +      VEV + VLD N+NS  P+FS   + + SI EN+    +V    ATD D       S+ L+ +  +G  + +    F + P TG I T  +LD E+ D Y L + A D       PL + + + + ++D NDE+P +  P      + + +  G  ++Q+ A D D G +  +R+ I K
Sbjct:  519 VKMRVKEMNDNAPVLKQFKCNILVDRNAPVGVLITTVTAIDIDISDKDQSLMYKSTFGNTGKAFSLDPKTGELRTARSLRGLQREFTLIIKATDGIQESPDTHPVILKISIVGGRQARKLQNHVSTKCVDSPLYAKALKIKQEQKSYSSLQPLIFATAKLHNRHHPVFRSHDQNIHISESTPIATVVSQFMATDEDKGYNGLVLYSI---VEGDVDSVFNINMFTGELTVAMPLDRETISSYTLNISAVDCGK-HRKSAYTILNVKITDVNDCSPVFD--KTVYEVTLPENITVGQTVTHVHASDKDQGTNGFITYQIVNDFGGKFRV-NRISGVVSVGDYLDYEEQEMYKIEIQAMDSSVDNQKVGSTHVI-VTLLDINDNSPIVKPKKFNVT--VQEDLLVNAVVTSIHASDPDSGPGGEIEFSLPE-STRKFNIDSKSGVIRLRQRL-DFEQKSTYNLTVRVTDKGSPALFTDVEVVVNVLDVNENSLAPVFSGGRILETSINENSPVGTVVISPKATDQD-------SWYLKYAIIDGTGVDK----FIIDPDTGAIRTAGELDHEVADHYWLTVQAKDGE---SYPLYTNIPVLINIVDLNDEAPYFA-PSTYYPVLAENLPSGSSVVQVTAKDPDSGGS-LLRYTITK 1144          

HSP 10 Score: 100.908 bits (250), Expect = 2.768e-21
Identity = 206/795 (25.91%), Postives = 329/795 (41.38%), Query Frame = 1
Query:  643 DFFIVT--EEGKILV--RKLIDLETL-CSQYKLCCGEPVCILKANILLNNKE-KEVVSSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNSFILD-ISQLPSIFLKVSK-----KLDFEEKKQYHAKLKACDEDNCTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTD----IQST---FYVETLSGRIKLKKKLSTFTRSRYPFRIVARD-SDPINPKQSLCSVTILVEDVNDHKPEI---RIIADLSSLK-IQEEIPSKLITTLQIVDQDKGPNG-IVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKI--IPII--ITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKS--AVLKYQIDNYGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSD-TEPKTASVE--VKITVLDANDNSPLFSTNLPQFS---IIENTGP-SQLVGQINATD---ADQDENALISFSLRNSWNGNTMQRHDNYFNVLP-TGHIETLLKLDREICDLYILEIMASDSAKS-----PQIPLTSIV----------NITLRVLD------------------------------ENDESPTWTHPDNNILNITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQMLHSGTV---ILLFRASDYGQPAK 2757
            DF I++  E+G   V  R++ D   +     K    E V   + N+++ +K  K  +   ++ + + D ND+ PIF   +    I E   +  SI+   A D D      I  Y   E T SF ++ IS + S+  K+S      +L    + +     K     NC    LI++++  N   P F  +T    + E    G +   +   D+D G  G I     T  + D    I+S+   + V+ +     L ++L+ F    Y   + A D   P+     +  V +L  D ND+ PE    R I +LS L  I   +   L T     D+D G NG I+Y        G FE+ +++  IY+       D+E  Q+ D  V   D G P L+SRKI  +P++  I D N+  P F  K+      ++E+   GT V TV A+D D      ++Y + N     FEI+ ++G+IR T NL DR+        + V  SD   P     E  VK+ V + NDN+P+    L QF    +++   P   L+  + A D   +D+D++ +   +  N+            F++ P TG + T   L R +   + L I A+D  +      P I   SIV          +++ + +D                               N   P +   D NI +I+++      + Q  ATD D G NG V + I++     D  S FN        +N  TG L ++  L   T+    L   A D G+  K
Sbjct:   30 DFIIISGNEQGMFSVDSRQVSDFNFMDIKTSKRLNRESVASYELNVVVQDKRTKRTLDRTKVNITVDDSNDNRPIFLKKKYLKTIPEDIPMHTSIARIEAVDADVGPNGLIY-YSFKEKTTSFAINPISGVVSVAQKLSNSARIHRLTVVARDRALPPSKPKSSRNC---QLIVNVQAVNQFSPEFSVKTQLQNVSEGTS-GIVYATLGIIDKDKGSNGDIDRVEITSGNLDGAFSIKSSPNDYAVQVIK---PLDRELAPFG---YNVTLTAYDKGTPVRNGSYVLRVNVL--DENDNNPEFNQSRYITNLSELAPIHTPVLRVLAT-----DKDAGSNGNIMYVITRGNELGKFEINSKTGQIYTKGD---LDYESRQRFDLTVAALD-GVP-LQSRKISTVPVVVNILDANDHDPEF--KAPEYRKDLYEDLTPGTSVFTVSAEDLDSGGNGKVRYSLANLRPVPFEIEPDTGIIRTTTNL-DRDTGLPEFINLQVRASDFGTPLRRETETLVKMRVKEMNDNAPV----LKQFKCNILVDRNAPVGVLITTVTAIDIDISDKDQSLMYKSTFGNTGKA---------FSLDPKTGELRTARSL-RGLQREFTLIIKATDGIQESPDTHPVILKISIVGGRQARKLQNHVSTKCVDSPLYAKALKIKQEQKSYSSLQPLIFATAKLHNRHHPVFRSHDQNI-HISESTPIATVVSQFMATDEDKGYNGLVLYSIVEG----DVDSVFN--------INMFTGELTVAMPLDRETISSYTLNISAVDCGKHRK 771          

HSP 11 Score: 99.3673 bits (246), Expect = 8.779e-21
Identity = 149/593 (25.13%), Postives = 253/593 (42.66%), Query Frame = 1
Query: 1024 FLKVSKKLDFEEKKQYHAKLKACDEDNCTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIPSKLITTLQIVDQDKGPNG-IVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKSAVLKYQI---DNYGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLF---------STNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLP-TGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQ--MLHSGTVILLFRASDYGQPA 2754
            F+ V+  LD EEK  Y  +++A D  N  +  + I+I D NDN P      Y   + E+  +G+++  VK  D D+G+ G ++Y I      +  S F +E+ SGRI   K L   T   +   I A D   I  +++L SV + V+DVNDHKPE       S + +  +  + ++  +   D+D G N  + Y  +      S  +   S  +     +    H+   K+ +     D GEP L+++  + + +  + +     K K +  L    ENS     + TV         +  Y+I    +     F + + SG+I  +    D E V+     +    + T+ + +S  V +T+ D NDN P+F         +   PQ + + +   SQLV    ATD D   + L    +  S          + F++ P TG I T   LD E+   Y  +I  +DS  +P+  L++  ++ + V D ND +P ++    +   +      G  +  + ATD D  AN  + F + +Q              ++ F VN  TG + +S   +L   T  +    SD    A
Sbjct: 1369 FITVAHSLDREEKSFYSLRVEATDGYNTASVPVTINILDVNDNSPQPARREYRAHVAENSDVGTLVTTVK--DPDAGVNGEVEYCIVQTAKAESASLFKIESHSGRILTVKPLDYETMQEHVLTIKASDRG-IPKRETLFSVVVSVDDVNDHKPEFLSPLFESEVDVSAKAGTAILRVIA-TDKDDGTNSKLKYSIVSGNTNKSLSVDQNSGVVKVAGRLSTLVHQYALKVQS----TDGGEPPLKTQVDVKVKVRGIVKNFAFEKPKYEVSL---PENSPPDQAIATVVYN----GILPVYEIVPGRSPCWRDFTVQRQSGVI-ISKKSFDAEEVTHCKLEIRA--NSTDGQHSSTLVIVTIQDKNDNQPIFEHARITGHVTEGSPQGTAVLDHKGSQLVAV--ATDQDISGDKLTYEIVETSAR--------DVFSIHPATGAITTAKVLDYEVTPQYAFKIKVTDSG-NPR--LSAFADVKIHVTDINDIAPVFSASTYH-ATVYLPSYAGTRVTMVTATDGDSAAN--LTFSLARQ-------------DTELFAVNPLTGVVTVSNAALLRRDTYTIKLTVSDGNHTA 1914          

HSP 12 Score: 91.2781 bits (225), Expect = 2.816e-18
Identity = 149/655 (22.75%), Postives = 279/655 (42.60%), Query Frame = 1
Query:  646 FFIVTEEGKILVRKLIDLETLCSQYKLCCGEPVCILKANILLNNKEKEVVSSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKL--DEPTNSFILDISQLPSIFLKVSKKLDFEEKKQYHAKLKACDEDNCTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIPSKLIT--TLQIVDQDKGPNGIVYCHLDPVCEGSFELQNRSKDIYSLRS---VRKFDHEVEQK-IDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKSAV-LKYQI----DNYGAEYFEIDQNSGLIRCTNNL---IDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQLQATDRDV 2562
            F I  + G + V K +D E+      +            +  +  +  +     ++V ++D ND+ P F+       I   +  G  ++   ATD D     +++ Y +   +    F +D SQ  S  + +S+ +  ++ K Y   ++  D  + +T  + + I D ND+ PIF  + Y ++  E+   G+ +  V A D DSG +  + YSI +    D    F ++  SG +  +        S+    +  R +D    +   C V + + D ND++P       +  LK  +   S+ +T  T  ++     P+      L  V  G     +++  ++++ +   V +   E E K  +  V+ KD G P L S   + I + +  + R     KS+Y +  V EN+E G  V  +       + V + Y+I    ++     F +D ++G +R    L   I    V  +   V  ++     + A   V + VLD ND +P F ++    SI EN      V ++ A D D   N +++++L  S +    ++ D   +   TG I T   LDRE    +  ++ A+D+  +    LTS+  +   VLD ND  P ++  +  + ++ +    G  +  + ATD D+
Sbjct: 2285 FKIDKKSGVVFVAKSLDYESRVVHEMII-----------VAADEGKPSLTGETRVRVVLMDANDNAPRFDKSMYAASILGSASPGQFVTRILATDPDEGDAKKLR-YSITGGQGRQHFQID-SQ--SGVITLSRVVGIKQGKVYGLDVEVSDSVHVSTSKVRVIIGDTNDHSPIFSEDVYKVSFNENYPEGTFVTMVSATDLDSGNYAHLTYSIDS---VDAMRKFRIDADSGMLYSRLMFDRENSSQAIMSVPIRATDG-GGRFGFCVVEVHLIDENDNQP-------IFELKNYDTTISRSVTMGTPVLMTSASDPDASSNAALTYVIVG-----HQTPPVFTINAATGVIQVSREPEVKSYNFFVLVKDGGNPLLRSIASVKITVLE-RDARILHFGKSKYDV-TVGENAEMGQIVTGLNLVVPGGNPVDVDYRIIKGNNDNNDRKFGVD-STGRVRVIGRLDYEIRNRYVMIVEANVSAIN-----QIARTVVVVQVLDINDVTPKFVSDPYLASIPENIDIGSKVLRVFAEDLDSGSNGMVTYALV-SKDKLVKEKFDIDQH---TGWITTRGALDREKQPSFEFQVRATDNGTT---RLTSLTTVRAIVLDVNDTPPKFSQSE-FMASVKEDALIGQSVTTITATDEDL 2892          

HSP 13 Score: 90.1225 bits (222), Expect = 5.120e-18
Identity = 137/513 (26.71%), Postives = 216/513 (42.11%), Query Frame = 1
Query: 1342 IKLKKKLSTFTRSRYPFRIVARDSDPINPKQSL--CSVTILVEDVNDHKPEIRIIADLSSLK-IQEEIPSKL-ITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQ--KIDAI-VICKDQGEPSLE---SRKIIPII-ITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKSAVLKYQIDNYGAEYFEIDQNSGLIRCTNNL-------IDRERVS-SISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFS-----TNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNV-LPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPL----TSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQMLHSGTVI-----LLFRASDYGQPAKYSDHKLV 2778
            IK  K+L+  + + Y   +V +D      K++L    V I V+D ND++P   I      LK I E+IP    I  ++ VD D GPNG++Y         SF+ +  S  I  +  V     ++    +I  + V+ +D+  P  +   SR    I+ +  +N+F P F  K+Q  L +V E +  G    T+   D+DK +     ID        +D    +    N+        +DRE      + T+   D  T  +  S  +++ VLD NDN+P F+     TNL + + I        V ++ ATD D   N  I + +     GN + +    F +   TG I T   LD E    + L + A D      +PL     S V + + +LD ND  P +  P+    ++ + + PG  +  + A D D G NGKVR+             S        F +   TG +  +  L   T +     L  RASD+G P +     LV
Sbjct:   57 IKTSKRLNRESVASYELNVVVQDK---RTKRTLDRTKVNITVDDSNDNRP---IFLKKKYLKTIPEDIPMHTSIARIEAVDADVGPNGLIYY--------SFKEKTTSFAINPISGVVSVAQKLSNSARIHRLTVVARDRALPPSKPKSSRNCQLIVNVQAVNQFSPEFSVKTQ--LQNVSEGTS-GIVYATLGIIDKDKGS--NGDIDRVEITSGNLDGAFSIKSSPNDYAVQVIKPLDRELAPFGYNVTLTAYDKGTPVRNGSYVLRVNVLDENDNNPEFNQSRYITNLSELAPIHTP-----VLRVLATDKDAGSNGNIMYVI---TRGNELGK----FEINSKTGQIYTKGDLDYESRQRFDLTVAALDG-----VPLQSRKISTVPVVVNILDANDHDPEFKAPEYR-KDLYEDLTPGTSVFTVSAEDLDSGGNGKVRY-------------SLANLRPVPFEIEPDTGIIRTTTNLDRDTGLPEFINLQVRASDFGTPLRRETETLV 519          
BLAST of Protocadherin-9 vs. Ensembl Nematostella
Match: EDO33359 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSF2])

HSP 1 Score: 181.8 bits (460), Expect = 6.387e-47
Identity = 223/855 (26.08%), Postives = 359/855 (41.99%), Query Frame = 1
Query:  556 IPPNSEIGSIL---------SAIPHNLRSTSLEFITESDFFIVTE-EGKILVRKLIDLETLCSQYKLCC-----GEPVCILKANILLNNKEKEVVSSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQ----YRIQNYKLDEPTNSFILDISQLPSIFLKVSKKLDFEEKKQYHAKLKACDE-----DNCTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSL--CSVTILVEDVNDHK------------PE------------------------IRIIADLSSLKI---------------------------QEEIPSKL-ITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDK-----SAVLKYQI-DNYGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNV-LPTGHIETLLKLDREICDLYILEIMASD------SAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQMLHSGTV---ILLFRASDYGQPAKYSD-----HKLVINI 2787
            IP +  +G  L         +A+   +  + + F TESD+F++    G +   K  D ET    Y         G P+             +  +++  I VQI D ND+ PIF+  E +  +SE + +G  ++   A DKD +S     Y IQN        SF +D S      +   K+ DFE+ ++Y+  +   D       +    N++I + DENDN P F  + Y  T+ E+  +G+++ +V A+D+DSG    +KYSI +  +TD    F +   SG I L K L   T   Y   ++  D   I P +S+    V ++V  VN+H             PE                        I +I D +S K+                            E + S   + TL   D+D+G NG V+ ++           N +  + SL +  + D E   + + +V+ +D G P   +   + + + D N+  P F   + Y    + E +  GT+++ V A D+D      +A ++Y + D   ++ F I+  +G I      +D E  SS SF V   D      T S  V+IT++D NDN P F        ++EN      V Q+ A+D D   N  + FS+     GN+    D  F +   TG + T   LD E    Y L I A+D      ++  P +   S+VNI       ND SP ++    +  +I +    G  +L++ A+D D   NGKV F I++     DG           F+V+ +TG +  ++ L    V    L+ +A+D G P   S      H  V+NI
Sbjct:   12 IPEDFTVGGTLLTVLARDQDAALNARVTYSIVSFSTESDYFVIDNITGVVRSSKEFDYET-QRMYSFSVRAEDRGSPI-------------RSAIAT--IHVQITDTNDNRPIFQPMEYETRVSENTPLGTIVARVKAVDKDSTSNADLIYSIQN---GNNNGSFTIDNSTGE---IMTRKEFDFEKTERYNLTISVSDTGVPALSSLNFANVVIIVVDENDNPPEFAQKRYTATVYENFTVGTVVLRVTAHDKDSGPNAMLKYSIHSG-NTD--DAFVIIADSGDISLDKPLDKETIENYTLVLIVTDM-GIPPLESIKRMVVNVIVSGVNEHAPRFLNEFYNASIPENLPLGTSIVRVRAVEDDVSVGARFIYVIKDAASSKVFLVNQTGDITLARELDYETRRRYEFEMYENVTSGTQVLTLFAHDRDEGINGQVFYYIVTSSVKGVFTTNSTTGVVSLTA--ELDRESVYQYNMLVVAQDGGSPPRTASAHVKVEVLDCNDNPPVFT--TLYYTLQLSEATSIGTRILRVSANDRDDKDEGVNAEIRYFLKDAIVSKKFSINDTTGQI-TIKQAVDYEERSSYSFEVFASDGGEARLTGSSSVRITIIDVNDNRPYFLPTRYYVQLVENVAIGTPVTQVTASDLDSSLNGKVLFSI---LGGNS----DGKFVIDQNTGVVTTNKSLDYEDVTEYTLVIQATDCGDPPLNSSQPGMLHVSVVNI-------NDNSPVFSQKMYS-ASIDENTTVGHVILRVTASDLDSSLNGKVLFSILEG--NSDGK----------FVVDQNTGVVTTNKSLDYEDVTEYTLVIQATDCGDPPLNSSQPGMLHVSVVNI 808          

HSP 2 Score: 126.716 bits (317), Expect = 1.512e-29
Identity = 163/626 (26.04%), Postives = 262/626 (41.85%), Query Frame = 1
Query:  634 TESDFFIVTEEGKILVRKLIDLETLCSQYKLCCGEPVCILKANILLNNKEKEVVSSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNSFILDISQLPSIFLKVSKKLDFEEKKQYHAKLKACDEDNCTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIPSKL--ITTLQIVDQDKGPNG-IVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKSAVLKYQIDNYGAEY---FEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTAS--VEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNV-LPTGHIETLLKLDREICDLYILEIMASD------SAKSPQIPLTSIVNITLRVLDENDESP 2466
            T+  F I+ + G I + K +D ET+   Y L     + +    I       E +  + + V +   N+H P F        I E   +G SI    A + D S   R   Y + +  +S +  ++Q   I L  +++LD+E +++Y                               E E Y     E+V  G+ +  + A+DRD G+ G + Y I T   + ++  F   + +G + L  +L   +  +Y   +VA+D     P+ +   V + V D ND+ P    +     L     I +++  ++     D+D+G N  I Y   D +    F + + +  I   ++V   D+E        V   D GE  L     + I I D+N+ RP F     Y+   + EN   GT V  V A D D S   K      G      F IDQN+G++  TN  +D E V+  +  +   D    P  +S    + ++V++ NDNSP+FS  +   SI ENT    ++ ++ A+D D   N  + FS+     GN+    D  F V   TG + T   LD E    Y L I A+D      ++  P +   S+VNI       ND SP
Sbjct:  260 TDDAFVIIADSGDISLDKPLDKETI-ENYTLV----LIVTDMGI----PPLESIKRMVVNVIVSGVNEHAPRFLNEFYNASIPENLPLGTSIVRVRAVEDDVSVGARFI-YVIKDAASSKVFLVNQTGDITL--ARELDYETRRRY-------------------------------EFEMY-----ENVTSGTQVLTLFAHDRDEGINGQVFYYIVT---SSVKGVFTTNSTTGVVSLTAELDRESVYQYNMLVVAQDGGS-PPRTASAHVKVEVLDCNDNPPVFTTLYYTLQLSEATSIGTRILRVSANDRDDKDEGVNAEIRYFLKDAIVSKKFSINDTTGQITIKQAV---DYEERSSYSFEVFASDGGEARLTGSSSVRITIIDVNDNRPYFLPTRYYV--QLVENVAIGTPVTQVTASDLDSSLNGKVLFSILGGNSDGKFVIDQNTGVV-TTNKSLDYEDVTEYTLVIQATDCGDPPLNSSQPGMLHVSVVNINDNSPVFSQKMYSASIDENTTVGHVILRVTASDLDSSLNGKVLFSI---LEGNS----DGKFVVDQNTGVVTTNKSLDYEDVTEYTLVIQATDCGDPPLNSSQPGMLHVSVVNI-------NDNSP 813          

HSP 3 Score: 112.849 bits (281), Expect = 3.335e-25
Identity = 134/558 (24.01%), Postives = 231/558 (41.40%), Query Frame = 1
Query: 1156 PIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARD-SDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIP-SKLITTLQIVDQDKGPNG-IVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKI--IPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDK--SAVLKYQIDNYGA-EYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEP--KTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQMLHSGTVI---LLFRASDYGQPAKYSDHKLVINIF 2790
            PIF    Y+  I ED  +G  +  V A D+D+ L   + YSI   F T+    F ++ ++G ++  K+    T+  Y F + A D   PI  + ++ ++ + + D ND++P  + +      ++ E  P   ++  ++ VD+D   N  ++Y   +    GSF + N + +I +    ++FD E  ++ +  +   D G P+L S     + II+ D N+  P F  K       V+EN   GT V+ V A D+D   +A+LKY I +    + F I  +SG I     L D+E + + +  + V D    P      + V + V   N+++P F       SI EN      + ++ A + D    A   + ++++ +          F V  TG I    +LD E    Y  E+                 N+T                             G  +L L A DRD G NG+V + I+    K              F  NS+TG + ++  L   +V    +L  A D G P + +   + + + 
Sbjct:    1 PIFNQTLYSAIIPEDFTVGGTLLTVLARDQDAALNARVTYSI-VSFSTE-SDYFVIDNITGVVRSSKEFDYETQRMYSFSVRAEDRGSPI--RSAIATIHVQITDTNDNRPIFQPME--YETRVSENTPLGTIVARVKAVDKDSTSNADLIYSIQNGNNNGSFTIDNSTGEIMTR---KEFDFEKTERYNLTISVSDTGVPALSSLNFANVVIIVVDENDNPPEFAQKR--YTATVYENFTVGTVVLRVTAHDKDSGPNAMLKYSIHSGNTDDAFVIIADSGDISLDKPL-DKETIENYTLVLIVTDMGIPPLESIKRMVVNVIVSGVNEHAPRFLNEFYNASIPENLPLGTSIVRVRAVEDDVSVGARFIYVIKDAASSKV-------FLVNQTGDITLARELDYETRRRYEFEMYE---------------NVT----------------------------SGTQVLTLFAHDRDEGINGQVFYYIVTSSVK------------GVFTTNSTTGVVSLTAELDRESVYQYNMLVVAQDGGSPPRTASAHVKVEVL 484          

HSP 4 Score: 105.916 bits (263), Expect = 4.045e-23
Identity = 99/382 (25.92%), Postives = 180/382 (47.12%), Query Frame = 1
Query: 1027 LKVSKKLDFEEKKQYHAKLKACDEDN---CTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDR---DSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIP-SKLITTLQIVDQDKGPNG-IVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRK--IIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKS---AVLKYQIDNYGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTAS--VEVKITVLDANDNSPL 2127
            + ++ +LD E   QY+  + A D  +     + ++ + + D NDN P+F T  Y L + E   IG+ I +V ANDR   D G+   I+Y ++   D  +   F +   +G+I +K+ +    RS Y F + A D        S  SV I + DVND++P    +     +++ E +     +T +   D D   NG +++  L    +G F +   +  + + +S    D+E   +   ++   D G+P L S +  ++ + + ++N+  P F  K       + EN+  G  ++ V A D D S    VL   ++      F +DQN+G++  TN  +D E V+  +  +   D    P  +S    + ++V++ NDNSP+
Sbjct:  445 VSLTAELDRESVYQYNMLVVAQDGGSPPRTASAHVKVEVLDCNDNPPVFTTLYYTLQLSEATSIGTRILRVSANDRDDKDEGVNAEIRYFLK---DAIVSKKFSINDTTGQITIKQAVDYEERSSYSFEVFASDGGEARLTGS-SSVRITIIDVNDNRP--YFLPTRYYVQLVENVAIGTPVTQVTASDLDSSLNGKVLFSILGGNSDGKFVIDQNTGVVTTNKS---LDYEDVTEYTLVIQATDCGDPPLNSSQPGMLHVSVVNINDNSPVFSQK--MYSASIDENTTVGHVILRVTASDLDSSLNGKVLFSILEGNSDGKFVVDQNTGVV-TTNKSLDYEDVTEYTLVIQATDCGDPPLNSSQPGMLHVSVVNINDNSPV 814          

HSP 5 Score: 72.7886 bits (177), Expect = 7.494e-13
Identity = 71/298 (23.83%), Postives = 138/298 (46.31%), Query Frame = 1
Query:  631 ITESDFFIVTEEGKILVRKLIDLETLCS-QYKLCCGEPVCILKANILLNNKEKEVVSSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNS-FILDISQLPSIFLKVSKKLDFEEKKQYHAKLKACDEDNC------TTQNLIIHIK--DENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSD--PINPKQ-SLCSVTILVEDVNDHKP 1485
            I    F I    G+I +++ +D E   S  +++   +              E  +  S  +++ I+D ND+ P F      + + E   IG  ++  +A+D D S   ++    L   ++  F++D +   +  +  +K LD+E+  +Y   ++A D   C      ++Q  ++H+   + NDN P+F  + Y+ +I E+  +G +I +V A+D DS L G + +SI    + +    F V+  +G +   K L     + Y   I A D    P+N  Q  +  V+++  ++ND+ P
Sbjct:  539 IVSKKFSINDTTGQITIKQAVDYEERSSYSFEVFASD------------GGEARLTGSSSVRITIIDVNDNRPYFLPTRYYVQLVENVAIGTPVTQVTASDLDSSLNGKVLFSILGGNSDGKFVIDQN---TGVVTTNKSLDYEDVTEYTLVIQATD---CGDPPLNSSQPGMLHVSVVNINDNSPVFSQKMYSASIDENTTVGHVILRVTASDLDSSLNGKVLFSI---LEGNSDGKFVVDQNTGVVTTNKSLDYEDVTEYTLVIQATDCGDPPLNSSQPGMLHVSVV--NINDNSP 813          
BLAST of Protocadherin-9 vs. Ensembl Medaka
Match: pcdh1a (protocadherin-1 [Source:NCBI gene;Acc:101157079])

HSP 1 Score: 248.054 bits (632), Expect = 2.912e-67
Identity = 235/799 (29.41%), Postives = 370/799 (46.31%), Query Frame = 1
Query:  532 ISIQMHEEIPPNSEIGSILSAIPHNLRSTSLEFITESDFFIVTEEGK---ILVRKL-IDLETLCSQYKLCCGEPVCILKANI----LLNNKEKEVVSSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNS---FILDIS-----QLPSIFLKVSKKLDFEEKKQYHAKLKACDEDNCT--TQNLI-IHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKP--EIRIIADLSS----LKIQEEIP-SKLITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNR--------SKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKS--AVLKYQI--DNYGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNIL-NITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQML---HSGTVILLFRASDYGQPAKYSDHKLVINIFGDES 2802
            I  ++ EE PPN+ IGS+  A  H L  +   +  E     +  +GK   I   ++ ID ETL     L  G+P C L+  +    LL N    ++   E ++++ D ND+ P F      I + E + +G   S+  ATD+D S +  + +Y L    ++   F L ++     +LP +   V   LD E K  Y   +KA D  N    +Q L+ + + D NDN P FE  +Y   + E+  +G  + QVKA+D D G  G I+YS+    D  +     ++  +G I +K  L     +   F +VARD  P  PK S   VTI V D ND+ P  EIR I  ++       I E++P    +  +Q+ D+D+G N +V C    V  G    Q R        +K  Y L++    D+E  ++    ++  D G P+L S   + + +TD+N+  P F   + + +    EN + G  ++ V A D D    A L Y I  D+Y    FEID N+G ++    L DRE      F V   D  +     +  V I VLD NDN P F  +   FS++EN  P   VG +   D D+ ENA +  S+        +Q          TG I + +  DRE    Y   + A D  + P+   +S V +T+ VLDEND  P  T P N+    ++    P  H+  ++A D D G N  + F I        G + +     Q F ++ S+G + +++ +   H G   L+ R SD G+P +++    +++I+ +E+
Sbjct:   24 ILYRVQEEQPPNTLIGSL--AADHGLPDSGHLYKLEVGAPYLRVDGKTGDIFTTEIPIDRETLRDCRSLVKGKP-CYLEFEVSVTDLLQNPSPRLI---EGRIEVQDINDNTPQFPLSVLTISVPENTIMGALFSIPLATDRD-SERNGVADYALTAGPDAATLFGLQVADDRGGKLPQLI--VLGNLDRELKDSYDLTIKAVDGGNPQRYSQALLRVVVTDANDNSPKFEHPSYEAEVSENSPVGHSVLQVKADDSDMGPNGEIEYSLHQAVDP-VPKLLRIDRTTGIIYVKGPLDREEINSLSFYVVARDKGP-QPKSSKTFVTIEVTDQNDNAPAVEIRGIGLVTHSEGIANISEDMPVGTAVALVQVSDKDEGENAVVTC----VVAGDVPFQLRPASDSTSDNKRKYFLQTTTPLDYERVKEYRVEIVAVDSGNPALSSTNSLKVQVTDVNDNSPVFS-PTIFEVDFAEEN-QPGETILDVTATDADSGTNAELFYNIVGDSYIKGLFEIDPNTGEVKARTPL-DREHKERYEFRVTAADKGSPVHKGTATVVIKVLDCNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVLDMDKGENAHVHLSVEPDGGKFVVQNG--------TGTILSSISFDREKESSYTFRLKAVDGGEPPR---SSYVGVTINVLDENDNDPVVTKPSNSSFRQLSPVASPDSHVDVVEAEDLDSGPNADLVFSIA-------GGNPY-----QLFRISPSSGEITLAKEMTRKHGGLHRLVVRVSDRGKPPRHA--TALVHIYVNET 779          
BLAST of Protocadherin-9 vs. Ensembl Medaka
Match: pcdh1a (protocadherin-1 [Source:NCBI gene;Acc:101157079])

HSP 1 Score: 249.21 bits (635), Expect = 6.874e-67
Identity = 235/799 (29.41%), Postives = 370/799 (46.31%), Query Frame = 1
Query:  532 ISIQMHEEIPPNSEIGSILSAIPHNLRSTSLEFITESDFFIVTEEGK---ILVRKL-IDLETLCSQYKLCCGEPVCILKANI----LLNNKEKEVVSSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNS---FILDIS-----QLPSIFLKVSKKLDFEEKKQYHAKLKACDEDNCT--TQNLI-IHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKP--EIRIIADLSS----LKIQEEIP-SKLITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNR--------SKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKS--AVLKYQI--DNYGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDN-NILNITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQML---HSGTVILLFRASDYGQPAKYSDHKLVINIFGDES 2802
            I  ++ EE PPN+ IGS+  A  H L  +   +  E     +  +GK   I   ++ ID ETL     L  G+P C L+  +    LL N    ++   E ++++ D ND+ P F      I + E + +G   S+  ATD+D S +  + +Y L    ++   F L ++     +LP +   V   LD E K  Y   +KA D  N    +Q L+ + + D NDN P FE  +Y   + E+  +G  + QVKA+D D G  G I+YS+    D  +     ++  +G I +K  L     +   F +VARD  P  PK S   VTI V D ND+ P  EIR I  ++       I E++P    +  +Q+ D+D+G N +V C    V  G    Q R        +K  Y L++    D+E  ++    ++  D G P+L S   + + +TD+N+  P F   + + +    EN + G  ++ V A D D    A L Y I  D+Y    FEID N+G ++    L DRE      F V   D  +     +  V I VLD NDN P F  +   FS++EN  P   VG +   D D+ ENA +  S+        +Q          TG I + +  DRE    Y   + A D  + P+   +S V +T+ VLDEND  P  T P N +   ++    P  H+  ++A D D G N  + F I        G + +     Q F ++ S+G + +++ +   H G   L+ R SD G+P +++    +++I+ +E+
Sbjct:  101 ILYRVQEEQPPNTLIGSL--AADHGLPDSGHLYKLEVGAPYLRVDGKTGDIFTTEIPIDRETLRDCRSLVKGKP-CYLEFEVSVTDLLQNPSPRLI---EGRIEVQDINDNTPQFPLSVLTISVPENTIMGALFSIPLATDRD-SERNGVADYALTAGPDAATLFGLQVADDRGGKLPQLI--VLGNLDRELKDSYDLTIKAVDGGNPQRYSQALLRVVVTDANDNSPKFEHPSYEAEVSENSPVGHSVLQVKADDSDMGPNGEIEYSLHQAVDP-VPKLLRIDRTTGIIYVKGPLDREEINSLSFYVVARDKGP-QPKSSKTFVTIEVTDQNDNAPAVEIRGIGLVTHSEGIANISEDMPVGTAVALVQVSDKDEGENAVVTC----VVAGDVPFQLRPASDSTSDNKRKYFLQTTTPLDYERVKEYRVEIVAVDSGNPALSSTNSLKVQVTDVNDNSPVFS-PTIFEVDFAEEN-QPGETILDVTATDADSGTNAELFYNIVGDSYIKGLFEIDPNTGEVKARTPL-DREHKERYEFRVTAADKGSPVHKGTATVVIKVLDCNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVLDMDKGENAHVHLSVEPDGGKFVVQNG--------TGTILSSISFDREKESSYTFRLKAVDGGEPPR---SSYVGVTINVLDENDNDPVVTKPSNSSFRQLSPVASPDSHVDVVEAEDLDSGPNADLVFSIA-------GGNPY-----QLFRISPSSGEITLAKEMTRKHGGLHRLVVRVSDRGKPPRHA--TALVHIYVNET 856          
BLAST of Protocadherin-9 vs. Ensembl Medaka
Match: pcdh1b (protocadherin-1 [Source:NCBI gene;Acc:101174755])

HSP 1 Score: 242.662 bits (618), Expect = 6.781e-65
Identity = 229/817 (28.03%), Postives = 376/817 (46.02%), Query Frame = 1
Query:  475 MIWFIVIFCVNTVLALSDKISIQMHEEIPPNSEIGSILS--AIPHNLRSTSLEFITESDFFIVTEEGKILVRKL-IDLETLCSQYKLCCGEPVCILKANILLNNKEKEVVSS---VEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNS---FILDISQ-----LPSIFLKVSKKLDFEEKKQYHAKLKACDEDN---CTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRI------IADLSSLKIQEEIP-SKLITTLQIVDQDKGPNGIVYC--------HLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKS--AVLKYQI-DNYGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQ-LQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQML---HSGTVILLFRASDYGQPAKYSDHKLVINIFGDESGN 2808
            ++   ++  V      S+ I  ++ EE PPN+ IGS+ +   +P +     LE +      + ++ G+I   ++ ID ETL     L   +  C L+  + + +  K +      +E  +++LD ND+ P F +P   + I E +  G   S+  A D+D  S   +  Y L    ++   F L +++     +P +   V   LD E+K  Y   ++  D       ++  L I + D+NDN P FE   Y   + E+   G  + QV+AND D+G  G I YS+    DT +Q    ++  +G I +K  +     +   F +VARD  P N K S   VTI ++D ND+ P I I      I       I E++P    +  +Q+ D+D+G N +V C         L P  E +    N  K  Y L++    D+E  +     ++  D G P+L S   + + +TD+N+  P+F      L  +  E+++ G KV+ V A D D    A L Y I ++  A  FEI+ N+G IR  N L DRE V    F V   D     KT +  V I V D NDN P F  +   FS+ EN  P   VG +  +DAD+ EN+ ++  +    NG  + ++        TG I + +  DRE    Y   + A D+   P+   +S V +T+ VLDEND +P  T P N+         P D  ++ ++A D D G N ++ + I                    F ++ ++G + ++Q     H G   L+ R SD G+P +++    +++++ +E+ N
Sbjct:   23 LVLLTIVLMVPCGAVPSNNI-YKLSEEQPPNTLIGSLAADLGLPDSGHLYKLE-VGSPYLRVDSKTGEIYTTEIPIDRETLSDCRNLFEDDK-CFLEFEVSITDMVKGIGLGPRLIEGIIEVLDINDNTPQFSSPILTLSIPENTHTGTLFSIPVAVDRDSGSN-GVAEYALSAGPDANQLFGLQVAEDVDEKIPQVI--VIGNLDREKKDSYDLNIRVVDGGKPPRASSALLRITVTDQNDNAPKFEKNQYEAELPENSPPGHSVLQVRANDADTGANGDIDYSLHQASDT-VQRLLRIDRSTGIIYVKGLVDREEDNLLKFYVVARDRGP-NSKSSKAQVTISIKDQNDNAPAIEIRGIGLVIHQNFVANISEDMPIGTPVALVQVSDRDEGENAVVTCVVAGDVPFQLRPASESA----NDRKRKYFLQTTTLLDYERIKDYRIEIVAVDSGNPALSSTNSLKVQVTDINDNTPSFS--PALLEVNFAEDNQPGDKVIDVVATDADSGVNAELVYSIIESSAASLFEINSNTGEIRVRNQL-DREDVERYEFGVAAADKGVPSKTGTAIVVINVEDRNDNDPKFMLSGYSFSVNENMPPLNPVGVVTVSDADKGENSQVTLFVEPD-NGKFIIQNG-------TGTILSSISFDREKESTYTFRLKAVDAGDPPR---SSYVGVTINVLDENDNAPYVTKPANSSYTHLKPSSPPDTPVEVVKAEDIDAGVNAELYYTIT------------GGNPHGLFQISHNSGEIKLAQGFTGKHKGLHRLVVRVSDKGKPPRHT--TALVHVYVNETTN 799          
BLAST of Protocadherin-9 vs. Ensembl Medaka
Match: pcdh1b (protocadherin-1 [Source:NCBI gene;Acc:101174755])

HSP 1 Score: 241.121 bits (614), Expect = 7.117e-65
Identity = 229/817 (28.03%), Postives = 376/817 (46.02%), Query Frame = 1
Query:  475 MIWFIVIFCVNTVLALSDKISIQMHEEIPPNSEIGSILS--AIPHNLRSTSLEFITESDFFIVTEEGKILVRKL-IDLETLCSQYKLCCGEPVCILKANILLNNKEKEVVSS---VEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNS---FILDISQ-----LPSIFLKVSKKLDFEEKKQYHAKLKACDEDN---CTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRI------IADLSSLKIQEEIP-SKLITTLQIVDQDKGPNGIVYC--------HLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKS--AVLKYQI-DNYGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQ-LQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQML---HSGTVILLFRASDYGQPAKYSDHKLVINIFGDESGN 2808
            ++   ++  V      S+ I  ++ EE PPN+ IGS+ +   +P +     LE +      + ++ G+I   ++ ID ETL     L   +  C L+  + + +  K +      +E  +++LD ND+ P F +P   + I E +  G   S+  A D+D  S   +  Y L    ++   F L +++     +P +   V   LD E+K  Y   ++  D       ++  L I + D+NDN P FE   Y   + E+   G  + QV+AND D+G  G I YS+    DT +Q    ++  +G I +K  +     +   F +VARD  P N K S   VTI ++D ND+ P I I      I       I E++P    +  +Q+ D+D+G N +V C         L P  E +    N  K  Y L++    D+E  +     ++  D G P+L S   + + +TD+N+  P+F      L  +  E+++ G KV+ V A D D    A L Y I ++  A  FEI+ N+G IR  N L DRE V    F V   D     KT +  V I V D NDN P F  +   FS+ EN  P   VG +  +DAD+ EN+ ++  +    NG  + ++        TG I + +  DRE    Y   + A D+   P+   +S V +T+ VLDEND +P  T P N+         P D  ++ ++A D D G N ++ + I                    F ++ ++G + ++Q     H G   L+ R SD G+P +++    +++++ +E+ N
Sbjct:   23 LVLLTIVLMVPCGAVPSNNI-YKLSEEQPPNTLIGSLAADLGLPDSGHLYKLE-VGSPYLRVDSKTGEIYTTEIPIDRETLSDCRNLFEDDK-CFLEFEVSITDMVKGIGLGPRLIEGIIEVLDINDNTPQFSSPILTLSIPENTHTGTLFSIPVAVDRDSGSN-GVAEYALSAGPDANQLFGLQVAEDVDEKIPQVI--VIGNLDREKKDSYDLNIRVVDGGKPPRASSALLRITVTDQNDNAPKFEKNQYEAELPENSPPGHSVLQVRANDADTGANGDIDYSLHQASDT-VQRLLRIDRSTGIIYVKGLVDREEDNLLKFYVVARDRGP-NSKSSKAQVTISIKDQNDNAPAIEIRGIGLVIHQNFVANISEDMPIGTPVALVQVSDRDEGENAVVTCVVAGDVPFQLRPASESA----NDRKRKYFLQTTTLLDYERIKDYRIEIVAVDSGNPALSSTNSLKVQVTDINDNTPSFS--PALLEVNFAEDNQPGDKVIDVVATDADSGVNAELVYSIIESSAASLFEINSNTGEIRVRNQL-DREDVERYEFGVAAADKGVPSKTGTAIVVINVEDRNDNDPKFMLSGYSFSVNENMPPLNPVGVVTVSDADKGENSQVTLFVEPD-NGKFIIQNG-------TGTILSSISFDREKESTYTFRLKAVDAGDPPR---SSYVGVTINVLDENDNAPYVTKPANSSYTHLKPSSPPDTPVEVVKAEDIDAGVNAELYYTIT------------GGNPHGLFQISHNSGEIKLAQGFTGKHKGLHRLVVRVSDKGKPPRHT--TALVHVYVNETTN 799          
BLAST of Protocadherin-9 vs. Ensembl Medaka
Match: pcdh7b (protocadherin 7 [Source:NCBI gene;Acc:101166584])

HSP 1 Score: 220.32 bits (560), Expect = 9.131e-58
Identity = 226/838 (26.97%), Postives = 366/838 (43.68%), Query Frame = 1
Query:  436 NKIKTTCLYYLQIMIWFIVIFCVNTVLALSDKISIQMHEEIPPNSEIGSILSAIPHNLRSTSLEFITES--DFFIVTE-EGKILV-RKLIDLETLCSQYKLCCGEPVCILKANILLNNKEKEVVSSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKL------------------------DEPTNS---FILDIS------QLPSIFLKVSKKLDFEEKKQYHAKLKACDEDN---CTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARD-SDPINPKQSLCSVTILVEDVNDHKPEIRI-------IADLSSLKIQEEIPSKLITTLQIVDQDKGPNGIVYC--------HLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQD--KSAVLKYQIDNYGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNN---ILNITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQML---HSGTVILLFRASDYGQPAK 2757
            N     CLYY  +++          VL        ++ EE P +  +G++ + +     S  + F  ES  +FF +    G++    K ID E L  Q ++   E  C +   + +    +  V   E +V ILD ND+ P F +P   + + E   IG    L +ATD+D   +  I+ Y+L                        DE  +    F L ++      + P + +K    LD E++  Y   L+  D  +    +   L + I D NDN P FE   Y   + E+   GS I Q+KA D D G+ G I+Y      ++ ++    ++  +G + +  ++     S+  F ++ARD   P  PK    +V + ++D ND+ P I I       + D  +   ++ +    I  +Q+ D+D+G NGIV C         L P  E   E QN+ K  Y L +    D+E  Q+ + +++  D G PSL S   + + + D N+  P F      +     EN+  G +V TV A D D  K+A + Y +D+     F ID +SG IR   NL DRE+     F V   D        S  V + V D NDN P F  ++  F + EN  P+  VG +   DAD+ +NA +   +       +++          TG I + L  DRE    Y   + A D    P+   ++   ++L V+DEND +PT T P N+   +L  + T+R    +  + ATD D G N  + + II       G + F     + F ++ +TG + +   L   H G   L+ + +D GQP++
Sbjct:    4 NAAAVDCLYYCMLILQLAHQPAAKQVL------RYRLAEEGPADVRVGNVAADLGMVAGSREVTFTLESGSEFFKIDNITGELTTNEKRIDREKL-QQCQMIFDENECFIDFEVSVIGPAQSWVDLFEGKVIILDINDNTPSFPSPVLTLSVEENRPIGTLYLLPTATDRDF-GRNGIERYELIQDNGENSRRSGSSGDSYSGKRRFDEGASRSSVFELQVADTTDGEKQPQLIIK--GALDREQRDSYELTLRVRDGGDPPRSSQAILRVMITDVNDNNPRFEKSVYEADLPENSSPGSPILQLKAADADVGVNGQIEYVFGAATES-VRRLLRLDESTGWLSVLHRIDREEVSQLRFTVMARDRGQP--PKMDKATVVLNIKDENDNVPAIEIRKIGRIFLKDGVANVAEDVVVDTPIALVQVSDRDQGENGIVTCTVVGDVPFQLKPASEMEGE-QNKKK--YFLHTSAPLDYETTQEYNVVIVAVDSGSPSLTSNNSLLVKVGDTNDNPPIFSKNVVQV--SFPENNAPGERVTTVTATDADSGKNAEISYSLDSSVNGIFSIDSDSGDIRVNTNL-DREQKERYEFKVIAKDKGINTLQGSATVVVLVDDKNDNEPKFMQDVFTFYVKENLDPNSPVGMVTVIDADKGQNAEMGLFIEEEEEIFSIENE--------TGTIFSTLSFDREQKTTYTFRVKAVDGGDPPR---SATATVSLFVMDENDNAPTVTFPINSSYTLLPPSSTVR--TVVRTVIATDTDTGINADLNYSII-------GGNPF-----RLFEIDGATGVISLMAKLEQKHYGLHRLVVQVTDNGQPSQ 797          

HSP 2 Score: 117.087 bits (292), Expect = 7.165e-26
Identity = 150/571 (26.27%), Postives = 250/571 (43.78%), Query Frame = 1
Query:  808 IQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNSF--ILDISQLPSIFLKVSKKLDFEEKKQYHAKLKACDEDN---CTTQNLIIHIKDENDNQPIFETETYN--------LTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKL----KKKLSTFTRSRYPFRIVARDSDPINPK-QSLCSVTILVEDVNDHKPEIRIIADLSSLKI---QEEIPSKLITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKSAVLKYQI-DNYGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFS-------TNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNV-LPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNI 2430
            ++V I D ND+NP FE    +  + E S  G  I    A D D     +I+ Y     T S   +L + +  + +L V  ++D EE  Q    + A D           ++++IKDENDN P  E               + EDV + + I  V+ +DRD G  G +  ++  D    ++    +E    + K        L   T   Y   IVA DS   +P   S  S+ + V D ND+ P    I   + +++   +   P + +TT+   D D G N  +   LD    G F + + S DI   R     D E +++ +  VI KD+G  +L+    + +++ D N+  P F         +V EN +  + V  V   D DK    +  +      E F I+  +G I  T +  DRE+ ++ +F V  +D    P++A+  V + V+D NDN+P  +       T LP  S +       +V  + ATD D   NA +++S+     GN  +     F +   TG I  + KL+++   L+ L +  +D+ + P    T++V++
Sbjct:  262 LRVMITDVNDNNPRFEKSVYEADLPENSSPGSPILQLKAADADVGVNGQIE-YVFGAATESVRRLLRLDE-STGWLSVLHRIDREEVSQLRFTVMARDRGQPPKMDKATVVLNIKDENDNVPAIEIRKIGRIFLKDGVANVAEDVVVDTPIALVQVSDRDQGENGIVTCTVVGDVPFQLKPASEMEGEQNKKKYFLHTSAPLDYETTQEYNVVIVAVDSG--SPSLTSNNSLLVKVGDTNDNPP----IFSKNVVQVSFPENNAPGERVTTVTATDADSGKNAEISYSLDSSVNGIFSIDSDSGDI---RVNTNLDREQKERYEFKVIAKDKGINTLQGSATVVVLVDDKNDNEPKFM--QDVFTFYVKENLDPNSPVGMVTVIDADKGQNAEMGLFIEEEEEIFSIENETGTIFSTLSF-DREQKTTYTFRVKAVDGGDPPRSATATVSLFVMDENDNAPTVTFPINSSYTLLPPSSTVRT-----VVRTVIATDTDTGINADLNYSI---IGGNPFR----LFEIDGATGVISLMAKLEQKHYGLHRLVVQVTDNGQ-PSQSTTTLVHV 805          
BLAST of Protocadherin-9 vs. Planmine SMEST
Match: SMESG000079318.1 (SMESG000079318.1)

HSP 1 Score: 2132.45 bits (5524), Expect = 0.000e+0
Identity = 1106/1110 (99.64%), Postives = 1106/1110 (99.64%), Query Frame = 1
Query:  475 MIWFIVIFCVNTVLALSDKISIQMHEEIPPNSEIGSILSAIPHNLRSTSLEFITESDFFIVTEEGKILVRKLIDLETLCSQYKLCCGEPVCILKANILLNNKEKEVVSSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNSFILDISQLPSIFLKVSKKLDFEEKKQYHAKLKACDEDNCTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIPSKLITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKSAVLKYQIDNYGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQMLHSGTVILLFRASDYGQPAKYSDHKLVINIFGDESGNLNXXXXXXXXXXXXXXSLFLIVAIICVRRKPPKYHSPTSSILTKEQPVPDWIGLNSDESLLAYPSGNKSPYITNSHRASFSTPMNDGTIPMRTYTPNCAQFEPIXXXXXXXXXXXXXXXXNPHHMPQEGQNYYTIRQPVRGPFRPCVPIPASPSRSGCYCYVLPEETIIQPGHPSPFPTFSQGDPSMSPVTPMNADXXXXXXXXXXXXXXPRYHFPNSNSKFNTNSTLKFHHYSPIDSMLMKDQYSHMAPNNSSECSTPRCHPRLTPMHIRKLSEKDLDSGASNPDERXXXXXXXXXXXXXXXXXVLYNGPPTSVDLTRTNSNQSYSDSIQT 3804
            MIWFIVIFCVNTV ALSDKISIQMHEEIPPNSEIGSILSAIPHNLRSTSLEFITESDFFIVTEEGKILVRKLIDLETLCSQYKLCCGEPVCILKANILLNNKEKEVVSSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNSFILDISQLPSIFLKVSKKLDFEEKKQYHAKLKACDEDNCTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIPSKLITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKSAVLKYQIDNYGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQMLHSGTVILLFRASDYGQPAKYSDHKLVINIFGDESGNLNMTIIAVMITVTAVISLFLIVAIICVRRKPPKYHSPTSSILTKEQPVPDWIGLNSDESLLAYPSGNKSPYITNSHRASF  PMNDGTIPMRTY PNCAQFEPIDGDSGDSGKGPSEEGSNPHHMPQEGQNYYTIRQPVRGPFRPCVPIPASPSRSGCYCYVLPEETIIQPGHPSPFPTFSQGDPSMSPVTPMNADISSIGYSSYNSLSLPRYHFPNSNSKFNTNSTLKFHHYSPIDSMLMKDQYSHMAPNNSSECSTPRCHPRLTPMHIRKLSEKDLDSGASNPDERSSSLVTSTTSASSSTKTVLYNGPPTSVDLTRTNSNQSYSDSIQT
Sbjct:    1 MIWFIVIFCVNTVFALSDKISIQMHEEIPPNSEIGSILSAIPHNLRSTSLEFITESDFFIVTEEGKILVRKLIDLETLCSQYKLCCGEPVCILKANILLNNKEKEVVSSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNSFILDISQLPSIFLKVSKKLDFEEKKQYHAKLKACDEDNCTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIPSKLITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKSAVLKYQIDNYGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQMLHSGTVILLFRASDYGQPAKYSDHKLVINIFGDESGNLNMTIIAVMITVTAVISLFLIVAIICVRRKPPKYHSPTSSILTKEQPVPDWIGLNSDESLLAYPSGNKSPYITNSHRASFIPPMNDGTIPMRTYAPNCAQFEPIDGDSGDSGKGPSEEGSNPHHMPQEGQNYYTIRQPVRGPFRPCVPIPASPSRSGCYCYVLPEETIIQPGHPSPFPTFSQGDPSMSPVTPMNADISSIGYSSYNSLSLPRYHFPNSNSKFNTNSTLKFHHYSPIDSMLMKDQYSHMAPNNSSECSTPRCHPRLTPMHIRKLSEKDLDSGASNPDERSSSLVTSTTSASSSTKTVLYNGPPTSVDLTRTNSNQSYSDSIQT 1110          
BLAST of Protocadherin-9 vs. Planmine SMEST
Match: SMESG000002712.1 (SMESG000002712.1)

HSP 1 Score: 494.197 bits (1271), Expect = 4.570e-155
Identity = 319/949 (33.61%), Postives = 522/949 (55.01%), Query Frame = 1
Query:  535 SIQMHEEIPPNSEIGSILSAIPHNLRSTSLEFITESDFFIVTEEGKILVRKLIDLETLCSQYKLCCGEPVCILKANILLNNKEKEVVSSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNSFILDISQLPSIFLKVSKKLDFEEKKQYHAKLKACDEDNCTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEE-IPSKLITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHV--WENSEFGTKVMTVKAQDQDKSAVLKYQIDNYGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPD--NNILNITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQMLHSGTVILLFRASDYGQPAKYSDHKLVINIFGDESGNLNXXXXXXXXXXXXXXSLFLIVAIICVRRKP----PKYHSPTSSILTKEQPVPDWIGLNSDESLLAYPSGNKSPYITNSHRASFSTPMNDGTIPMRTYTPNCAQFEPIXXXXXXXXXXXXXXXXNPHHMPQEGQNYYTIRQPVRGPFRPCVPIPASPSRSGCYCYVLPEET--IIQPGHPSPFPTF 3348
            ++ + EE  PN  IG+I  A+P  L+ +SL+F  +S F  + + G + ++K IDLETLC    +CCG+ +C ++  +L+N++  + + S+ + +QI D ND+ P+F T E  I + E   +  S+SL SA D+D S++ RI++YKL++ +N F LD S+ P I L++  +LD+E +KQY   LKACD D+CT + LII ++DENDN+PIF    Y ++I E+   GS++  V A D+DSG  G + Y+I    D D+  TF + + SG I+L+++L+   R  Y F +VA+DSD  NP++    V I VED+N++ P I I++    ++++E  +P  LI T+++ D D G N  V C L    +  F+L  + +++YSL SVR FD E  Q   A + C D G P   + + + + ITD+NE+ P FK     L+  V   EN+   TKV+ + A D+D +A ++Y +D  G  +F+ID  SG I+  N ++DRE + +I F     D+  +P TA+ ++ +T+ D NDN+P+F   +P+F++ EN   ++L+G++ ATDAD+  N+ + F L  +      Q     F+V   G IETL  LDRE  + Y LE+   D  K    P+ +  N+T++VLDEND  P W +P+  N   NIT  +   + ++ +QA D D G NG+++      YR  +   +  Q     F ++  +G + + + L    + L   ASD     K    KL+IN     + + ++++I ++I+VT  IS+ L+V+IICVR++P     KY  P +  L K   + +W     D S+     G                 +ND  +P +    +   +EPI  D+ +SG        +  + P   QN    R      ++   PIP++   +G   Y+LP+ +  +    + SP+P+ 
Sbjct:   24 NLTVKEEFKPNQFIGNIKYALPDKLKFSSLKFNVDSQFLQINDNGDVTLKKRIDLETLCQNSNICCGQFLCFIQTKVLVNDR-NDFIDSLTVNLQINDLNDNTPLFSTIEQTITLRESLPVNYSMSLESAFDRDFSAENRIESYKLEDSSNKFELDTSKFPQISLRLKSELDYETRKQYRLTLKACDRDSCTDKELIIDVQDENDNKPIFTKNFYKVSILENTDTGSLVVTVNAYDKDSGDLGLVMYNIDAPNDLDLIQTFGINSNSGEIRLERRLAANQRKLYTFHVVAKDSDFNNPQKEKVPVEITVEDINNYYPVIAILSTNERVEVRENTLPGNLI-TIKVSDNDIGMNSKVNCELQTESKIDFQLLKKKENLYSLASVRSFDFESGQVKSASIKCTDSGSPPKSTDRSVLVHITDMNEYSPEFKQ----LIYEVSLRENTATNTKVLQLNATDRDGAASIRYSLDEKGKAFFKIDHMSGWIKTKNVVLDREVIETIVFNAFAHDAYVDPFTATTKIIVTIEDENDNAPIFGV-IPEFTVKENMISTRLIGRLTATDADKGNNSQVEFVLLKTLARK--QEVQKIFSVSKEGFIETLQSLDRETFESYTLEVGVRDKGK---YPMATSTNVTVKVLDENDNKPQWMNPNPINPEYNITRIINKNELVMTVQAFDTDAGENGRIK------YRIHNPKPNSKQ---PVFSLDEDSGEIRLVKELDFDQIELTIIASDSATKPKMVMLKLIINNHSRVASSPSVSVIIILISVTGFISIVLVVSIICVRKRPIGTGIKYSCPNALDLGKTN-MAEWTF--QDNSIYKQKPG-------------IHYQLNDYQLPTQNVASSRTSYEPI--DAEESGDSGKGPSEDIRNAPYLDQNQIFARNYANMQWKIPSPIPSTAC-NGRQLYMLPDRSMNLHNSNYGSPYPSL 932          

HSP 2 Score: 80.4925 bits (197), Expect = 6.641e-15
Identity = 123/499 (24.65%), Postives = 220/499 (44.09%), Query Frame = 1
Query: 1174 TYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSL---CSVTILVEDVNDHKPEIRIIADLSSLKIQEEIPSKLITTLQ-IVDQDKGPNGIVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKS--AVLKYQIDNYG----AEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTE---PKTASVEVKITVLDANDNSP---LFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLR--NSWNGNTMQRHDNYFNVLPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQLQATDRDVGAN--------GKVRFEI 2592
            T NLT+KE+ +    IG +K    D   F ++K+++ + F   I     V TL  RI L+            F    +    +N +       +V + + D+ND+ P    I    ++ ++E +P     +L+   D+D      +  +        FEL        SLR   + D+E  ++    +   D+   S   +++I I + D N+ +P F  K+ Y +  + EN++ G+ V+TV A D+D     ++ Y ID        + F I+ NSG IR    L   +R     +T HV+  D++   P+   V V+ITV D N+  P   + STN  +  + ENT P  L+  I  +D D   N+ ++  L+  +  +   +++ +N ++      + ++   D E   +    I  +DS   P+    S++   + + D N+ SP +      + ++ +       +LQL ATDRD  A+        GK  F+I
Sbjct:   22 TANLTVKEEFKPNQFIGNIKYALPDKLKFSSLKFNVDSQF-LQINDNGDV-TLKKRIDLETLCQNSNICCGQFLCFIQTKVLVNDRNDFIDSLTVNLQINDLNDNTPLFSTIE--QTITLRESLPVNYSMSLESAFDRDFSAENRIESYKLEDSSNKFELDTSKFPQISLRLKSELDYETRKQYRLTLKACDRD--SCTDKELI-IDVQDENDNKPIFT-KNFYKVS-ILENTDTGSLVVTVNAYDKDSGDLGLVMYNIDAPNDLDLIQTFGINSNSGEIRLERRLAANQRK---LYTFHVVAKDSDFNNPQKEKVPVEITVEDINNYYPVIAILSTN-ERVEVRENTLPGNLI-TIKVSDNDIGMNSKVNCELQTESKIDFQLLKKKENLYS------LASVRSFDFESGQVKSASIKCTDSGSPPKSTDRSVL---VHITDMNEYSPEFKQLIYEV-SLRENTATNTKVLQLNATDRDGAASIRYSLDEKGKAFFKI 496          
BLAST of Protocadherin-9 vs. Planmine SMEST
Match: SMESG000002712.1 (SMESG000002712.1)

HSP 1 Score: 494.197 bits (1271), Expect = 4.692e-155
Identity = 319/949 (33.61%), Postives = 522/949 (55.01%), Query Frame = 1
Query:  535 SIQMHEEIPPNSEIGSILSAIPHNLRSTSLEFITESDFFIVTEEGKILVRKLIDLETLCSQYKLCCGEPVCILKANILLNNKEKEVVSSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNSFILDISQLPSIFLKVSKKLDFEEKKQYHAKLKACDEDNCTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEE-IPSKLITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHV--WENSEFGTKVMTVKAQDQDKSAVLKYQIDNYGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPD--NNILNITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQMLHSGTVILLFRASDYGQPAKYSDHKLVINIFGDESGNLNXXXXXXXXXXXXXXSLFLIVAIICVRRKP----PKYHSPTSSILTKEQPVPDWIGLNSDESLLAYPSGNKSPYITNSHRASFSTPMNDGTIPMRTYTPNCAQFEPIXXXXXXXXXXXXXXXXNPHHMPQEGQNYYTIRQPVRGPFRPCVPIPASPSRSGCYCYVLPEET--IIQPGHPSPFPTF 3348
            ++ + EE  PN  IG+I  A+P  L+ +SL+F  +S F  + + G + ++K IDLETLC    +CCG+ +C ++  +L+N++  + + S+ + +QI D ND+ P+F T E  I + E   +  S+SL SA D+D S++ RI++YKL++ +N F LD S+ P I L++  +LD+E +KQY   LKACD D+CT + LII ++DENDN+PIF    Y ++I E+   GS++  V A D+DSG  G + Y+I    D D+  TF + + SG I+L+++L+   R  Y F +VA+DSD  NP++    V I VED+N++ P I I++    ++++E  +P  LI T+++ D D G N  V C L    +  F+L  + +++YSL SVR FD E  Q   A + C D G P   + + + + ITD+NE+ P FK     L+  V   EN+   TKV+ + A D+D +A ++Y +D  G  +F+ID  SG I+  N ++DRE + +I F     D+  +P TA+ ++ +T+ D NDN+P+F   +P+F++ EN   ++L+G++ ATDAD+  N+ + F L  +      Q     F+V   G IETL  LDRE  + Y LE+   D  K    P+ +  N+T++VLDEND  P W +P+  N   NIT  +   + ++ +QA D D G NG+++      YR  +   +  Q     F ++  +G + + + L    + L   ASD     K    KL+IN     + + ++++I ++I+VT  IS+ L+V+IICVR++P     KY  P +  L K   + +W     D S+     G                 +ND  +P +    +   +EPI  D+ +SG        +  + P   QN    R      ++   PIP++   +G   Y+LP+ +  +    + SP+P+ 
Sbjct:   23 NLTVKEEFKPNQFIGNIKYALPDKLKFSSLKFNVDSQFLQINDNGDVTLKKRIDLETLCQNSNICCGQFLCFIQTKVLVNDR-NDFIDSLTVNLQINDLNDNTPLFSTIEQTITLRESLPVNYSMSLESAFDRDFSAENRIESYKLEDSSNKFELDTSKFPQISLRLKSELDYETRKQYRLTLKACDRDSCTDKELIIDVQDENDNKPIFTKNFYKVSILENTDTGSLVVTVNAYDKDSGDLGLVMYNIDAPNDLDLIQTFGINSNSGEIRLERRLAANQRKLYTFHVVAKDSDFNNPQKEKVPVEITVEDINNYYPVIAILSTNERVEVRENTLPGNLI-TIKVSDNDIGMNSKVNCELQTESKIDFQLLKKKENLYSLASVRSFDFESGQVKSASIKCTDSGSPPKSTDRSVLVHITDMNEYSPEFKQ----LIYEVSLRENTATNTKVLQLNATDRDGAASIRYSLDEKGKAFFKIDHMSGWIKTKNVVLDREVIETIVFNAFAHDAYVDPFTATTKIIVTIEDENDNAPIFGV-IPEFTVKENMISTRLIGRLTATDADKGNNSQVEFVLLKTLARK--QEVQKIFSVSKEGFIETLQSLDRETFESYTLEVGVRDKGK---YPMATSTNVTVKVLDENDNKPQWMNPNPINPEYNITRIINKNELVMTVQAFDTDAGENGRIK------YRIHNPKPNSKQ---PVFSLDEDSGEIRLVKELDFDQIELTIIASDSATKPKMVMLKLIINNHSRVASSPSVSVIIILISVTGFISIVLVVSIICVRKRPIGTGIKYSCPNALDLGKTN-MAEWTF--QDNSIYKQKPG-------------IHYQLNDYQLPTQNVASSRTSYEPI--DAEESGDSGKGPSEDIRNAPYLDQNQIFARNYANMQWKIPSPIPSTAC-NGRQLYMLPDRSMNLHNSNYGSPYPSL 931          

HSP 2 Score: 80.4925 bits (197), Expect = 6.809e-15
Identity = 123/499 (24.65%), Postives = 220/499 (44.09%), Query Frame = 1
Query: 1174 TYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSL---CSVTILVEDVNDHKPEIRIIADLSSLKIQEEIPSKLITTLQ-IVDQDKGPNGIVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKS--AVLKYQIDNYG----AEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTE---PKTASVEVKITVLDANDNSP---LFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLR--NSWNGNTMQRHDNYFNVLPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQLQATDRDVGAN--------GKVRFEI 2592
            T NLT+KE+ +    IG +K    D   F ++K+++ + F   I     V TL  RI L+            F    +    +N +       +V + + D+ND+ P    I    ++ ++E +P     +L+   D+D      +  +        FEL        SLR   + D+E  ++    +   D+   S   +++I I + D N+ +P F  K+ Y +  + EN++ G+ V+TV A D+D     ++ Y ID        + F I+ NSG IR    L   +R     +T HV+  D++   P+   V V+ITV D N+  P   + STN  +  + ENT P  L+  I  +D D   N+ ++  L+  +  +   +++ +N ++      + ++   D E   +    I  +DS   P+    S++   + + D N+ SP +      + ++ +       +LQL ATDRD  A+        GK  F+I
Sbjct:   21 TANLTVKEEFKPNQFIGNIKYALPDKLKFSSLKFNVDSQF-LQINDNGDV-TLKKRIDLETLCQNSNICCGQFLCFIQTKVLVNDRNDFIDSLTVNLQINDLNDNTPLFSTIE--QTITLRESLPVNYSMSLESAFDRDFSAENRIESYKLEDSSNKFELDTSKFPQISLRLKSELDYETRKQYRLTLKACDRD--SCTDKELI-IDVQDENDNKPIFT-KNFYKVS-ILENTDTGSLVVTVNAYDKDSGDLGLVMYNIDAPNDLDLIQTFGINSNSGEIRLERRLAANQRK---LYTFHVVAKDSDFNNPQKEKVPVEITVEDINNYYPVIAILSTN-ERVEVRENTLPGNLI-TIKVSDNDIGMNSKVNCELQTESKIDFQLLKKKENLYS------LASVRSFDFESGQVKSASIKCTDSGSPPKSTDRSVL---VHITDMNEYSPEFKQLIYEV-SLRENTATNTKVLQLNATDRDGAASIRYSLDEKGKAFFKI 495          
BLAST of Protocadherin-9 vs. Planmine SMEST
Match: SMESG000033639.1 (SMESG000033639.1)

HSP 1 Score: 461.455 bits (1186), Expect = 3.858e-142
Identity = 319/886 (36.00%), Postives = 483/886 (54.51%), Query Frame = 1
Query:  496 FCVNTVLALSDK-----ISIQMHEEIPPNSEIGSILSAIPHNLRSTSLEFITESDFFIVTEEGKILVRKLIDLETLCSQYKLCCGEPVCILKANILLNNKEKEVVSSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNSFILDISQLPSIFLKVSKKLDFEEKKQYHAKLKACDED-NCTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIPSKLITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKSAVLKYQIDNYGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIEN-TGPSQLVGQINATDADQDE-NALISFSLRNSWNGNTMQRHDNYFNVLPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSI-VNITLRVLDENDESPTW-----THPDNNILNITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQMLHSGTVILLFRASDYGQPAKYSDHKLVINIFGDESGNLNXXXXXXXXXXXXXXSLFLIVAIICVRRKPPKYHSPTSSILTKEQP-------VPDWIGLNSDESLLAYPSGNKSPYITNSHRASFSTPMNDGTIPMRTY 3090
            FC+  +  L  +     ++ ++ EE P +  IG+I+   P   +++   +  +S F  ++++G +++   IDLET+C+Q+++CC E  CILK  I+  +K  +   S+ I V + DKND+ P F  P+  + ++E   IG  + L  A D D +S  R+  Y   EPT +F LD S+LPSI L V K LD+E K QY A L+ACD +  C TQ L IH+ D+NDN P F  + Y + I E+  +G  I  V+A D+DS LF  I Y      D +I++TF +   +G IKL+KKLS   R +Y F++ A D   +   +++ ++ I V+D+ND+ P+I  ++  S ++I E  P + + TLQ+ D D G N  V C L       F L     +IYSL S+R FD+E E++I A + C D G P   + K + + + D+NEF P F+   Q L   + EN E G  ++ V A D+D SAVLKY       +YF ID ++G I+     +DRE V  I   + V D+   PKT    V I VLD NDN P F      F+I EN +  S++ G+I ATD D+DE N  + F L+++++    +  +  F V  +G I T+ KLDREI   Y +EI A D+     +P+ S   N T+ V D+ND  P W     +H   + +NIT    PG  +++LQATD D G N  V + ++   +               FI+N  TG L ++++L  G   L  RASD G+P ++++  L I I GDE   LNM+II V+I +T  IS+FLI+AIICVRR+P   ++ T       +P       V    G ++DE    YPSGN   +++++    +     D ++PM T+
Sbjct:    5 FCIIFLFYLCHQGSCQTVTFKIMEESPIDMVIGNIVHLHPSFNKAS---YFIKSPFLKLSDKGDLMLSSRIDLETICAQHEMCCEEVECILKTTIMAKDKSSDQSESINIHVSVSDKNDNWPKFVKPKQTVNVAENEPIGFYLYLDRALDADATSANRVHQYIFKEPTGTFNLDQSRLPSIGLIVKKPLDYEVKSQYFATLEACDTNKQCNTQALEIHVLDQNDNYPSFSQQEYQIEILENFPVGQQIIAVEAIDKDSDLFNKIIYGFHELSDNNIRNTFIITENTGSIKLQKKLSAKVRQKYKFKVFAADKMAMAFHKAVANIFIKVKDLNDNSPKITSLSGNSKIEINETDPPRELFTLQVTDDDIGVNANVSCQLLQQYINDFRLDAVGNEIYSLSSIRSFDYENEREIKAEIECYDHGSPRNVAHKSLNVHVKDINEFAPRFEKDFQKL--KLLENREQGHNILQVSASDRDGSAVLKYSFTGEPNDYFTIDPHTGQIKSGIRRLDREMVERIEINIIVTDAIENPKTGQCTVIIEVLDENDNPPTFIDISGVFNISENLSSYSKVRGRIAATDKDKDEINNKVLFQLQHTFDSQNRRISEPIFKVTESGEILTVKKLDREINHNYTVEIRAFDTG----LPMLSAHKNFTIYVEDQNDNDPDWVTPLSSHGGIHTVNITANSPPGYLIIKLQATDPDYGENSNVTYSVMNNNK-------------LLFILNQVTGELRVARLLPIGQFQLFLRASDNGRPPRHNETSLFIFINGDEVATLNMSIIIVLIGITGFISIFLIIAIICVRRRPRYNNTDTMGSQNSFEPPKTSNHHVTGTWGHHTDEGSY-YPSGN---FLSDNTSVLYFPNEIDSSVPMNTF 864          
BLAST of Protocadherin-9 vs. Planmine SMEST
Match: SMESG000033639.1 (SMESG000033639.1)

HSP 1 Score: 459.914 bits (1182), Expect = 8.983e-142
Identity = 316/863 (36.62%), Postives = 473/863 (54.81%), Query Frame = 1
Query:  550 EEIPPNSEIGSILSAIPHNLRSTSLEFITESDFFIVTEEGKILVRKLIDLETLCSQYKLCCGEPVCILKANILLNNKEKEVVSSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNSFILDISQLPSIFLKVSKKLDFEEKKQYHAKLKACDED-NCTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKIQEEIPSKLITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKSAVLKYQIDNYGAEYFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIEN-TGPSQLVGQINATDADQDE-NALISFSLRNSWNGNTMQRHDNYFNVLPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSI-VNITLRVLDENDESPTW-----THPDNNILNITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQMLHSGTVILLFRASDYGQPAKYSDHKLVINIFGDESGNLNXXXXXXXXXXXXXXSLFLIVAIICVRRKPPKYHSPTSSILTKEQP-------VPDWIGLNSDESLLAYPSGNKSPYITNSHRASFSTPMNDGTIPMRTY 3090
            EE P +  IG+I+   P   +++   +  +S F  ++++G +++   IDLET+C+Q+++CC E  CILK  I+  +K  +   S+ I V + DKND+ P F  P+  + ++E   IG  + L  A D D +S  R+  Y   EPT +F LD S+LPSI L V K LD+E K QY A L+ACD +  C TQ L IH+ D+NDN P F  + Y + I E+  +G  I  V+A D+DS LF  I Y      D +I++TF +   +G IKL+KKLS   R +Y F++ A D   +   +++ ++ I V+D+ND+ P+I  ++  S ++I E  P + + TLQ+ D D G N  V C L       F L     +IYSL S+R FD+E E++I A + C D G P   + K + + + D+NEF P F+   Q L   + EN E G  ++ V A D+D SAVLKY       +YF ID ++G I+     +DRE V  I   + V D+   PKT    V I VLD NDN P F      F+I EN +  S++ G+I ATD D+DE N  + F L+++++    +  +  F V  +G I T+ KLDREI   Y +EI A D+     +P+ S   N T+ V D+ND  P W     +H   + +NIT    PG  +++LQATD D G N  V + ++   +               FI+N  TG L ++++L  G   L  RASD G+P ++++  L I I GDE   LNM+II V+I +T  IS+FLI+AIICVRR+P   ++ T       +P       V    G ++DE    YPSGN   +++++    +     D ++PM T+
Sbjct:    2 EESPIDMVIGNIVHLHPSFNKAS---YFIKSPFLKLSDKGDLMLSSRIDLETICAQHEMCCEEVECILKTTIMAKDKSSDQSESINIHVSVSDKNDNWPKFVKPKQTVNVAENEPIGFYLYLDRALDADATSANRVHQYIFKEPTGTFNLDQSRLPSIGLIVKKPLDYEVKSQYFATLEACDTNKQCNTQALEIHVLDQNDNYPSFSQQEYQIEILENFPVGQQIIAVEAIDKDSDLFNKIIYGFHELSDNNIRNTFIITENTGSIKLQKKLSAKVRQKYKFKVFAADKMAMAFHKAVANIFIKVKDLNDNSPKITSLSGNSKIEINETDPPRELFTLQVTDDDIGVNANVSCQLLQQYINDFRLDAVGNEIYSLSSIRSFDYENEREIKAEIECYDHGSPRNVAHKSLNVHVKDINEFAPRFEKDFQKL--KLLENREQGHNILQVSASDRDGSAVLKYSFTGEPNDYFTIDPHTGQIKSGIRRLDREMVERIEINIIVTDAIENPKTGQCTVIIEVLDENDNPPTFIDISGVFNISENLSSYSKVRGRIAATDKDKDEINNKVLFQLQHTFDSQNRRISEPIFKVTESGEILTVKKLDREINHNYTVEIRAFDTG----LPMLSAHKNFTIYVEDQNDNDPDWVTPLSSHGGIHTVNITANSPPGYLIIKLQATDPDYGENSNVTYSVMNNNK-------------LLFILNQVTGELRVARLLPIGQFQLFLRASDNGRPPRHNETSLFIFINGDEVATLNMSIIIVLIGITGFISIFLIIAIICVRRRPRYNNTDTMGSQNSFEPPKTSNHHVTGTWGHHTDEGSY-YPSGN---FLSDNTSVLYFPNEIDSSVPMNTF 838          
The following BLAST results are available for this feature:
BLAST of Protocadherin-9 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PCDH11Y1.636e-6026.58protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:... [more]
PCDH94.209e-6026.88protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661][more]
PCDH11Y4.310e-6026.58protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:... [more]
PCDH11Y5.537e-6026.58protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:... [more]
PCDH11Y5.537e-6026.58protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Protocadherin-9 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fmi-12.952e-4425.94FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
fmi-16.389e-4127.23FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
cdh-12.911e-3426.10CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4... [more]
cdh-41.414e-3326.37Cadherin-4 [Source:UniProtKB/TrEMBL;Acc:A0A1C3NSI... [more]
cdh-36.693e-2723.33Cadherin-3 [Source:UniProtKB/Swiss-Prot;Acc:P3461... [more]
back to top
BLAST of Protocadherin-9 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ds7.352e-5327.18gene:FBgn0284247 transcript:FBtr0078045[more]
ds7.352e-5327.18gene:FBgn0284247 transcript:FBtr0343249[more]
stan9.527e-5128.04gene:FBgn0024836 transcript:FBtr0304899[more]
stan9.527e-5128.04gene:FBgn0024836 transcript:FBtr0300578[more]
stan1.062e-5028.04gene:FBgn0024836 transcript:FBtr0330601[more]
back to top
BLAST of Protocadherin-9 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CT030123.12.380e-6928.88protocadherin 1b [Source:NCBI gene;Acc:572016][more]
CT030123.11.826e-6829.09protocadherin 1b [Source:NCBI gene;Acc:572016][more]
CT030123.12.024e-6829.09protocadherin 1b [Source:NCBI gene;Acc:572016][more]
CT030123.12.626e-6829.09protocadherin 1b [Source:NCBI gene;Acc:572016][more]
pcdh1b3.152e-6829.09protocadherin 1b [Source:ZFIN;Acc:ZDB-GENE-091015-... [more]
back to top
BLAST of Protocadherin-9 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh172.647e-6528.82protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
pcdh173.210e-6528.82protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
pcdh173.653e-6528.82protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
pcdh175.018e-6528.82protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
pcdh178.486e-6528.82protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
back to top
BLAST of Protocadherin-9 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pcdhgb21.190e-5928.51protocadherin gamma subfamily B, 2 [Source:MGI Sym... [more]
Pcdh93.403e-5826.51protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801... [more]
Pcdh93.470e-5826.54protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801... [more]
Pcdh94.086e-5826.51protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801... [more]
Pcdh95.072e-5826.51protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801... [more]
back to top
BLAST of Protocadherin-9 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9BZA8|PC11Y_HUMAN7.855e-6026.58Protocadherin-11 Y-linked OS=Homo sapiens OX=9606 ... [more]
sp|Q6WYY1|PC11X_PANPA3.396e-5926.33Protocadherin-11 X-linked OS=Pan paniscus OX=9597 ... [more]
sp|Q71M42|PC11X_PANTR3.768e-5926.33Protocadherin-11 X-linked OS=Pan troglodytes OX=95... [more]
sp|Q9HC56|PCDH9_HUMAN3.965e-5926.88Protocadherin-9 OS=Homo sapiens OX=9606 GN=PCDH9 P... [more]
sp|Q9BZA7|PC11X_HUMAN4.455e-5826.33Protocadherin-11 X-linked OS=Homo sapiens OX=9606 ... [more]
back to top
BLAST of Protocadherin-9 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3R7DDS93.323e-13931.87Protocadherin-11 Y-linked (Fragment) OS=Clonorchis... [more]
A0A4S2LLF47.564e-13932.20Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A5J4NP927.565e-13933.37Protocadherin delta 1 OS=Paragonimus westermani OX... [more]
G7YAD68.186e-13831.87Protocadherin-9 OS=Clonorchis sinensis OX=79923 GN... [more]
A0A074ZRN89.621e-13832.96Uncharacterized protein OS=Opisthorchis viverrini ... [more]
back to top
BLAST of Protocadherin-9 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh1b1.124e-6728.78protocadherin 1b [Source:ZFIN;Acc:ZDB-GENE-091015-... [more]
pcdh1a2.840e-6628.57protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
pcdh1a4.148e-6628.57protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
pcdh112.085e-5827.41protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
pcdh115.639e-5827.41protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
back to top
BLAST of Protocadherin-9 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000010725.13.230e-5326.86pep scaffold:Pmarinus_7.0:GL479425:26296:30457:-1 ... [more]
ENSPMAT00000008517.14.023e-4826.94pep scaffold:Pmarinus_7.0:GL476786:43429:129410:1 ... [more]
ENSPMAT00000006996.11.219e-4728.42pep scaffold:Pmarinus_7.0:GL476780:2096:143714:1 g... [more]
pcdh111.221e-4726.14protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
si:ch211-199f5.11.662e-4525.54protocadherin 8 [Source:HGNC Symbol;Acc:HGNC:8660][more]
back to top
BLAST of Protocadherin-9 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protocadherin-9 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO461892.060e-6229.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO354124.613e-5429.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO482371.662e-4928.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO417673.489e-4727.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO333596.387e-4726.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protocadherin-9 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh1a2.912e-6729.41protocadherin-1 [Source:NCBI gene;Acc:101157079][more]
pcdh1a6.874e-6729.41protocadherin-1 [Source:NCBI gene;Acc:101157079][more]
pcdh1b6.781e-6528.03protocadherin-1 [Source:NCBI gene;Acc:101174755][more]
pcdh1b7.117e-6528.03protocadherin-1 [Source:NCBI gene;Acc:101174755][more]
pcdh7b9.131e-5826.97protocadherin 7 [Source:NCBI gene;Acc:101166584][more]
back to top
BLAST of Protocadherin-9 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000079318.10.000e+099.64SMESG000079318.1[more]
SMESG000002712.14.570e-15533.61SMESG000002712.1[more]
SMESG000002712.14.692e-15533.61SMESG000002712.1[more]
SMESG000033639.13.858e-14236.00SMESG000033639.1[more]
SMESG000033639.18.983e-14236.62SMESG000033639.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012056 ID=SMED30012056|Name=Protocadherin-9|organism=Schmidtea mediterranea sexual|type=transcript|length=3995bp
TGATCAGAAATCACTATCGAATAAGATTGGATTTTCATTGAAATTTATCG
TCGTGCAACATTTTTCCAGATTTTCATTATCTCTCTCGTTGCGTGTCTAC
GAGTGAGTCTGTGTGTGCAATTTTGGAATTTAAATCGATTTCGTTTCGGA
TTATTCGTTTGGAGAATTTTGTGTTCTTCTGTCTCTGTGTTGGATATTTT
GTGCTTGTTTCCATGCTTATGTGCCGATTCCAGTCGTGAGGGGTTGGGAG
TTTTTTTTGTGTTGTTGTTTAGAAAGATTCCCAAAATCCAATCAGAAATA
TAATTATCACTTGAATTACAATTACCAGATGTTGGAAACAGATGCGAGTG
TGAAAAATTTATACTACACAATTTATTGAGATCAATTCTTGATTAAAATT
AAAAGTATTTCTGGGATTATCAAAAGTAATTTTTAAATAAAATCAAAACT
ACTTGTTTATACTACTTACAAATAATGATTTGGTTTATCGTTATTTTTTG
CGTTAATACTGTTCTTGCGTTGTCGGATAAAATCAGCATTCAAATGCACG
AGGAAATTCCTCCGAATTCAGAGATTGGAAGTATTCTCTCAGCTATTCCA
CACAATTTACGAAGCACTTCTTTGGAGTTTATTACTGAAAGCGATTTTTT
TATTGTTACTGAAGAGGGGAAAATATTAGTAAGAAAGTTGATTGATTTGG
AGACATTATGTTCCCAATATAAGTTATGTTGCGGTGAACCTGTTTGCATA
TTAAAGGCGAATATTTTATTAAATAATAAAGAAAAGGAAGTGGTTTCAAG
TGTAGAAATTCAAGTGCAGATATTAGATAAAAACGATCATAATCCTATAT
TTGAAACGCCTGAAACTAAAATAGTGATAAGTGAGTTCTCTCAGATTGGT
ATCTCAATTTCTTTAACTTCCGCAACTGACAAGGACCATTCAAGCCAATA
TCGCATACAAAATTATAAACTTGATGAACCGACAAATAGTTTCATTCTTG
ACATCAGTCAGTTGCCTTCAATTTTCTTGAAGGTTTCGAAAAAGCTAGAT
TTTGAAGAAAAGAAACAATACCATGCGAAATTGAAAGCGTGCGACGAAGA
CAACTGTACCACTCAAAACCTCATTATCCACATTAAAGACGAAAATGATA
ATCAACCGATTTTTGAGACTGAAACTTACAATTTAACAATCAAAGAAGAC
GTTCAAATCGGATCAATCATTGGCCAGGTCAAAGCCAATGATAGAGATTC
GGGATTATTTGGCACAATCAAATATTCTATCAGAACCGATTTTGACACAG
ATATCCAATCAACGTTTTATGTCGAAACTCTTTCAGGGAGAATCAAATTG
AAAAAGAAATTGTCCACCTTTACTAGAAGCCGATATCCGTTTAGAATTGT
TGCCCGAGACTCTGATCCCATTAACCCAAAACAATCCCTGTGCAGTGTGA
CCATTCTTGTTGAAGACGTCAACGATCACAAGCCGGAAATTCGGATTATA
GCCGATTTGAGTTCATTAAAAATTCAAGAGGAAATACCATCGAAACTCAT
TACGACATTGCAAATTGTCGATCAAGATAAAGGTCCCAATGGAATTGTTT
ATTGTCATCTTGATCCGGTTTGCGAGGGTTCATTTGAACTGCAAAACCGA
TCGAAAGACATTTACTCTTTGCGGAGCGTGAGAAAATTCGATCACGAAGT
CGAACAGAAAATCGACGCGATTGTCATTTGCAAAGATCAAGGAGAACCGA
GTCTGGAATCGAGGAAAATTATTCCAATTATCATTACTGATCTCAATGAA
TTCCGACCGACCTTTAAAGATAAGTCCCAGTATTTGCTGGGACATGTTTG
GGAAAATTCAGAATTTGGTACCAAAGTAATGACGGTAAAAGCACAGGATC
AGGACAAATCCGCTGTGTTGAAGTACCAAATCGACAATTACGGTGCCGAA
TATTTTGAAATAGATCAAAATTCTGGGCTTATTAGATGTACAAATAACTT
AATAGACCGGGAAAGAGTGTCATCAATTTCATTTACAGTTCACGTCATGG
ATAGTGACACAGAACCGAAAACTGCAAGCGTCGAAGTGAAGATTACGGTG
CTCGACGCAAATGATAATTCTCCATTGTTTTCAACAAATTTACCTCAATT
TTCAATTATTGAAAATACCGGACCTAGTCAATTAGTTGGTCAAATAAACG
CAACAGATGCTGATCAGGACGAAAATGCATTAATATCCTTTTCTCTTCGA
AATTCATGGAACGGTAACACAATGCAACGACACGATAACTATTTCAACGT
CTTACCAACCGGTCACATTGAGACATTATTGAAACTTGACCGAGAAATTT
GCGATTTATATATTCTAGAAATTATGGCGTCGGATTCCGCAAAATCTCCC
CAAATTCCTTTAACATCAATTGTTAATATTACTTTACGAGTGCTAGATGA
AAATGATGAATCTCCAACCTGGACACATCCTGATAATAATATCTTAAACA
TTACTGACACTATGAGACCCGGAGATCATTTGTTGCAACTTCAAGCAACA
GATCGTGATGTCGGAGCCAATGGAAAAGTTCGATTTGAAATAATCAAACA
ATACAGAAAGGAAGACGGATCATCGTCATTTAATCAAGGATCTAGTCAGT
ATTTCATAGTAAATTCATCAACTGGAGCATTATGGATATCACAAATGCTC
CATTCGGGAACTGTAATTCTTTTATTTCGAGCAAGTGACTATGGACAACC
TGCCAAATATTCAGATCATAAACTAGTTATTAACATTTTCGGTGATGAAA
GTGGCAATTTGAACATGACAATAATAGCTGTCATGATCACAGTTACCGCT
GTGATATCTTTGTTTTTAATTGTTGCAATAATTTGTGTTCGACGAAAACC
TCCGAAATACCATAGTCCGACAAGTTCTATTCTAACAAAAGAACAACCTG
TCCCAGATTGGATTGGTTTGAATTCCGATGAATCTTTATTAGCATACCCA
TCTGGAAACAAATCTCCTTATATTACCAATTCTCACAGAGCTTCATTTAG
TACGCCTATGAATGATGGAACCATACCAATGCGTACATATACACCTAATT
GTGCACAATTCGAACCAATCGATGGAGACAGTGGAGATTCTGGAAAAGGT
CCCAGTGAGGAAGGTTCAAATCCACATCATATGCCTCAAGAAGGGCAAAA
TTATTATACTATTCGCCAGCCTGTTCGTGGACCATTCAGGCCATGTGTTC
CAATACCAGCTAGTCCGTCAAGATCAGGATGCTATTGTTATGTGTTGCCA
GAAGAAACCATAATTCAACCCGGTCATCCTAGTCCATTTCCCACATTTTC
TCAAGGAGATCCATCAATGTCACCAGTAACCCCTATGAACGCTGACATTT
CCTCGATTGGTTATTCATCATATAACTCATTAAGTTTACCAAGATATCAT
TTTCCGAACTCAAATTCAAAGTTTAATACAAATTCAACTTTAAAATTTCA
CCACTATTCACCAATTGATTCAATGTTAATGAAAGATCAGTATTCTCACA
TGGCACCAAATAATTCTAGTGAATGTTCAACACCAAGATGTCATCCGAGA
CTCACACCTATGCACATAAGAAAACTCTCGGAAAAAGATCTCGATTCAGG
GGCATCCAATCCAGATGAAAGATCATCTTCATTAGTCACAAGTACAACAT
CTGCTTCCTCAAGTACTAAAACAGTACTTTACAATGGGCCCCCGACTTCA
GTTGATTTGACCCGAACAAACTCAAATCAATCATACTCAGACTCTATCCA
AACTTAAAATTTGATAAATCTTGTCAAATCTTTTAATTTCTATGTGATAA
ATTCCATTACTGTTGTCGAGGGGTTCCTCTTGAAGCGTCACATTTGCTAC
TCAAAAGCATATTATAATGTATATTATGCTATTTGAAAATGTTGTTAATC
TATCTATTTTTAAAGTAAGATAAGAAGAAAAGGTTCAAAACTGAG
back to top

protein sequence of SMED30012056-orf-1

>SMED30012056-orf-1 ID=SMED30012056-orf-1|Name=SMED30012056-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1111bp
MIWFIVIFCVNTVLALSDKISIQMHEEIPPNSEIGSILSAIPHNLRSTSL
EFITESDFFIVTEEGKILVRKLIDLETLCSQYKLCCGEPVCILKANILLN
NKEKEVVSSVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSA
TDKDHSSQYRIQNYKLDEPTNSFILDISQLPSIFLKVSKKLDFEEKKQYH
AKLKACDEDNCTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIG
QVKANDRDSGLFGTIKYSIRTDFDTDIQSTFYVETLSGRIKLKKKLSTFT
RSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSSLKI
QEEIPSKLITTLQIVDQDKGPNGIVYCHLDPVCEGSFELQNRSKDIYSLR
SVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDK
SQYLLGHVWENSEFGTKVMTVKAQDQDKSAVLKYQIDNYGAEYFEIDQNS
GLIRCTNNLIDRERVSSISFTVHVMDSDTEPKTASVEVKITVLDANDNSP
LFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTM
QRHDNYFNVLPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIV
NITLRVLDENDESPTWTHPDNNILNITDTMRPGDHLLQLQATDRDVGANG
KVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQMLHSGTVILL
FRASDYGQPAKYSDHKLVINIFGDESGNLNMTIIAVMITVTAVISLFLIV
AIICVRRKPPKYHSPTSSILTKEQPVPDWIGLNSDESLLAYPSGNKSPYI
TNSHRASFSTPMNDGTIPMRTYTPNCAQFEPIDGDSGDSGKGPSEEGSNP
HHMPQEGQNYYTIRQPVRGPFRPCVPIPASPSRSGCYCYVLPEETIIQPG
HPSPFPTFSQGDPSMSPVTPMNADISSIGYSSYNSLSLPRYHFPNSNSKF
NTNSTLKFHHYSPIDSMLMKDQYSHMAPNNSSECSTPRCHPRLTPMHIRK
LSEKDLDSGASNPDERSSSLVTSTTSASSSTKTVLYNGPPTSVDLTRTNS
NQSYSDSIQT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0002032epidermal cell
PLANA:0002075pigment cell
PLANA:0003001lateral region of the whole animal
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR002126Cadherin-like_dom
IPR020894Cadherin_CS
IPR015919Cadherin-like_sf
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0005886plasma membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0007156homophilic cell adhesion via plasma membrane adhesion molecules
GO:0007155cell adhesion
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002126Cadherin-likePRINTSPR00205CADHERINcoord: 611..637
score: 28.87
coord: 56..75
score: 23.51
coord: 303..315
score: 30.28
coord: 648..665
score: 40.3
coord: 531..550
score: 39.88
coord: 230..259
score: 30.2
IPR002126Cadherin-likeSMARTSM00112CA_2coord: 252..337
e-value: 1.4E-15
score: 67.8
coord: 574..664
e-value: 2.8E-15
score: 66.8
coord: 148..228
e-value: 2.2E-9
score: 47.2
coord: 689..780
e-value: 0.064
score: 16.0
coord: 362..445
e-value: 1.6E-8
score: 44.3
coord: 471..550
e-value: 5.0E-19
score: 79.2
IPR002126Cadherin-likePFAMPF00028Cadherincoord: 558..653
e-value: 2.5E-11
score: 43.9
coord: 457..543
e-value: 6.0E-14
score: 52.2
coord: 235..330
e-value: 2.2E-12
score: 47.3
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 338..444
e-value: 5.0E-13
score: 51.5
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 19..118
e-value: 8.5E-7
score: 31.1
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 454..550
e-value: 9.4E-22
score: 79.5
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 663..776
e-value: 3.0E-12
score: 48.8
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 226..337
e-value: 1.4E-26
score: 95.2
coord: 120..225
e-value: 2.2E-15
score: 59.1
coord: 551..662
e-value: 1.4E-22
score: 82.3
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1062..1110
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1054..1110
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 885..905
NoneNo IPR availablePANTHERPTHR24026FAMILY NOT NAMEDcoord: 107..285
coord: 279..488
coord: 406..781
coord: 185..375
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 460..552
score: 21.424
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 127..230
score: 16.579
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 231..339
score: 21.752
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 58..126
score: 8.993
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 668..771
score: 10.089
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 553..666
score: 21.621
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 342..447
score: 11.339
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 558..661
e-value: 1.37076E-19
score: 82.7465
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 234..335
e-value: 3.19568E-24
score: 95.8433
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 347..442
e-value: 1.52228E-9
score: 54.2418
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 457..548
e-value: 2.17214E-22
score: 90.8357
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 674..771
e-value: 1.11139E-11
score: 60.0197
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 133..226
e-value: 1.3543E-9
score: 54.2418
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..15
score: 0.82
NoneNo IPR availableTMHMMTMhelixcoord: 781..803
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 327..337
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 114..124
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 218..228
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 540..550
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 218..341
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 655..773
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 435..544
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 120..230
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 332..439
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 540..669