arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like

Overview
Namearf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like
Smed IDSMED30012050
Length (bp)3266
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like (SMED30012050) t-SNE clustered cells

Violin plots show distribution of expression levels for arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like (SMED30012050) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like (SMED30012050) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like (SMED30012050) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012050

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30012050SMESG000070668.1 SmedASXL_015768SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
epidermal cellSMED30012050SMESG000070668.1 dd_Smed_v4_10120_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30012050SMESG000070668.1 dd_Smed_v6_10120_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30012050SMESG000070668.1 dd_Smed_v4_10120_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30012050SMESG000070668.1 dd_Smed_v4_10120_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Human
Match: ARAP2 (ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 2 [Source:HGNC Symbol;Acc:HGNC:16924])

HSP 1 Score: 115.161 bits (287), Expect = 4.422e-25
Identity = 72/214 (33.64%), Postives = 109/214 (50.93%), Query Frame = 3
Query:  705 TFKIRFESSELVNEWKIILSEAINIAFMGGENKILKQIYTNESNKLCADCGYPNPEWVSINLCVILCINCSGLHRSLATSHSRIQSAILDQRIWEDSFLIEIMKKIGNENSNLFWYKNKQNSSTIFPSDLSE-----INSKYIEKKFIDTEFINLSDNEIKNRLRSSVATDDVFLTMKLYHS---IKFPYDSEFIKEILLIARNSNQYLQEKFL 1322
            +F    E+ +   +W  I +   +IA    + ++ ++I+ NESN+ CADC  P+P+W SINLCV++C  C+G HRSL    S+++S  +D  IW +  LIE+   IGN+ +N FW  N Q    +      E     I  KY E KF  T   +L+  E+   L ++V   DV  TM L  S   +             L+A+ + Q LQ +FL
Sbjct:  656 SFSFTAETEKEKQDW--IEAVQQSIAETLSDYEVAEKIWFNESNRSCADCKAPDPDWASINLCVVICKKCAGQHRSLGPKDSKVRSLKMDASIWSNE-LIELFIVIGNKRANDFWAGNLQKDEELHMDSPVEKRKNFITQKYKEGKFRKTLLASLTKEELNKALCAAVVKPDVLETMALLFSGADVMCATGDPVHSTPYLLAKKAGQSLQMEFL 866          

HSP 2 Score: 59.3066 bits (142), Expect = 4.617e-8
Identity = 35/142 (24.65%), Postives = 67/142 (47.18%), Query Frame = 3
Query: 1983 NLFTNQRPIMFNPIDKMITFIITRGLKSEFIFRKVGAVRKINALYELIEKSPNDFFIDPNVYNVNDVASCLKKYFRSFNEPIITDSLFNLFCDACKLENTSSKLAQLEFTVSSMPEINYQVLRKTVELLYMIQKFADENKMD 2408
             L  N  PI+ N     I F+   GL  ++I++K G    I+ L E  +K    F +    + + DV + LK +    ++ ++T  L+  +  A   ++   ++ +    + S+P +N   L   +E LY +QK ++ N M+
Sbjct: 1122 QLSKNDVPIIVN---SCIAFVTQYGLGCKYIYQKNGDPLHISELLESFKKDARSFKLRAGKHQLEDVTAVLKSFLSDIDDALLTKELYPYWISALDTQDDKERIKKYGAFIRSLPGVNRATLAAIIEHLYRVQKCSEINHMN 1260          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Human
Match: ARAP1 (ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 1 [Source:HGNC Symbol;Acc:HGNC:16925])

HSP 1 Score: 112.849 bits (281), Expect = 1.648e-24
Identity = 73/272 (26.84%), Postives = 131/272 (48.16%), Query Frame = 3
Query:  534 YILIRSDEYLLHIYENLVEHAQNICSHVINLKFYSLEXXXXXXXXXXXXLKLFGKSITFKIRFESSELVNEWKIILSEAINIAFMGGENKILKQIYTNESNKLCADCGYPNPEWVSINLCVILCINCSGLHRSLATSHSRIQSAILDQRIWEDSFLIEIMKKIGNENSNLFWYKNKQNSSTIFPSDLS-----EINSKYIEKKFIDTEFINLSDNEIKNRLRSSVATDDVFLTMKLYHSIK----FPYDSEFIKEILLIARNSNQYLQEKFL 1322
            Y+ +  D+  + +Y+NL E+   I    I++   +++     S       ++F  S +     E  + +   +  ++EA++       +++ ++I+    N+ CADCG P P+W SINLCV++C  C+G HR L    S+++S  +D+++W ++ LIE+  ++GN   N FW  N   S  + PS         + +KY E K+     +  +  E+   L ++V T D+  T  L         F  D E     L +A  + Q LQ +FL
Sbjct:  217 YVAVVGDK--VQLYKNLEEYHLGIGITFIDMSVGNVKEVDRRSFDLTTPYRIF--SFSADSELEKEQWLEAMQGAIAEALST------SEVAERIWAAAPNRFCADCGAPQPDWASINLCVVICKRCAGEHRGLGAGVSKVRSLKMDRKVWTET-LIELFLQLGNGAGNRFWAANVPPSEALQPSSSPSTRRCHLEAKYREGKYRRYHPLFGNQEELDKALCAAVTTTDLAETQALLGCGAGINCFSGDPE-APTPLALAEQAGQTLQMEFL 476          

HSP 2 Score: 55.8398 bits (133), Expect = 4.507e-7
Identity = 41/171 (23.98%), Postives = 86/171 (50.29%), Query Frame = 3
Query: 2028 KMITFIITRGLKSEFIFRKVGAVRKINALYELIEKSPNDFFIDPNVYNVNDVASCLKKYFRSFNEPIITDSLFNLFCDACKLENTSSKLAQLEFTVSSMPEINYQVLRKTVELLYMIQKFADENKMDXXXXXXXXXXXXXXEDENHGEISTEILKDLIDYFETVFGYSPKE 2540
            + + +I   GL SE I+RK G   K   L E + +      +     +V+DV+S LK++ R   + + T +    + +A ++E+   K+++    +  +P +N   ++  +  LY +Q F+D N+M+  +LA+    ++   D      +  +++DLI+++  VF    +E
Sbjct:  736 RCVDYITQCGLTSEGIYRKCGQTSKTQRLLESLRQDARSVHLKEGEQHVDDVSSALKRFLRDLPDGLFTRAQRLTWLEASEIEDEEEKVSRYRELLVRLPPVNRATVKALISHLYCVQCFSDTNQMNVHNLAIVFGPTLFQTD-GQDYKAGRVVEDLINHYVVVFSVDEEE 905          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Human
Match: ARAP1 (ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 1 [Source:HGNC Symbol;Acc:HGNC:16925])

HSP 1 Score: 112.849 bits (281), Expect = 1.720e-24
Identity = 73/272 (26.84%), Postives = 131/272 (48.16%), Query Frame = 3
Query:  534 YILIRSDEYLLHIYENLVEHAQNICSHVINLKFYSLEXXXXXXXXXXXXLKLFGKSITFKIRFESSELVNEWKIILSEAINIAFMGGENKILKQIYTNESNKLCADCGYPNPEWVSINLCVILCINCSGLHRSLATSHSRIQSAILDQRIWEDSFLIEIMKKIGNENSNLFWYKNKQNSSTIFPSDLS-----EINSKYIEKKFIDTEFINLSDNEIKNRLRSSVATDDVFLTMKLYHSIK----FPYDSEFIKEILLIARNSNQYLQEKFL 1322
            Y+ +  D+  + +Y+NL E+   I    I++   +++     S       ++F  S +     E  + +   +  ++EA++       +++ ++I+    N+ CADCG P P+W SINLCV++C  C+G HR L    S+++S  +D+++W ++ LIE+  ++GN   N FW  N   S  + PS         + +KY E K+     +  +  E+   L ++V T D+  T  L         F  D E     L +A  + Q LQ +FL
Sbjct:  457 YVAVVGDK--VQLYKNLEEYHLGIGITFIDMSVGNVKEVDRRSFDLTTPYRIF--SFSADSELEKEQWLEAMQGAIAEALST------SEVAERIWAAAPNRFCADCGAPQPDWASINLCVVICKRCAGEHRGLGAGVSKVRSLKMDRKVWTET-LIELFLQLGNGAGNRFWAANVPPSEALQPSSSPSTRRCHLEAKYREGKYRRYHPLFGNQEELDKALCAAVTTTDLAETQALLGCGAGINCFSGDPE-APTPLALAEQAGQTLQMEFL 716          

HSP 2 Score: 55.4546 bits (132), Expect = 7.186e-7
Identity = 40/165 (24.24%), Postives = 84/165 (50.91%), Query Frame = 3
Query: 2028 KMITFIITRGLKSEFIFRKVGAVRKINALYELIEKSPNDFFIDPNVYNVNDVASCLKKYFRSFNEPIITDSLFNLFCDACKLENTSSKLAQLEFTVSSMPEINYQVLRKTVELLYMIQKFADENKMDXXXXXXXXXXXXXXEDENHGEISTEILKDLIDYFETVF 2522
            + + +I   GL SE I+RK G   K   L E + +      +     +V+DV+S LK++ R   + + T +    + +A ++E+   K+++    +  +P +N   ++  +  LY +Q F+D N+M+  +LA+    ++   D      +  +++DLI+++  VF
Sbjct:  976 RCVDYITQCGLTSEGIYRKCGQTSKTQRLLESLRQDARSVHLKEGEQHVDDVSSALKRFLRDLPDGLFTRAQRLTWLEASEIEDEEEKVSRYRELLVRLPPVNRATVKALISHLYCVQCFSDTNQMNVHNLAIVFGPTLFQTD-GQDYKAGRVVEDLINHYVVVF 1139          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Human
Match: ARAP1 (ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 1 [Source:HGNC Symbol;Acc:HGNC:16925])

HSP 1 Score: 112.849 bits (281), Expect = 1.787e-24
Identity = 73/272 (26.84%), Postives = 131/272 (48.16%), Query Frame = 3
Query:  534 YILIRSDEYLLHIYENLVEHAQNICSHVINLKFYSLEXXXXXXXXXXXXLKLFGKSITFKIRFESSELVNEWKIILSEAINIAFMGGENKILKQIYTNESNKLCADCGYPNPEWVSINLCVILCINCSGLHRSLATSHSRIQSAILDQRIWEDSFLIEIMKKIGNENSNLFWYKNKQNSSTIFPSDLS-----EINSKYIEKKFIDTEFINLSDNEIKNRLRSSVATDDVFLTMKLYHSIK----FPYDSEFIKEILLIARNSNQYLQEKFL 1322
            Y+ +  D+  + +Y+NL E+   I    I++   +++     S       ++F  S +     E  + +   +  ++EA++       +++ ++I+    N+ CADCG P P+W SINLCV++C  C+G HR L    S+++S  +D+++W ++ LIE+  ++GN   N FW  N   S  + PS         + +KY E K+     +  +  E+   L ++V T D+  T  L         F  D E     L +A  + Q LQ +FL
Sbjct:  457 YVAVVGDK--VQLYKNLEEYHLGIGITFIDMSVGNVKEVDRRSFDLTTPYRIF--SFSADSELEKEQWLEAMQGAIAEALST------SEVAERIWAAAPNRFCADCGAPQPDWASINLCVVICKRCAGEHRGLGAGVSKVRSLKMDRKVWTET-LIELFLQLGNGAGNRFWAANVPPSEALQPSSSPSTRRCHLEAKYREGKYRRYHPLFGNQEELDKALCAAVTTTDLAETQALLGCGAGINCFSGDPE-APTPLALAEQAGQTLQMEFL 716          

HSP 2 Score: 55.4546 bits (132), Expect = 6.897e-7
Identity = 40/165 (24.24%), Postives = 84/165 (50.91%), Query Frame = 3
Query: 2028 KMITFIITRGLKSEFIFRKVGAVRKINALYELIEKSPNDFFIDPNVYNVNDVASCLKKYFRSFNEPIITDSLFNLFCDACKLENTSSKLAQLEFTVSSMPEINYQVLRKTVELLYMIQKFADENKMDXXXXXXXXXXXXXXEDENHGEISTEILKDLIDYFETVF 2522
            + + +I   GL SE I+RK G   K   L E + +      +     +V+DV+S LK++ R   + + T +    + +A ++E+   K+++    +  +P +N   ++  +  LY +Q F+D N+M+  +LA+    ++   D      +  +++DLI+++  VF
Sbjct:  976 RCVDYITQCGLTSEGIYRKCGQTSKTQRLLESLRQDARSVHLKEGEQHVDDVSSALKRFLRDLPDGLFTRAQRLTWLEASEIEDEEEKVSRYRELLVRLPPVNRATVKALISHLYCVQCFSDTNQMNVHNLAIVFGPTLFQTD-GQDYKAGRVVEDLINHYVVVF 1139          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Human
Match: ARAP1 (ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 1 [Source:HGNC Symbol;Acc:HGNC:16925])

HSP 1 Score: 112.849 bits (281), Expect = 1.904e-24
Identity = 73/272 (26.84%), Postives = 131/272 (48.16%), Query Frame = 3
Query:  534 YILIRSDEYLLHIYENLVEHAQNICSHVINLKFYSLEXXXXXXXXXXXXLKLFGKSITFKIRFESSELVNEWKIILSEAINIAFMGGENKILKQIYTNESNKLCADCGYPNPEWVSINLCVILCINCSGLHRSLATSHSRIQSAILDQRIWEDSFLIEIMKKIGNENSNLFWYKNKQNSSTIFPSDLS-----EINSKYIEKKFIDTEFINLSDNEIKNRLRSSVATDDVFLTMKLYHSIK----FPYDSEFIKEILLIARNSNQYLQEKFL 1322
            Y+ +  D+  + +Y+NL E+   I    I++   +++     S       ++F  S +     E  + +   +  ++EA++       +++ ++I+    N+ CADCG P P+W SINLCV++C  C+G HR L    S+++S  +D+++W ++ LIE+  ++GN   N FW  N   S  + PS         + +KY E K+     +  +  E+   L ++V T D+  T  L         F  D E     L +A  + Q LQ +FL
Sbjct:  212 YVAVVGDK--VQLYKNLEEYHLGIGITFIDMSVGNVKEVDRRSFDLTTPYRIF--SFSADSELEKEQWLEAMQGAIAEALST------SEVAERIWAAAPNRFCADCGAPQPDWASINLCVVICKRCAGEHRGLGAGVSKVRSLKMDRKVWTET-LIELFLQLGNGAGNRFWAANVPPSEALQPSSSPSTRRCHLEAKYREGKYRRYHPLFGNQEELDKALCAAVTTTDLAETQALLGCGAGINCFSGDPE-APTPLALAEQAGQTLQMEFL 471          

HSP 2 Score: 55.8398 bits (133), Expect = 4.974e-7
Identity = 41/171 (23.98%), Postives = 86/171 (50.29%), Query Frame = 3
Query: 2028 KMITFIITRGLKSEFIFRKVGAVRKINALYELIEKSPNDFFIDPNVYNVNDVASCLKKYFRSFNEPIITDSLFNLFCDACKLENTSSKLAQLEFTVSSMPEINYQVLRKTVELLYMIQKFADENKMDXXXXXXXXXXXXXXEDENHGEISTEILKDLIDYFETVFGYSPKE 2540
            + + +I   GL SE I+RK G   K   L E + +      +     +V+DV+S LK++ R   + + T +    + +A ++E+   K+++    +  +P +N   ++  +  LY +Q F+D N+M+  +LA+    ++   D      +  +++DLI+++  VF    +E
Sbjct:  731 RCVDYITQCGLTSEGIYRKCGQTSKTQRLLESLRQDARSVHLKEGEQHVDDVSSALKRFLRDLPDGLFTRAQRLTWLEASEIEDEEEKVSRYRELLVRLPPVNRATVKALISHLYCVQCFSDTNQMNVHNLAIVFGPTLFQTD-GQDYKAGRVVEDLINHYVVVFSVDEEE 900          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Celegans
Match: cnt-1 (Arf-GAP with ANK repeat and PH domain-containing protein cnt-1 Truncated ctn-1 [Source:UniProtKB/Swiss-Prot;Acc:Q9XXH8])

HSP 1 Score: 85.8853 bits (211), Expect = 6.140e-17
Identity = 43/121 (35.54%), Postives = 68/121 (56.20%), Query Frame = 3
Query:  810 KQIYTNESNKLCADCGYPNPEWVSINLCVILCINCSGLHRSLATSHSRIQSAILDQRIWEDSFLIEIMKKIGNENSNLFWYKNKQNSSTIFPSDLSE----------INSKYIEKKFIDTE 1142
            +Q+     N++CADCG P P+WVSINL V+LCI CSG HRSL    S+++S  +D     D+ L +++  +GN   N  +  +   + +I P  ++E          I +KY+E++F   E
Sbjct:  200 EQVRRVPGNEVCADCGSPAPKWVSINLGVVLCIECSGAHRSLGVQTSKVRSLCMDSI---DNELRDVLLALGNRQVNEIFLAHLPPADSIVPPQINEKSARPAREAWIKAKYVERRFAVAE 317          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Celegans
Match: cnt-1 (Arf-GAP with ANK repeat and PH domain-containing protein cnt-1 Truncated ctn-1 [Source:UniProtKB/Swiss-Prot;Acc:Q9XXH8])

HSP 1 Score: 85.8853 bits (211), Expect = 8.720e-17
Identity = 43/121 (35.54%), Postives = 68/121 (56.20%), Query Frame = 3
Query:  810 KQIYTNESNKLCADCGYPNPEWVSINLCVILCINCSGLHRSLATSHSRIQSAILDQRIWEDSFLIEIMKKIGNENSNLFWYKNKQNSSTIFPSDLSE----------INSKYIEKKFIDTE 1142
            +Q+     N++CADCG P P+WVSINL V+LCI CSG HRSL    S+++S  +D     D+ L +++  +GN   N  +  +   + +I P  ++E          I +KY+E++F   E
Sbjct:  367 EQVRRVPGNEVCADCGSPAPKWVSINLGVVLCIECSGAHRSLGVQTSKVRSLCMDS---IDNELRDVLLALGNRQVNEIFLAHLPPADSIVPPQINEKSARPAREAWIKAKYVERRFAVAE 484          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Celegans
Match: cnt-1 (Arf-GAP with ANK repeat and PH domain-containing protein cnt-1 Truncated ctn-1 [Source:UniProtKB/Swiss-Prot;Acc:Q9XXH8])

HSP 1 Score: 85.8853 bits (211), Expect = 9.168e-17
Identity = 43/121 (35.54%), Postives = 68/121 (56.20%), Query Frame = 3
Query:  810 KQIYTNESNKLCADCGYPNPEWVSINLCVILCINCSGLHRSLATSHSRIQSAILDQRIWEDSFLIEIMKKIGNENSNLFWYKNKQNSSTIFPSDLSE----------INSKYIEKKFIDTE 1142
            +Q+     N++CADCG P P+WVSINL V+LCI CSG HRSL    S+++S  +D     D+ L +++  +GN   N  +  +   + +I P  ++E          I +KY+E++F   E
Sbjct:  451 EQVRRVPGNEVCADCGSPAPKWVSINLGVVLCIECSGAHRSLGVQTSKVRSLCMDSI---DNELRDVLLALGNRQVNEIFLAHLPPADSIVPPQINEKSARPAREAWIKAKYVERRFAVAE 568          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Celegans
Match: cnt-2 (Arf-GAP with ANK repeat and PH domain-containing protein cnt-2 [Source:UniProtKB/Swiss-Prot;Acc:Q9XX14])

HSP 1 Score: 85.5001 bits (210), Expect = 1.502e-16
Identity = 47/132 (35.61%), Postives = 72/132 (54.55%), Query Frame = 3
Query:  831 SNKLCADCGYPNPEWVSINLCVILCINCSGLHRSLATSHSRIQSAILDQRIWEDSFLIEIMKKIGNENSNLFW---YKNKQNSSTIFPSDLSEINSKYIEKKFIDTEFIN--LSDNEIKNRLRSSVATDDVF 1211
             N  CADCG P+ EW SINL +I+CI CSG+HR+L +  S+++   LDQ  W    L  +M+ IGN+ +N  W     N +   T  P    E   ++I++K++   F+    S   + ++L S+V   DV 
Sbjct:  599 GNGRCADCGNPSSEWASINLGIIICIECSGIHRNLGSHISKVRGLELDQ--WPVEHLA-VMQAIGNDKANEMWEFGLLNGERKPT--PESSREEKERFIDRKYVQKAFLKPIASGEPVTSQLISAVLARDVM 725          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Celegans
Match: cnt-2 (Arf-GAP with ANK repeat and PH domain-containing protein cnt-2 [Source:UniProtKB/Swiss-Prot;Acc:Q9XX14])

HSP 1 Score: 85.5001 bits (210), Expect = 1.510e-16
Identity = 47/132 (35.61%), Postives = 72/132 (54.55%), Query Frame = 3
Query:  831 SNKLCADCGYPNPEWVSINLCVILCINCSGLHRSLATSHSRIQSAILDQRIWEDSFLIEIMKKIGNENSNLFW---YKNKQNSSTIFPSDLSEINSKYIEKKFIDTEFIN--LSDNEIKNRLRSSVATDDVF 1211
             N  CADCG P+ EW SINL +I+CI CSG+HR+L +  S+++   LDQ  W    L  +M+ IGN+ +N  W     N +   T  P    E   ++I++K++   F+    S   + ++L S+V   DV 
Sbjct:  677 GNGRCADCGNPSSEWASINLGIIICIECSGIHRNLGSHISKVRGLELDQ--WPVEHLA-VMQAIGNDKANEMWEFGLLNGERKPT--PESSREEKERFIDRKYVQKAFLKPIASGEPVTSQLISAVLARDVM 803          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Fly
Match: CenG1A (gene:FBgn0028509 transcript:FBtr0080546)

HSP 1 Score: 82.0333 bits (201), Expect = 2.045e-15
Identity = 49/157 (31.21%), Postives = 74/157 (47.13%), Query Frame = 3
Query:  720 FES--SELVNEWKIILSEAINIAFMGGENKILKQIYTNE------------SNKLCADCGYPNPEWVSINLCVILCINCSGLHRSLATSHSRIQSAILDQRIWEDSFLIEIMKKIGNENSNLFWYKNKQNSSTIFPSDLSEINSKYIEKKFIDTEFI 1148
            FE+  SE  +EW   + + I  +    E+   KQ  + +             N  C DCG PNPEW S+NL V++CI CSG+HR+L +  S+++S  LD   W    L  +M  IGN  +N  W  N +           E   +++  K+   EF+
Sbjct:  662 FEAANSEERDEWVAAVEQEIFKSLQSIESSKTKQATSTDLAAMLAIRQRVPGNGFCVDCGAPNPEWASLNLGVLMCIECSGVHRNLGSHISKVRSLGLDD--WPSPHL-SVMLAIGNSLANSVWESNTRQRVKPTSQASREDKERWVRSKYEAKEFL 815          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Fly
Match: CenG1A (gene:FBgn0028509 transcript:FBtr0080547)

HSP 1 Score: 82.0333 bits (201), Expect = 2.291e-15
Identity = 49/157 (31.21%), Postives = 74/157 (47.13%), Query Frame = 3
Query:  720 FES--SELVNEWKIILSEAINIAFMGGENKILKQIYTNE------------SNKLCADCGYPNPEWVSINLCVILCINCSGLHRSLATSHSRIQSAILDQRIWEDSFLIEIMKKIGNENSNLFWYKNKQNSSTIFPSDLSEINSKYIEKKFIDTEFI 1148
            FE+  SE  +EW   + + I  +    E+   KQ  + +             N  C DCG PNPEW S+NL V++CI CSG+HR+L +  S+++S  LD   W    L  +M  IGN  +N  W  N +           E   +++  K+   EF+
Sbjct:  594 FEAANSEERDEWVAAVEQEIFKSLQSIESSKTKQATSTDLAAMLAIRQRVPGNGFCVDCGAPNPEWASLNLGVLMCIECSGVHRNLGSHISKVRSLGLDD--WPSPHL-SVMLAIGNSLANSVWESNTRQRVKPTSQASREDKERWVRSKYEAKEFL 747          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Fly
Match: CenG1A (gene:FBgn0028509 transcript:FBtr0080548)

HSP 1 Score: 81.6481 bits (200), Expect = 2.334e-15
Identity = 49/157 (31.21%), Postives = 74/157 (47.13%), Query Frame = 3
Query:  720 FES--SELVNEWKIILSEAINIAFMGGENKILKQIYTNE------------SNKLCADCGYPNPEWVSINLCVILCINCSGLHRSLATSHSRIQSAILDQRIWEDSFLIEIMKKIGNENSNLFWYKNKQNSSTIFPSDLSEINSKYIEKKFIDTEFI 1148
            FE+  SE  +EW   + + I  +    E+   KQ  + +             N  C DCG PNPEW S+NL V++CI CSG+HR+L +  S+++S  LD   W    L  +M  IGN  +N  W  N +           E   +++  K+   EF+
Sbjct:  430 FEAANSEERDEWVAAVEQEIFKSLQSIESSKTKQATSTDLAAMLAIRQRVPGNGFCVDCGAPNPEWASLNLGVLMCIECSGVHRNLGSHISKVRSLGLDD--WPSPHL-SVMLAIGNSLANSVWESNTRQRVKPTSQASREDKERWVRSKYEAKEFL 583          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Fly
Match: CenB1A (gene:FBgn0039056 transcript:FBtr0084368)

HSP 1 Score: 77.0258 bits (188), Expect = 6.997e-14
Identity = 40/109 (36.70%), Postives = 62/109 (56.88%), Query Frame = 3
Query:  831 SNKLCADCGYPNPEWVSINLCVILCINCSGLHRSLATSHSRIQSAILDQRIWEDSFLIEIMKKIGNENSN-LFWYKNKQNSSTIFPSDLSEIN-------SKYIEKKFI 1133
             N  C DC  P P W SINL + LCI CSG+HRSL   +S+++S  LD   WE S  +++M ++GNE  N ++  +   +     P++  EI        +KY+E++F+
Sbjct:  392 GNAYCCDCRSPEPRWASINLGITLCIECSGVHRSLGVHYSKVRSLTLD--AWE-SENVKVMMELGNEVVNRIYEARIGDDCGLKKPTEQCEIGVREAWIKAKYVERRFV 497          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Fly
Match: CenB1A (gene:FBgn0039056 transcript:FBtr0084369)

HSP 1 Score: 76.2554 bits (186), Expect = 8.808e-14
Identity = 40/109 (36.70%), Postives = 62/109 (56.88%), Query Frame = 3
Query:  831 SNKLCADCGYPNPEWVSINLCVILCINCSGLHRSLATSHSRIQSAILDQRIWEDSFLIEIMKKIGNENSN-LFWYKNKQNSSTIFPSDLSEIN-------SKYIEKKFI 1133
             N  C DC  P P W SINL + LCI CSG+HRSL   +S+++S  LD   WE S  +++M ++GNE  N ++  +   +     P++  EI        +KY+E++F+
Sbjct:  162 GNAYCCDCRSPEPRWASINLGITLCIECSGVHRSLGVHYSKVRSLTLD--AWE-SENVKVMMELGNEVVNRIYEARIGDDCGLKKPTEQCEIGVREAWIKAKYVERRFV 267          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Zebrafish
Match: CR387919.1 (zmp:0000000660 [Source:NCBI gene;Acc:559690])

HSP 1 Score: 104.76 bits (260), Expect = 3.716e-22
Identity = 70/217 (32.26%), Postives = 111/217 (51.15%), Query Frame = 3
Query:  696 KSITFKIRFESSELVNEWKIILSEAINIAFMGGENKILKQIYTNESNKLCADCGYPNPEWVSINLCVILCINCSGLHRSLATSHSRIQSAILDQRIWEDSFLIEIMKKIGNENSNLFWYKNKQNSSTIFPSDLSEINSKYIEKKFIDTEFINL-----SDNEIKNRLRSSVATDDVFLTMKLYHS---IKFPYDSEFIKEILLIARNSNQYLQEKFL 1322
            KS  F +  ES    +EW   + E+I       E  +L++++ N+SN+ CADC  P PEW SINLCV++C NC+G HR L    S+++S  LD  IW +  LIE+  ++GN+NSN  W  N      +     +E  + +I +K+   ++  +     +  E+   L ++V   DV  TM L  S   +        +    L+A+ + Q LQ +FL
Sbjct:  586 KSFCFTV--ESEHERDEWIEAVQESIVETLCNYE--VLEKVWFNKSNRKCADCQAPEPEWASINLCVVICKNCAGQHRFLGPGISKVRSMKLDSSIWTNE-LIELFLEVGNKNSNSLWVANLPPEDELCKQSSTEQRASFIRRKYKKRKYKKVLNGLNTQEELNKALCAAVVLPDVLQTMALVFSGADVMCATGDPELSTPYLLAQKAGQRLQMEFL 797          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Zebrafish
Match: CR387919.1 (zmp:0000000660 [Source:NCBI gene;Acc:559690])

HSP 1 Score: 104.76 bits (260), Expect = 3.716e-22
Identity = 70/217 (32.26%), Postives = 111/217 (51.15%), Query Frame = 3
Query:  696 KSITFKIRFESSELVNEWKIILSEAINIAFMGGENKILKQIYTNESNKLCADCGYPNPEWVSINLCVILCINCSGLHRSLATSHSRIQSAILDQRIWEDSFLIEIMKKIGNENSNLFWYKNKQNSSTIFPSDLSEINSKYIEKKFIDTEFINL-----SDNEIKNRLRSSVATDDVFLTMKLYHS---IKFPYDSEFIKEILLIARNSNQYLQEKFL 1322
            KS  F +  ES    +EW   + E+I       E  +L++++ N+SN+ CADC  P PEW SINLCV++C NC+G HR L    S+++S  LD  IW +  LIE+  ++GN+NSN  W  N      +     +E  + +I +K+   ++  +     +  E+   L ++V   DV  TM L  S   +        +    L+A+ + Q LQ +FL
Sbjct:  586 KSFCFTV--ESEHERDEWIEAVQESIVETLCNYE--VLEKVWFNKSNRKCADCQAPEPEWASINLCVVICKNCAGQHRFLGPGISKVRSMKLDSSIWTNE-LIELFLEVGNKNSNSLWVANLPPEDELCKQSSTEQRASFIRRKYKKRKYKKVLNGLNTQEELNKALCAAVVLPDVLQTMALVFSGADVMCATGDPELSTPYLLAQKAGQRLQMEFL 797          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Zebrafish
Match: FO704810.1 (arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like [Source:NCBI gene;Acc:100005008])

HSP 1 Score: 97.4413 bits (241), Expect = 5.136e-20
Identity = 68/250 (27.20%), Postives = 121/250 (48.40%), Query Frame = 3
Query:  705 TFKIRFESSELVNEWKIILSEAINIAFMGGENKILKQIYTNESNKLCADCGYPNPEWVSINLCVILCINCSGLHRSLATSHSRIQSAILDQRIWEDSFLIEIMKKIGNENSNLFWYKN----KQNSSTIFPSDLSE-INSKYIEKKFIDTEFINLSDNEIKNRLRSSVATDDVFLTMKLYHS---IKFPYDSEFIKEILLIARNSNQYLQEKFLSVQPDLSNSIQDQTIIKDKIFKISYNNEEKLADLFS 1430
            TF    +SS+  + W   L++ I  A    E  +  +++++  NK+CADCG  NPEW S+NL V++C  C+G HRS+ +S S+++   LD ++W +  LI++    GN+ +N  W  N    +Q S    P   +E I +KY +  +     +  S   +  RLR  V    V  T+ L  S   +        +K  + +A ++ Q LQ + L          +    ++   F+ + ++EE++ +L  
Sbjct:  357 TFNFSADSSKEASAWLESLNDVIRNALSYSE--VALRLWSSPCNKVCADCGAANPEWASVNLLVVICEACAGAHRSMGSSRSKVRGLKLDDKVWTEP-LIQLFVLHGNKTANNVWGHNIPPTEQISPLASPDQRAEFILAKYHKGLYRKAHPLAASQKLLDQRLREVVCGPAVEETVSLLCSGAKVSCSSSDPELKSAIAVAESAGQALQTELL----------RHNEFVEAPDFEQTRHSEEQMEELHG 593          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Zebrafish
Match: arap3 (ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 3 [Source:ZFIN;Acc:ZDB-GENE-091019-1])

HSP 1 Score: 97.4413 bits (241), Expect = 6.930e-20
Identity = 49/147 (33.33%), Postives = 81/147 (55.10%), Query Frame = 3
Query:  705 TFKIRFESSELVNEWKIILSEAINIAFMGGENKILKQIYTNESNKLCADCGYPNPEWVSINLCVILCINCSGLHRSLATSHSRIQSAILDQRIWEDSFLIEIMKKIGNENSNLFWYKNKQNSSTIFPSDLSEINSKYIEKKFIDTEF 1145
            TF    E+     +W   L E+I  A    + ++ ++I++N SNK+CADC   NP+W SINLCV++C NC+G HR L T  S++QS  LD  +W +  ++++   +GN+ +N FW      S  +      E   ++I  K+ +  +
Sbjct:  608 TFSFTAETDREKRDWMEALQESI--AETLSDYEVAEKIWSNRSNKICADCKAINPDWASINLCVVICKNCAGQHRGLGTMVSKVQSLKLDTSVWSNE-IVQLFIMLGNDRANEFWAARLPVSEELDCDATPEQRREFISHKYKEGRY 751          

HSP 2 Score: 72.4034 bits (176), Expect = 3.265e-12
Identity = 59/200 (29.50%), Postives = 96/200 (48.00%), Query Frame = 3
Query: 1953 GSQNLVYNYLNLFTNQRPIMFNPIDKMITFIITRGLKSEFIFRKVGAVRKINALYELIEKSPNDFFIDPNVYNVNDVASCLKKYFRSFNEPIITDSLFNLFCDACKLENTSSKLAQLEFTVSSMPEINYQVLRKTVELLYMIQKFADENKMDXXXXXXXXXXXXXXEDENHGEISTEILKDLIDYFETVFGYSPKERTAL 2552
            G +        L  N  PI+   +D  I FI   GL  E I+RK GA  +I  L E   K   +  +      + DV   LK++FR  ++PI    L   + +A K+   + +L + +  +  +P +N   L   +  LY +QK AD N+M +K+L+L  A S+   D   GE   +I++DLID +  +F    + +T +
Sbjct: 1047 GGKGNTLKDQQLSRNDIPII---VDSCIAFITQYGLGHEGIYRKNGAKSRIKLLMEEFRKDARNVKLRIGDNFIEDVTDVLKRFFREIDDPIFMADLHPFWKEAAKIPLKTQRLDRYKELIRGLPRVNRTTLAALISHLYRVQKCADLNQMCTKNLSLLFAPSLFQTD-GKGEHEVKIIEDLIDNYLYIFDVDEEHQTQI 1242          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Zebrafish
Match: arap1a (ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 1a [Source:ZFIN;Acc:ZDB-GENE-030131-6226])

HSP 1 Score: 93.9745 bits (232), Expect = 6.132e-19
Identity = 48/150 (32.00%), Postives = 85/150 (56.67%), Query Frame = 3
Query:  696 KSITFKIRFESSELVNEWKIILSEAINIAFMGGENKILKQIYTNESNKLCADCGYPNPEWVSINLCVILCINCSGLHRSLATSHSRIQSAILDQRIWEDSFLIEIMKKIGNENSNLFWYKNKQNSSTIFPSDLSEINSKYIEKKFIDTEF 1145
            ++ +F +  ES +    W   L+E ++ +     + + + ++  ++N++CADC    PEW S+NLCV+LC  C+G HR+L  + S+++S  LD+R+W D  LI +   +GN  +N FW  N   S  +  S  SE   K+I  K+ + ++
Sbjct:  232 RAFSFMVDSESEK--QRWCESLTECVSRSLSC--DGVCESVWRVQANRICADCSSSMPEWASVNLCVLLCEKCAGAHRNLGQNISKVRSLKLDERVWTDD-LIRVFLMLGNGKANKFWGANIPPSERLSASANSEQRLKHITDKYKNGKY 376          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Xenopus
Match: ccn4 (cellular communication network factor 4 [Source:Xenbase;Acc:XB-GENE-484776])

HSP 1 Score: 108.997 bits (271), Expect = 1.277e-23
Identity = 85/273 (31.14%), Postives = 133/273 (48.72%), Query Frame = 3
Query:  708 FKIRFESSELVNEWKIILSEAINIAFMGGENKILKQIYTNESNKLCADCGYPNPEWVSINLCVILCINCSGLHRSLATSHSRIQSAILDQRIWEDSFLIEIMKKIGNENSNLFWYKNKQNSSTI-FPSDLSE----INSKYIEKKFIDTEFINLSDNEIKNRLRSSVATDDVFLTMKLYHS---IKFPYDSEFIKEILLIARNSNQYLQEKFLSVQ----PDLSNSIQDQTIIKDKIFKISYNNEEKLADLFSVSLLCTCISINIEELLTPAI 1490
            F +  ES     EW   + ++I  A    + ++ ++I+ NESN+ CADC  P+P+W SI+L V++C NC+G HR+L ++ S++ S ILD  IW +  L+E+   +GNE  N  W  N    + +   S++S+    I  KY E +F    F   +  E+   L  +V  D++  TM L  S      P   +      L+A+ S Q LQ +FL       P++    Q    I++   K   N    +AD   V  L   IS+N     TPA+
Sbjct:  131 FSLTAESEREKQEWTEEIQQSI--AETLADYEVAEKIWFNESNRSCADCRAPSPDWASISLGVVICKNCAGQHRALGSNISKVHSLILDTTIWSNE-LVELFIVVGNEKVNNIWEANLLPENMLHMDSNVSQRRLFITQKYKEGRFKKIYFPGFTQEELNQALCDAVTKDEILQTMILVFSGADTMCPTGDKVYNTPYLLAKMSGQRLQMEFLHHNRLSVPEMK---QWWCTIENNFLKYYENETAPVAD--GVIDLSEIISLN----FTPAV 391          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Xenopus
Match: itgav (integrin subunit alpha V [Source:Xenbase;Acc:XB-GENE-488969])

HSP 1 Score: 89.3521 bits (220), Expect = 2.523e-17
Identity = 72/306 (23.53%), Postives = 140/306 (45.75%), Query Frame = 3
Query:  261 LIIFKNSNDIISSKRLPINKSIRLQYIDNSNQFLILLGNFQYLFMHSDASIIKNWVNKINTLLLNYEDLQLNYFKYAEVRIDSNEASNVSSYI-----------LIRSDEYLLHIYENLVEHAQNICSHVINLKFYSLEXXXXXXXXXXXXLKLFGKSITFKIRFESSELVNEWKIILSEAINIAFMGGENKILKQIYTNESNKLCADCGYPNPEWVSINLCVILCINCSGLHRSLATSHSRIQSAILDQRIWEDSFLIEIMKKIGNENSNLFWYKNKQNSSTIFPSDLSEINSKYIEKKFIDTEF 1145
            L+ F N  ++     +P++ SI +      N+F ++  +  ++F   +      W   I   +  +  +      +  +R+  + +   S Y+           ++ +DE  +H  E L +    I   VI +   ++ + R+ +       K+F          ES     EW   L E I+ +    + ++ ++I++N+SNK+CADC        SINLCV++C  C+G+HRSL T+ S++QS  LD  IW +  ++++   +GN+ +N FW      S  +   D  E    +I +K+ + ++
Sbjct:  287 LMYFSNDKELYPKGVIPLS-SIEMARSTKENKFEVVTKHRTFVFRAENEVQRNEWCATIQNRVKEHRMV------FPRLRLGCSSSCQRSGYLELKGYKSKIFAVLTTDELWIHKNEQLFK--MGIGMFVIGMHGCTIRDVRNKNFELVTMQKIFS------FTAESEREKKEWMEALLECISESL--SDYEVAEKIWSNKSNKICADCR------ASINLCVVICKQCAGVHRSLGTNISKVQSLKLDTSIWSNE-IVQLFIILGNDKANRFWAAKLLPSEMLHTDDPVERRRNFITQKYREGKY 568          

HSP 2 Score: 72.7886 bits (177), Expect = 3.293e-12
Identity = 56/180 (31.11%), Postives = 92/180 (51.11%), Query Frame = 3
Query: 1983 NLFTNQRPIMFNPIDKMITFIITRGLKSEFIFRKVGAVRKINALYELIEKSPNDFFIDPNVYNVNDVASCLKKYFRSFNEPIITDSLFNLFCDACKLENTSSKLAQLEFTVSSMPEINYQVLRKTVELLYMIQKFADENKMDXXXXXXXXXXXXXXEDENHGEISTEILKDLIDYFETVF 2522
             L  N  PI+   +D  I F+   GL+ E I+RK GA  +I  L +   K   +  +  +   + DV   LK++FR  ++PI T  L   + +A      S +L +    ++ +P +N   L   +  LY +QK AD N+M +K+LAL  A S+   D   GE   ++++D+ID + +VF
Sbjct:  785 QLSRNDIPII---VDSCIAFLTQYGLRHEGIYRKNGAKSRIKLLMDEFRKDARNVKLRISDNFIEDVTDVLKRFFRELDDPIFTTELHPQWKEAADNPEKSKRLEKYMELINHLPRVNRATLAALIGHLYRVQKCADLNQMCTKNLALLFAPSLFQTD-GKGEHEVKVMEDIIDNYASVF 960          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Xenopus
Match: itgav (integrin subunit alpha V [Source:Xenbase;Acc:XB-GENE-488969])

HSP 1 Score: 89.3521 bits (220), Expect = 2.673e-17
Identity = 72/306 (23.53%), Postives = 141/306 (46.08%), Query Frame = 3
Query:  261 LIIFKNSNDIISSKRLPINKSIRLQYIDNSNQFLILLGNFQYLFMHSDASIIKNWVNKINTLLLNYEDLQLNYFKYAEVRIDSNEASNVSSYI-----------LIRSDEYLLHIYENLVEHAQNICSHVINLKFYSLEXXXXXXXXXXXXLKLFGKSITFKIRFESSELVNEWKIILSEAINIAFMGGENKILKQIYTNESNKLCADCGYPNPEWVSINLCVILCINCSGLHRSLATSHSRIQSAILDQRIWEDSFLIEIMKKIGNENSNLFWYKNKQNSSTIFPSDLSEINSKYIEKKFIDTEF 1145
            L+ F N  ++     +P++ SI +      N+F ++  +  ++F   +      W   I   +  +  +      +  +R+  + +   S Y+           ++ +DE  +H  E L +    I   VI +   ++ + R+ +       K+F  +       ES     EW   L E I+ +    + ++ ++I++N+SNK+CADC        SINLCV++C  C+G+HRSL T+ S++QS  LD  IW +  ++++   +GN+ +N FW      S  +   D  E    +I +K+ + ++
Sbjct:  152 LMYFSNDKELYPKGVIPLS-SIEMARSTKENKFEVVTKHRTFVFRAENEVQRNEWCATIQNRVKEHRMV------FPRLRLGCSSSCQRSGYLELKGYKSKIFAVLTTDELWIHKNEQLFK--MGIGMFVIGMHGCTIRDVRNKNFELVTMQKIFSFTA------ESEREKKEWMEALLECISESL--SDYEVAEKIWSNKSNKICADCR------ASINLCVVICKQCAGVHRSLGTNISKVQSLKLDTSIWSNE-IVQLFIILGNDKANRFWAAKLLPSEMLHTDDPVERRRNFITQKYREGKY 433          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Xenopus
Match: itgav (integrin subunit alpha V [Source:Xenbase;Acc:XB-GENE-488969])

HSP 1 Score: 89.3521 bits (220), Expect = 2.818e-17
Identity = 72/306 (23.53%), Postives = 141/306 (46.08%), Query Frame = 3
Query:  261 LIIFKNSNDIISSKRLPINKSIRLQYIDNSNQFLILLGNFQYLFMHSDASIIKNWVNKINTLLLNYEDLQLNYFKYAEVRIDSNEASNVSSYI-----------LIRSDEYLLHIYENLVEHAQNICSHVINLKFYSLEXXXXXXXXXXXXLKLFGKSITFKIRFESSELVNEWKIILSEAINIAFMGGENKILKQIYTNESNKLCADCGYPNPEWVSINLCVILCINCSGLHRSLATSHSRIQSAILDQRIWEDSFLIEIMKKIGNENSNLFWYKNKQNSSTIFPSDLSEINSKYIEKKFIDTEF 1145
            L+ F N  ++     +P++ SI +      N+F ++  +  ++F   +      W   I   +  +  +      +  +R+  + +   S Y+           ++ +DE  +H  E L +    I   VI +   ++ + R+ +       K+F  +       ES     EW   L E I+ +    + ++ ++I++N+SNK+CADC        SINLCV++C  C+G+HRSL T+ S++QS  LD  IW +  ++++   +GN+ +N FW      S  +   D  E    +I +K+ + ++
Sbjct:  335 LMYFSNDKELYPKGVIPLS-SIEMARSTKENKFEVVTKHRTFVFRAENEVQRNEWCATIQNRVKEHRMV------FPRLRLGCSSSCQRSGYLELKGYKSKIFAVLTTDELWIHKNEQLFK--MGIGMFVIGMHGCTIRDVRNKNFELVTMQKIFSFTA------ESEREKKEWMEALLECISESL--SDYEVAEKIWSNKSNKICADCR------ASINLCVVICKQCAGVHRSLGTNISKVQSLKLDTSIWSNE-IVQLFIILGNDKANRFWAAKLLPSEMLHTDDPVERRRNFITQKYREGKY 616          

HSP 2 Score: 70.0922 bits (170), Expect = 2.159e-11
Identity = 56/180 (31.11%), Postives = 93/180 (51.67%), Query Frame = 3
Query: 1983 NLFTNQRPIMFNPIDKMITFIITRGLKSEFIFRKVGAVRKINALYELIEKSPNDFFIDPNVYNVNDVASCLKKYFRSFNEPIITDSLFNLFCDACKLENTSSKLAQLEFTVSSMPEINYQVLRKTVELLYMIQKFADENKMDXXXXXXXXXXXXXXEDENHGEISTEILKDLIDYFETVF 2522
             L  N  PI+   +D  I F+   GL+ E I+RK GA  +I  L +   K   +  +  +   + DV   LK++FR  ++PI T  L   + +A +    S +L +    ++ +P +N   L   +  LY +QK AD N+M +K+LAL  A S+   D   GE   ++++D+ID + +VF
Sbjct:  913 QLSRNDIPII---VDSCIAFLTQYGLRHEGIYRKNGAKSRIKLLMDEFRKDARNVKLRISDNFIEDVTDVLKRFFRELDDPIFTTELHPQWKEAAE---KSKRLEKYMELINHLPRVNRATLAALIGHLYRVQKCADLNQMCTKNLALLFAPSLFQTD-GKGEHEVKVMEDIIDNYASVF 1085          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Xenopus
Match: ikzf2 (IKAROS family zinc finger 2 [Source:Xenbase;Acc:XB-GENE-1013632])

HSP 1 Score: 88.5817 bits (218), Expect = 3.002e-17
Identity = 63/188 (33.51%), Postives = 96/188 (51.06%), Query Frame = 3
Query:  729 SELVNEWKIILS----EAINIAFMG----GENKILKQ--------IYTNESNKLCADCGYPNPEWVSINLCVILCINCSGLHRSLATSHSRIQSAILDQRIWEDSFLIEIMKKIGNENSNLFWYKNKQNSSTIFPSDLSEINSK--YIEKKFIDTEFINLS--DNEIK-NRLRSSVATDDVFLTMKLY 1229
            +E   EW  +L     EA+N AF G    GEN I+++        I     N +C DCG  +P W+S NL ++ CI CSG+HR L   +SRIQS  LD  +   S L+ + K IGN   N           ++ PS  S++N++  YI  K+I+ ++      DN  K + L  +V + D+F  ++L+
Sbjct:  350 AEDETEWMSVLQNSKEEALNNAFKGDHSAGENNIVQELTKEIISDIQRMPGNDVCCDCGASDPTWLSTNLGILTCIECSGIHRELGVHYSRIQSLTLD--VLGTSELL-LAKNIGNSGFNELMEACLPADDSVKPSPCSDMNARKDYITTKYIERKYARRKYHDNASKLHGLCDAVKSRDIFTLVQLH 534          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Mouse
Match: Arap2 (ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 2 [Source:MGI Symbol;Acc:MGI:2684416])

HSP 1 Score: 115.161 bits (287), Expect = 2.627e-25
Identity = 73/214 (34.11%), Postives = 108/214 (50.47%), Query Frame = 3
Query:  705 TFKIRFESSELVNEWKIILSEAINIAFMGGENKILKQIYTNESNKLCADCGYPNPEWVSINLCVILCINCSGLHRSLATSHSRIQSAILDQRIWEDSFLIEIMKKIGNENSNLFWYKNKQNSSTIFPSDLSE-----INSKYIEKKFIDTEFINLSDNEIKNRLRSSVATDDVFLTMKLYHS---IKFPYDSEFIKEILLIARNSNQYLQEKFL 1322
            +F    +S     EW  I +   +IA    + ++ ++I+ NESN+ CADC  P+P+W SINLCV++C  C+G HRSL    S+++S  +D  IW +  LIE+   IGN+ +N FW  N Q    +      E     I  KY E KF  T   +L+  E+   L ++V   DV  TM L  S   +             L+A+ + Q LQ +FL
Sbjct:  654 SFSFTADSEREKQEW--IEAVQQSIAETLSDYEVAEKIWFNESNRSCADCKAPDPDWASINLCVVICKKCAGQHRSLGPKDSKVRSLKMDASIWSNE-LIELFIVIGNKRANDFWAGNLQKDEELQVDSPVEKRKNFITQKYKEGKFRKTLLASLTKEELNKALCAAVVKPDVLETMALLFSGADVMCATGDPVHSTPYLLAKKAGQSLQMEFL 864          

HSP 2 Score: 56.9954 bits (136), Expect = 1.606e-7
Identity = 34/142 (23.94%), Postives = 65/142 (45.77%), Query Frame = 3
Query: 1983 NLFTNQRPIMFNPIDKMITFIITRGLKSEFIFRKVGAVRKINALYELIEKSPNDFFIDPNVYNVNDVASCLKKYFRSFNEPIITDSLFNLFCDACKLENTSSKLAQLEFTVSSMPEINYQVLRKTVELLYMIQKFADENKMD 2408
             L  N  PI+ N     I F+   GL  ++I++K G    I+ L E  +K      +    + + DV   LK +    ++ ++T  L+  +  A   ++   + ++    + S+P +N   L   +E LY +QK ++ N M+
Sbjct: 1120 QLCKNDVPIIVN---SCIAFVTQYGLGCKYIYQKDGDPLHISELLESFKKDARSVKLRAGKHQLEDVTGVLKSFLSDIDDALLTKELYPYWVSALDTQDEKERTSKYRAFIRSLPGVNRATLAALIEHLYRVQKCSEINHMN 1258          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Mouse
Match: Arap1 (ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 1 [Source:MGI Symbol;Acc:MGI:1916960])

HSP 1 Score: 105.145 bits (261), Expect = 2.484e-22
Identity = 85/374 (22.73%), Postives = 167/374 (44.65%), Query Frame = 3
Query:  261 LIIFKNSNDIISSKRLPINKSIRLQYIDNSNQFLILLGNFQYLFMHSDASIIKN-WVNKINTLLLNYED-LQLNYFKYAEVRIDSNEASNVSS----------YILIRSDEYLLHIYENLVEHAQNICSHVINLKFYSLEXXXXXXXXXXXXLKLFGKSITFKIRFESSELVNEWKIILSEAINIAFMGGENKILKQIYTNESNKLCADCGYPNPEWVSINLCVILCINCSGLHRSLATSHSRIQSAILDQRIWEDSFLIEIMKKIGNENSNLFWYKNKQNSSTIFPSDLS-----EINSKYIEKKFIDTEFINLSDNEIKNRLRSSVATDDVFLTMKLYH---SIKFPYDSEFIKEILLIARNSNQYLQEKFL 1322
            L  F ++ D  S + +P+    R+  I +  +F ++  N  + F  +++ + +N W+  +   ++ +    +L+      VR  S +     S          Y+ +  D+  + +Y+NL E    I    I++   +++     S       ++F  S +     E  + +   +  ++EA++       +++ ++I+    N+ CADCG   P+W SINLCV++C  C+G HR L    S+++S  +D+++W ++ LI++   +GN   N FW  N   S  + PS         + +KY E K+     +  +  E+   L ++V T D+  T  L      +            L +A  + Q LQ +FL
Sbjct:  111 LRYFDSNKDAYSKRFVPVACICRVAPIGD-QKFEVITNNRTFAF-RAESDVERNEWMQALQQAVVEHRARFRLSSASVLGVR-GSEQPDRAGSLELRGFKNKLYVAVTGDK--VQLYKNLEEFHLGIGITFIDMNVGNVKEVDRRSFDLTTPYRIF--SFSADSELEKEQWLEAMQGAIAEALST------SEVAERIWAAAPNRFCADCGAAQPDWASINLCVVICKRCAGEHRGLGAGVSKVRSLKMDRKVWTEA-LIQLFLHLGNGPGNHFWAANVPPSEALEPSSSPGARRYHLEAKYREGKYRRYHPLFGNQEELDKALCAAVTTTDLAETQALLGCGAGVSCFSGDPAAPTPLALAEQAGQTLQMEFL 470          

HSP 2 Score: 55.4546 bits (132), Expect = 4.915e-7
Identity = 40/171 (23.39%), Postives = 88/171 (51.46%), Query Frame = 3
Query: 2028 KMITFIITRGLKSEFIFRKVGAVRKINALYELIEKSPNDFFIDPNVYNVNDVASCLKKYFRSFNEPIITDSLFNLFCDACKLENTSSKLAQLEFTVSSMPEINYQVLRKTVELLYMIQKFADENKMDXXXXXXXXXXXXXXEDENHGEISTEILKDLIDYFETVFGYSPKE 2540
            + + +I   GL SE I+RK G   K   L + + +      +     +V+DV+S LK++ R   + + T +    + +A ++E+   K+++    +  +P +N   ++  +  LY +Q F+D N+M++ +LA+    ++   D      + ++++DLI+++  VF    +E
Sbjct:  730 RCVDYITQCGLTSEGIYRKCGQTSKTQRLLDSLRQDARSVHLKEGEQHVDDVSSALKRFLRDLPDGLFTRAQRLAWLEASEIEDEEEKISRYRELLVHLPPVNRATVKALISHLYCVQCFSDTNQMNTHNLAIVFGPTLFQTD-GQDYKAGKVVEDLINHYVVVFSVDEEE 899          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Mouse
Match: Arap1 (ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 1 [Source:MGI Symbol;Acc:MGI:1916960])

HSP 1 Score: 105.531 bits (262), Expect = 2.544e-22
Identity = 87/375 (23.20%), Postives = 168/375 (44.80%), Query Frame = 3
Query:  261 LIIFKNSNDIISSKRLPINKSIRLQYIDNSNQFLILLGNFQYLFMHSDASIIKN-WVNKINTLLLNYED-LQLNYFKYAEVRIDSNEASNVSS----------YILIRSDEYLLHIYENLVEHAQNICSHVINLKFYSLEXXXXXXXXXXXXLKLFGKSITFKIRFESSELVNEWKIILSEAINIAFMGGENKILKQIYTNESNKLCADCGYPNPEWVSINLCVILCINCSGLHRSLATSHSRIQSAILDQRIWEDSFLIEIMKKIGNENSNLFWYKNKQNSSTIFPSDLS-----EINSKYIEKKFIDTEFINLSDNEIKNRLRSSVATDDVFLTMKLYHSIK----FPYDSEFIKEILLIARNSNQYLQEKFL 1322
            L  F ++ D  S + +P+    R+  I +  +F ++  N  + F  +++ + +N W+  +   ++ +    +L+      VR  S +     S          Y+ +  D+  + +Y+NL E    I    I++   +++     S       ++F  S +     E  + +   +  ++EA++       +++ ++I+    N+ CADCG   P+W SINLCV++C  C+G HR L    S+++S  +D+++W ++ LI++   +GN   N FW  N   S  + PS         + +KY E K+     +  +  E+   L ++V T D+  T  L         F  D       L +A  + Q LQ +FL
Sbjct:  359 LRYFDSNKDAYSKRFVPVACICRVAPIGD-QKFEVITNNRTFAF-RAESDVERNEWMQALQQAVVEHRARFRLSSASVLGVR-GSEQPDRAGSLELRGFKNKLYVAVTGDK--VQLYKNLEEFHLGIGITFIDMNVGNVKEVDRRSFDLTTPYRIF--SFSADSELEKEQWLEAMQGAIAEALST------SEVAERIWAAAPNRFCADCGAAQPDWASINLCVVICKRCAGEHRGLGAGVSKVRSLKMDRKVWTEA-LIQLFLHLGNGPGNHFWAANVPPSEALEPSSSPGARRYHLEAKYREGKYRRYHPLFGNQEELDKALCAAVTTTDLAETQALLGCGAGVSCFSGDPA-APTPLALAEQAGQTLQMEFL 718          

HSP 2 Score: 54.6842 bits (130), Expect = 7.992e-7
Identity = 39/165 (23.64%), Postives = 86/165 (52.12%), Query Frame = 3
Query: 2028 KMITFIITRGLKSEFIFRKVGAVRKINALYELIEKSPNDFFIDPNVYNVNDVASCLKKYFRSFNEPIITDSLFNLFCDACKLENTSSKLAQLEFTVSSMPEINYQVLRKTVELLYMIQKFADENKMDXXXXXXXXXXXXXXEDENHGEISTEILKDLIDYFETVF 2522
            + + +I   GL SE I+RK G   K   L + + +      +     +V+DV+S LK++ R   + + T +    + +A ++E+   K+++    +  +P +N   ++  +  LY +Q F+D N+M++ +LA+    ++   D      + ++++DLI+++  VF
Sbjct:  978 RCVDYITQCGLTSEGIYRKCGQTSKTQRLLDSLRQDARSVHLKEGEQHVDDVSSALKRFLRDLPDGLFTRAQRLAWLEASEIEDEEEKISRYRELLVHLPPVNRATVKALISHLYCVQCFSDTNQMNTHNLAIVFGPTLFQTD-GQDYKAGKVVEDLINHYVVVF 1141          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Mouse
Match: Arap1 (ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 1 [Source:MGI Symbol;Acc:MGI:1916960])

HSP 1 Score: 105.145 bits (261), Expect = 2.779e-22
Identity = 87/375 (23.20%), Postives = 168/375 (44.80%), Query Frame = 3
Query:  261 LIIFKNSNDIISSKRLPINKSIRLQYIDNSNQFLILLGNFQYLFMHSDASIIKN-WVNKINTLLLNYED-LQLNYFKYAEVRIDSNEASNVSS----------YILIRSDEYLLHIYENLVEHAQNICSHVINLKFYSLEXXXXXXXXXXXXLKLFGKSITFKIRFESSELVNEWKIILSEAINIAFMGGENKILKQIYTNESNKLCADCGYPNPEWVSINLCVILCINCSGLHRSLATSHSRIQSAILDQRIWEDSFLIEIMKKIGNENSNLFWYKNKQNSSTIFPSDLS-----EINSKYIEKKFIDTEFINLSDNEIKNRLRSSVATDDVFLTMKLYHSIK----FPYDSEFIKEILLIARNSNQYLQEKFL 1322
            L  F ++ D  S + +P+    R+  I +  +F ++  N  + F  +++ + +N W+  +   ++ +    +L+      VR  S +     S          Y+ +  D+  + +Y+NL E    I    I++   +++     S       ++F  S +     E  + +   +  ++EA++       +++ ++I+    N+ CADCG   P+W SINLCV++C  C+G HR L    S+++S  +D+++W ++ LI++   +GN   N FW  N   S  + PS         + +KY E K+     +  +  E+   L ++V T D+  T  L         F  D       L +A  + Q LQ +FL
Sbjct:  359 LRYFDSNKDAYSKRFVPVACICRVAPIGD-QKFEVITNNRTFAF-RAESDVERNEWMQALQQAVVEHRARFRLSSASVLGVR-GSEQPDRAGSLELRGFKNKLYVAVTGDK--VQLYKNLEEFHLGIGITFIDMNVGNVKEVDRRSFDLTTPYRIF--SFSADSELEKEQWLEAMQGAIAEALST------SEVAERIWAAAPNRFCADCGAAQPDWASINLCVVICKRCAGEHRGLGAGVSKVRSLKMDRKVWTEA-LIQLFLHLGNGPGNHFWAANVPPSEALEPSSSPGARRYHLEAKYREGKYRRYHPLFGNQEELDKALCAAVTTTDLAETQALLGCGAGVSCFSGDPA-APTPLALAEQAGQTLQMEFL 718          

HSP 2 Score: 54.6842 bits (130), Expect = 8.070e-7
Identity = 39/165 (23.64%), Postives = 86/165 (52.12%), Query Frame = 3
Query: 2028 KMITFIITRGLKSEFIFRKVGAVRKINALYELIEKSPNDFFIDPNVYNVNDVASCLKKYFRSFNEPIITDSLFNLFCDACKLENTSSKLAQLEFTVSSMPEINYQVLRKTVELLYMIQKFADENKMDXXXXXXXXXXXXXXEDENHGEISTEILKDLIDYFETVF 2522
            + + +I   GL SE I+RK G   K   L + + +      +     +V+DV+S LK++ R   + + T +    + +A ++E+   K+++    +  +P +N   ++  +  LY +Q F+D N+M++ +LA+    ++   D      + ++++DLI+++  VF
Sbjct:  978 RCVDYITQCGLTSEGIYRKCGQTSKTQRLLDSLRQDARSVHLKEGEQHVDDVSSALKRFLRDLPDGLFTRAQRLAWLEASEIEDEEEKISRYRELLVHLPPVNRATVKALISHLYCVQCFSDTNQMNTHNLAIVFGPTLFQTD-GQDYKAGKVVEDLINHYVVVF 1141          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Mouse
Match: Arap3 (ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 3 [Source:MGI Symbol;Acc:MGI:2147274])

HSP 1 Score: 92.4337 bits (228), Expect = 2.496e-18
Identity = 38/141 (26.95%), Postives = 73/141 (51.77%), Query Frame = 3
Query:  708 FKIRFESSELVNEWKIILSEAINIAFMGGENKILKQIYTNESNKLCADCGYPNPEWVSINLCVILCINCSGLHRSLATSHSRIQSAILDQRIWEDSFLIEIMKKIGNENSNLFWYKNKQNSSTIFPSDLSEINSKYIEKKF 1130
            F    ES      W   L EA+       + ++ +++++N +N+ CADC    P+W ++NL V++C  C+G HR+L +  S++QS  LD  +W +  ++++   +GN+ +N FW         + P        ++I +K+
Sbjct:  378 FSFTAESGGARQSWAAALQEAVTETL--SDYEVAEKVWSNPANRHCADCRASRPDWAAVNLGVVICKQCAGQHRALGSGISKVQSLKLDTSVWSNE-IVQLFIVLGNDRANCFWAGALPPGEGLHPDSAPGPRGEFISRKY 515          

HSP 2 Score: 75.8702 bits (185), Expect = 2.738e-13
Identity = 51/168 (30.36%), Postives = 90/168 (53.57%), Query Frame = 3
Query: 2022 IDKMITFIITRGLKSEFIFRKVGA-VRKINALYELIEKSPNDFFIDPNVYNVNDVASCLKKYFRSFNEPIITDSLFNLFCDACKLENTSSKLAQLEFTVSSMPEINYQVLRKTVELLYMIQKFADENKMDXXXXXXXXXXXXXXEDENHGEISTEILKDLIDYFETVF 2522
            +D  I+F+   GL+ E ++RK GA  R +  L E   +      + P  + V DV   LK++FR  ++P+ +  L   + +A +L   + +L + +  +S +P +N + L   +  LY +QK A  N+M +++LAL  A S+   D   GE    +L++LID + +VF
Sbjct:  841 VDACISFVTQHGLRLEGVYRKGGARARSLRLLAEF-RRDARSVKLRPREHFVEDVTDTLKRFFRELDDPVTSARLLPRWREAAELSQKNQRLEKYKEVISCLPRVNRRTLATLIGHLYRVQKCASLNQMCTRNLALLFAPSVFQTD-GRGEHEVRVLQELIDGYISVF 1006          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. UniProt/SwissProt
Match: sp|Q8WZ64|ARAP2_HUMAN (Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ARAP2 PE=1 SV=3)

HSP 1 Score: 115.161 bits (287), Expect = 2.124e-24
Identity = 72/214 (33.64%), Postives = 109/214 (50.93%), Query Frame = 3
Query:  705 TFKIRFESSELVNEWKIILSEAINIAFMGGENKILKQIYTNESNKLCADCGYPNPEWVSINLCVILCINCSGLHRSLATSHSRIQSAILDQRIWEDSFLIEIMKKIGNENSNLFWYKNKQNSSTIFPSDLSE-----INSKYIEKKFIDTEFINLSDNEIKNRLRSSVATDDVFLTMKLYHS---IKFPYDSEFIKEILLIARNSNQYLQEKFL 1322
            +F    E+ +   +W  I +   +IA    + ++ ++I+ NESN+ CADC  P+P+W SINLCV++C  C+G HRSL    S+++S  +D  IW +  LIE+   IGN+ +N FW  N Q    +      E     I  KY E KF  T   +L+  E+   L ++V   DV  TM L  S   +             L+A+ + Q LQ +FL
Sbjct:  656 SFSFTAETEKEKQDW--IEAVQQSIAETLSDYEVAEKIWFNESNRSCADCKAPDPDWASINLCVVICKKCAGQHRSLGPKDSKVRSLKMDASIWSNE-LIELFIVIGNKRANDFWAGNLQKDEELHMDSPVEKRKNFITQKYKEGKFRKTLLASLTKEELNKALCAAVVKPDVLETMALLFSGADVMCATGDPVHSTPYLLAKKAGQSLQMEFL 866          

HSP 2 Score: 59.3066 bits (142), Expect = 2.217e-7
Identity = 35/142 (24.65%), Postives = 67/142 (47.18%), Query Frame = 3
Query: 1983 NLFTNQRPIMFNPIDKMITFIITRGLKSEFIFRKVGAVRKINALYELIEKSPNDFFIDPNVYNVNDVASCLKKYFRSFNEPIITDSLFNLFCDACKLENTSSKLAQLEFTVSSMPEINYQVLRKTVELLYMIQKFADENKMD 2408
             L  N  PI+ N     I F+   GL  ++I++K G    I+ L E  +K    F +    + + DV + LK +    ++ ++T  L+  +  A   ++   ++ +    + S+P +N   L   +E LY +QK ++ N M+
Sbjct: 1122 QLSKNDVPIIVN---SCIAFVTQYGLGCKYIYQKNGDPLHISELLESFKKDARSFKLRAGKHQLEDVTAVLKSFLSDIDDALLTKELYPYWISALDTQDDKERIKKYGAFIRSLPGVNRATLAAIIEHLYRVQKCSEINHMN 1260          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. UniProt/SwissProt
Match: sp|Q8BZ05|ARAP2_MOUSE (Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 2 OS=Mus musculus OX=10090 GN=Arap2 PE=1 SV=2)

HSP 1 Score: 113.235 bits (282), Expect = 8.262e-24
Identity = 72/214 (33.64%), Postives = 107/214 (50.00%), Query Frame = 3
Query:  705 TFKIRFESSELVNEWKIILSEAINIAFMGGENKILKQIYTNESNKLCADCGYPNPEWVSINLCVILCINCSGLHRSLATSHSRIQSAILDQRIWEDSFLIEIMKKIGNENSNLFWYKNKQNSSTIFPSDLSE-----INSKYIEKKFIDTEFINLSDNEIKNRLRSSVATDDVFLTMKLYHS---IKFPYDSEFIKEILLIARNSNQYLQEKFL 1322
            +F    +S     EW  I +   +IA    + ++ ++I+ NESN+ CADC  P+P+W SINLCV++C  C+G HRSL     +++S  +D  IW +  LIE+   IGN+ +N FW  N Q    +      E     I  KY E KF  T   +L+  E+   L ++V   DV  TM L  S   +             L+A+ + Q LQ +FL
Sbjct:  654 SFSFTADSEREKQEW--IEAVQQSIAETLSDYEVAEKIWFNESNRSCADCKAPDPDWASINLCVVICKKCAGQHRSLGPKDCKVRSLKMDASIWSNE-LIELFIVIGNKRANDFWAGNLQKDEELQVDSPVEKRKNFITQKYKEGKFRKTLLASLTKEELNKALCAAVVKPDVLETMALLFSGADVMCATGDPVHSTPYLLAKKAGQSLQMEFL 864          

HSP 2 Score: 56.9954 bits (136), Expect = 1.124e-6
Identity = 34/142 (23.94%), Postives = 65/142 (45.77%), Query Frame = 3
Query: 1983 NLFTNQRPIMFNPIDKMITFIITRGLKSEFIFRKVGAVRKINALYELIEKSPNDFFIDPNVYNVNDVASCLKKYFRSFNEPIITDSLFNLFCDACKLENTSSKLAQLEFTVSSMPEINYQVLRKTVELLYMIQKFADENKMD 2408
             L  N  PI+ N     I F+   GL  ++I++K G    I+ L E  +K      +    + + DV   LK +    ++ ++T  L+  +  A   ++   + ++    + S+P +N   L   +E LY +QK ++ N M+
Sbjct: 1120 QLCKNDVPIIVN---SCIAFVTQYGLGCKYIYQKDGDPLHISELLESFKKDARSVKLRAGKHQLEDVTGVLKSFLSDIDDALLTKELYPYWVSALDTQDEKERTSKYRAFIRSLPGVNRATLAALIEHLYRVQKCSEINHMN 1258          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. UniProt/SwissProt
Match: sp|Q96P48|ARAP1_HUMAN (Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ARAP1 PE=1 SV=3)

HSP 1 Score: 112.849 bits (281), Expect = 8.579e-24
Identity = 73/272 (26.84%), Postives = 131/272 (48.16%), Query Frame = 3
Query:  534 YILIRSDEYLLHIYENLVEHAQNICSHVINLKFYSLEXXXXXXXXXXXXLKLFGKSITFKIRFESSELVNEWKIILSEAINIAFMGGENKILKQIYTNESNKLCADCGYPNPEWVSINLCVILCINCSGLHRSLATSHSRIQSAILDQRIWEDSFLIEIMKKIGNENSNLFWYKNKQNSSTIFPSDLS-----EINSKYIEKKFIDTEFINLSDNEIKNRLRSSVATDDVFLTMKLYHSIK----FPYDSEFIKEILLIARNSNQYLQEKFL 1322
            Y+ +  D+  + +Y+NL E+   I    I++   +++     S       ++F  S +     E  + +   +  ++EA++       +++ ++I+    N+ CADCG P P+W SINLCV++C  C+G HR L    S+++S  +D+++W ++ LIE+  ++GN   N FW  N   S  + PS         + +KY E K+     +  +  E+   L ++V T D+  T  L         F  D E     L +A  + Q LQ +FL
Sbjct:  457 YVAVVGDK--VQLYKNLEEYHLGIGITFIDMSVGNVKEVDRRSFDLTTPYRIF--SFSADSELEKEQWLEAMQGAIAEALST------SEVAERIWAAAPNRFCADCGAPQPDWASINLCVVICKRCAGEHRGLGAGVSKVRSLKMDRKVWTET-LIELFLQLGNGAGNRFWAANVPPSEALQPSSSPSTRRCHLEAKYREGKYRRYHPLFGNQEELDKALCAAVTTTDLAETQALLGCGAGINCFSGDPE-APTPLALAEQAGQTLQMEFL 716          

HSP 2 Score: 55.4546 bits (132), Expect = 3.312e-6
Identity = 40/165 (24.24%), Postives = 84/165 (50.91%), Query Frame = 3
Query: 2028 KMITFIITRGLKSEFIFRKVGAVRKINALYELIEKSPNDFFIDPNVYNVNDVASCLKKYFRSFNEPIITDSLFNLFCDACKLENTSSKLAQLEFTVSSMPEINYQVLRKTVELLYMIQKFADENKMDXXXXXXXXXXXXXXEDENHGEISTEILKDLIDYFETVF 2522
            + + +I   GL SE I+RK G   K   L E + +      +     +V+DV+S LK++ R   + + T +    + +A ++E+   K+++    +  +P +N   ++  +  LY +Q F+D N+M+  +LA+    ++   D      +  +++DLI+++  VF
Sbjct:  976 RCVDYITQCGLTSEGIYRKCGQTSKTQRLLESLRQDARSVHLKEGEQHVDDVSSALKRFLRDLPDGLFTRAQRLTWLEASEIEDEEEKVSRYRELLVRLPPVNRATVKALISHLYCVQCFSDTNQMNVHNLAIVFGPTLFQTD-GQDYKAGRVVEDLINHYVVVF 1139          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. UniProt/SwissProt
Match: sp|Q4LDD4|ARAP1_MOUSE (Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1 OS=Mus musculus OX=10090 GN=Arap1 PE=1 SV=2)

HSP 1 Score: 105.145 bits (261), Expect = 1.944e-21
Identity = 87/375 (23.20%), Postives = 168/375 (44.80%), Query Frame = 3
Query:  261 LIIFKNSNDIISSKRLPINKSIRLQYIDNSNQFLILLGNFQYLFMHSDASIIKN-WVNKINTLLLNYED-LQLNYFKYAEVRIDSNEASNVSS----------YILIRSDEYLLHIYENLVEHAQNICSHVINLKFYSLEXXXXXXXXXXXXLKLFGKSITFKIRFESSELVNEWKIILSEAINIAFMGGENKILKQIYTNESNKLCADCGYPNPEWVSINLCVILCINCSGLHRSLATSHSRIQSAILDQRIWEDSFLIEIMKKIGNENSNLFWYKNKQNSSTIFPSDLS-----EINSKYIEKKFIDTEFINLSDNEIKNRLRSSVATDDVFLTMKLYHSIK----FPYDSEFIKEILLIARNSNQYLQEKFL 1322
            L  F ++ D  S + +P+    R+  I +  +F ++  N  + F  +++ + +N W+  +   ++ +    +L+      VR  S +     S          Y+ +  D+  + +Y+NL E    I    I++   +++     S       ++F  S +     E  + +   +  ++EA++       +++ ++I+    N+ CADCG   P+W SINLCV++C  C+G HR L    S+++S  +D+++W ++ LI++   +GN   N FW  N   S  + PS         + +KY E K+     +  +  E+   L ++V T D+  T  L         F  D       L +A  + Q LQ +FL
Sbjct:  359 LRYFDSNKDAYSKRFVPVACICRVAPIGD-QKFEVITNNRTFAF-RAESDVERNEWMQALQQAVVEHRARFRLSSASVLGVR-GSEQPDRAGSLELRGFKNKLYVAVTGDK--VQLYKNLEEFHLGIGITFIDMNVGNVKEVDRRSFDLTTPYRIF--SFSADSELEKEQWLEAMQGAIAEALST------SEVAERIWAAAPNRFCADCGAAQPDWASINLCVVICKRCAGEHRGLGAGVSKVRSLKMDRKVWTEA-LIQLFLHLGNGPGNHFWAANVPPSEALEPSSSPGARRYHLEAKYREGKYRRYHPLFGNQEELDKALCAAVTTTDLAETQALLGCGAGVSCFSGDPA-APTPLALAEQAGQTLQMEFL 718          

HSP 2 Score: 54.6842 bits (130), Expect = 5.645e-6
Identity = 39/165 (23.64%), Postives = 86/165 (52.12%), Query Frame = 3
Query: 2028 KMITFIITRGLKSEFIFRKVGAVRKINALYELIEKSPNDFFIDPNVYNVNDVASCLKKYFRSFNEPIITDSLFNLFCDACKLENTSSKLAQLEFTVSSMPEINYQVLRKTVELLYMIQKFADENKMDXXXXXXXXXXXXXXEDENHGEISTEILKDLIDYFETVF 2522
            + + +I   GL SE I+RK G   K   L + + +      +     +V+DV+S LK++ R   + + T +    + +A ++E+   K+++    +  +P +N   ++  +  LY +Q F+D N+M++ +LA+    ++   D      + ++++DLI+++  VF
Sbjct:  978 RCVDYITQCGLTSEGIYRKCGQTSKTQRLLDSLRQDARSVHLKEGEQHVDDVSSALKRFLRDLPDGLFTRAQRLAWLEASEIEDEEEKISRYRELLVHLPPVNRATVKALISHLYCVQCFSDTNQMNTHNLAIVFGPTLFQTD-GQDYKAGKVVEDLINHYVVVF 1141          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. UniProt/SwissProt
Match: sp|Q8WWN8|ARAP3_HUMAN (Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 3 OS=Homo sapiens OX=9606 GN=ARAP3 PE=1 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 7.465e-19
Identity = 40/141 (28.37%), Postives = 74/141 (52.48%), Query Frame = 3
Query:  708 FKIRFESSELVNEWKIILSEAINIAFMGGENKILKQIYTNESNKLCADCGYPNPEWVSINLCVILCINCSGLHRSLATSHSRIQSAILDQRIWEDSFLIEIMKKIGNENSNLFWYKNKQNSSTIFPSDLSEINSKYIEKKF 1130
            F    ES      W   L EA+       + ++ ++I++N +N+ CADCG   P+W ++NL V++C  C+G HR+L +  S++QS  LD  +W +  ++++   +GN+ +N FW         + P        ++I +K+
Sbjct:  461 FSFTAESGGARQSWAAALQEAVTETLS--DYEVAEKIWSNRANRQCADCGSSRPDWAAVNLGVVICKQCAGQHRALGSGISKVQSLKLDTSVWSNE-IVQLFIVLGNDRANRFWAGTLPPGEGLHPDATPGPRGEFISRKY 598          

HSP 2 Score: 74.7146 bits (182), Expect = 4.419e-12
Identity = 50/168 (29.76%), Postives = 89/168 (52.98%), Query Frame = 3
Query: 2022 IDKMITFIITRGLKSEFIFRKVGA-VRKINALYELIEKSPNDFFIDPNVYNVNDVASCLKKYFRSFNEPIITDSLFNLFCDACKLENTSSKLAQLEFTVSSMPEINYQVLRKTVELLYMIQKFADENKMDXXXXXXXXXXXXXXEDENHGEISTEILKDLIDYFETVF 2522
            +D  I+F+   GL+ E ++RK GA  R +  L E   +      + P  + V DV   LK++FR  ++P+ +  L   + +A +L   + +L + +  +  +P +N + L   +  LY +QK A  N+M +++LAL  A S+   D   GE    +L++LID + +VF
Sbjct:  923 VDACISFVTQHGLRLEGVYRKGGARARSLRLLAEF-RRDARSVKLRPGEHFVEDVTDTLKRFFRELDDPVTSARLLPRWREAAELPQKNQRLEKYKDVIGCLPRVNRRTLATLIGHLYRVQKCAALNQMCTRNLALLFAPSVFQTD-GRGEHEVRVLQELIDGYISVF 1088          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. TrEMBL
Match: G1KLB4 (ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 3 OS=Anolis carolinensis OX=28377 GN=ARAP3 PE=4 SV=1)

HSP 1 Score: 147.902 bits (372), Expect = 5.276e-32
Identity = 167/656 (25.46%), Postives = 295/656 (44.97%), Query Frame = 3
Query:  708 FKIRFESSELVNEWKIILSEAINIAFMGGENKILKQIYTNESNKLCADCGYPNPEWVSINLCVILCINCSGLHRSLATSHSRIQSAILDQRIWEDSFLIEIMKKIGNENSNLFWYKNKQNSSTIFPSDLSE-----INSKYIEKKFIDTEFINLSDNEIKNRLRSSVATDDVFLTMKLYHSIKFPYDSEFIKEILLIARNSNQYLQEKFLS--------VQPDL-------SNSIQDQTIIKDK---------------IFKISYNNEEKLADLFSVSLLCTCISINIEELLTPAIYINICCIYYTDIELIWYDSTNESLVITLFNNCQFFKNPKSRTSKKY-PITVHRLSFFDQSNVIKQFQLDLFKLLMPNHFVELTF---NSNLF------------MNLEVKLNENNTIKCKSHVDEQGIIFYFPIAIIFDLKNSTKIQLIDDKIISIKFNNDQIEIVTNNFGSQNLVYNYLNLFTNQRPIMFNPIDKMITFIITRGLKSEFIFRKVGAVRKINALYELIEKSPNDFFIDPNVYNVNDVASCLKKYFRSFNEPIITDSLFNLFCDACKLENTSSKLAQLEFTVSSMPEINYQVLRKTVELLYMIQKFADENKMDXXXXXXXXXXXXXXEDENHGEISTEILKDLIDYFETVF 2522
            F    ES     EW   L  +I       E  + ++I++N++N+LCADC  P+P+W S+NLCV++C +C+G HRSL +S S++QS  LD  IW +  ++++   +GNE  N FW      S  ++P   +E     I  KY   ++        S  +I   L S+V+   +  TM L+ +     ++E  +   L +   N  ++E  LS         QP         + ++   T+IK                 +F  +  + E LA +  V +    IS+ +  L  P   IN   I++T +EL   +   + L     ++ Q +    S   K + P++ H L  ++   V K   L    +L PN +++  F    S+LF            +NL  +L E + +      +++ ++    +   F L+ ++++           F+   + I  +  G  N + +   L  +  PI+ N     I FI   GL+ E I+RK GA  +I  L E   +   +  +  +   + DV   LK++FR   +P+ T  L   + +A  +   S +L + +  ++ +P +N + L   +  LY +QK AD N+M +K+LAL  A S+   D   GE   ++++DLID +  +F
Sbjct:  467 FSFVAESEREKREWMEALQNSIAETLYDYE--VAEKIWSNKANRLCADCHAPSPDWASVNLCVVICKHCAGQHRSLGSSISKVQSLKLDTSIWSNE-MVQLFIMLGNEQVNKFWETQLPPSEALYPDANAEQRQNFITCKYRYGRYCMPHPHYSSQEDILQALCSAVSGPGLLKTMLLFFATTMETENEVTEHPKLASSCGNLGVEE--LSPEGVYNEVTQPIAHSGYLYKAPAVTKLTVIKKSREEFQRVWCSLEKCFLFYETDKSSEPLAKIEMVDV----ISLGVSSL--PWEIINR--IHFT-LELYLSNERVQQLEADGPDSLQSW---ASAIGKWFTPLSCHCLLGYEFQRVGK---LCYKSMLNPNQWLQGFFILQKSHLFICPGEEGATEDSINLR-QLQELSVVPLPEGAEKKEMLVLVEMGRTFCLQGTSRLD----------FSTWCMAIQASASGQGNALRDQ-QLSRSGIPIIVN---SCIAFITQYGLQHEGIYRKNGAKSRIKLLMEDFRRDARNVKLRISDNFIEDVTDVLKRFFRELEDPVFTTYLHPQWKEAAGILQKSQRLEKYKELINHLPHLNRRTLAALIGHLYRVQKCADLNQMTTKNLALLFAPSLFQTD-GKGEHEVKVMEDLIDNYVYIF 1086          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. TrEMBL
Match: A0A3P8XRP3 (Uncharacterized protein OS=Esox lucius OX=8010 PE=4 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 5.278e-28
Identity = 100/397 (25.19%), Postives = 184/397 (46.35%), Query Frame = 3
Query:  270 FKNSNDIISSKRLPINKSIRLQYIDNSNQFLILLGNFQYLFMHSDASIIKNWVNKIN-TLLLNYEDLQLNYFKYAEVRIDSNEASNVSS-------------YILIRSDEYLLHIYENLVEHAQNICSHVINLKFYSLEXXXXXXXXXXXXLKLFGKSITFKIRFESSELVNEWKIILSEAINIAFMGGENKILKQIYTNESNKLCADCGYPNPEWVSINLCVILCINCSGLHRSLATSHSRIQSAILDQRIWEDSFLIEIMKKIGNENSNLFWYKNKQNSSTIFPSDLSE-----INSKYIEKKFIDTEFINLSDNEIKNRLRSSVATDDVFLTMKLYHSIK----FPYDSEFIKEILLIARNSNQYLQEKFLSVQPDL---SNSIQDQTIIKDKI 1382
            F N  ++ S KR+    SI         +F ++  N  +LF   + ++ + WV+ +  T+  + + +++++   +++    N   ++S              Y++I +D   L  Y +  EH Q +    I +   ++ ++   S       +      TF    ES +   +W   L   +  +     N++ ++I+  E+N+ CADCG PNP+W S+NLCV+LC  C+G+HR L  S S++ S   D+ +W DS LI++ + +GN+  NLFW  N   S  + PS  SE     + +KY + K+ +   +     E+   L +++ T DV  T+ L         +  D E    + + A++  Q LQ +FL+         +   DQ +IK  +
Sbjct:   30 FDNEKEVYS-KRIIAIASITHVLNVGGQKFAVVTRNRTFLFRSENNTVREEWVSVLQATVQQHRKRVEMSFMNVSDMSGQHNGGVSISKQGYLEVDGLRSKVYVVICADRVFL--YRSTEEHNQGVGITSIEMNMVTVTSTDKRSFNITTFCR------TFSFMAESEQQREQWVEALKACVGRSL--SSNRVAQKIWAEEANQRCADCGAPNPDWASVNLCVVLCKCCAGVHRGLGQSVSKVCSLRTDEHLWTDS-LIQVFRLLGNDRVNLFWAANLPPSEALCPSSDSEERLQFVTAKYCQGKYRNYHALFAKQEELNKALCNNIKTSDVLETLALVFCGADVNSYTGDPELPSPVSM-AQHYGQTLQVEFLTRNHSTEIPGSRAGDQPVIKAAL 413          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. TrEMBL
Match: A0A4W5P1Z8 (Uncharacterized protein OS=Hucho hucho OX=62062 PE=4 SV=1)

HSP 1 Score: 130.568 bits (327), Expect = 7.311e-27
Identity = 99/388 (25.52%), Postives = 189/388 (48.71%), Query Frame = 3
Query:  270 FKNSNDIISSKRLPINKSIRLQYIDNSNQFLILLGNFQYLFMHSDASIIKNWVNKINTLL---LNYEDLQLNYFKYAEVRIDSN----------EASNVSS--YILIRSDEYLLHIYENLVEHAQNICSHVINLKFYSLEXXXXXXXXXXXXLKLFGKSITFKIRFESSELVNEWKIILSEAINIAFMGGENKILKQIYTNESNKLCADCGYPNPEWVSINLCVILCINCSGLHRSLATSHSRIQSAILDQRIWEDSFLIEIMKKIGNENSNLFWYKNKQNSSTIFPSDLSEINSKYIEKKFIDTEFIN----LSDNEIKNR-LRSSVATDDVFLTMKLYHSIK----FPYDSEFIKEILLIARNSNQYLQEKFLSVQPDLSNSIQDQ 1361
            F+N  ++ S + + I     +  +    +F ++  N  +LF   + ++ + WV+ +   +    N  ++ L  F +   + DS           E + + S  Y++I +D   L  Y N  E++Q +    I +   +++++   S       +      TF    ES++L ++W   L + ++ +     + + ++I+  E+N+ CADCG P+P+W S+NLCV+LC  C+G+HR L  S S+++S  +D+++W D+ LI++   +GN   NLFW  N   S  + PS  SE+  +++  K+   ++          E  N+ L S+V TDDV  T+ L         +  D E    + + A++  Q LQ +FL+   +   S+ +Q
Sbjct:   30 FQNEKEVYSKRIIAILSVTEVLNV-GEQKFEVVTRNRTFLFRAENNTVREEWVSVLKETIQQRRNGMEMSLMNFSFTSGQRDSGVSLISKQGYLEMNGLRSKVYVVICADRVFL--YGNAEEYSQGVGITYIEMNVGTVKSTDKRSFNLTTFYR------TFSFLAESAQLRDQWVEALQDCVSRSL--SSDVVAQKIWAVEANQRCADCGAPHPDWASVNLCVVLCKCCAGVHRGLGQSVSKVRSLRMDEKVWTDN-LIQVF-LVGNNRVNLFWAANMPPSEALHPSSDSEMRQRFVSAKYCQGKYRRYHALFGQQEALNKALCSTVQTDDVLETLSLVFCGADVNCYTGDPELPSPVSM-AQHYGQILQVEFLTHNHNTGRSLINQ 403          

HSP 2 Score: 78.1814 bits (191), Expect = 1.093e-10
Identity = 50/193 (25.91%), Postives = 92/193 (47.67%), Query Frame = 3
Query: 2022 IDKMITFIITRGLKSEFIFRKVGAVRKINALYELIEKSPNDFFIDPNVYNVNDVASCLKKYFRSFNEPIITDSLFNLFCDACKLENTSSKLAQLEFTVSSMPEINYQVLRKTVELLYMIQKFADENKMDXXXXXXXXXXXXXXEDENHGEISTEILKDLIDYFETVFGYSPKERTALIKHIENPVEKEPIIIR 2600
            +D+ +++I   GLKSE I+R+ G   KI AL   +        +      V+DVA+ LK++ R   E +      +L       +  S +++Q +  + S+P +N   L   +  LY +Q FADEN+M+  +LA+    ++   D        ++++DLI  ++ +F  S     A +  I   V  E ++ +
Sbjct:  636 VDRCMSYITQHGLKSEGIYRRCGVNSKIAALLFFLRHDARQVRLSEGERQVDDVANVLKRFLREVGEGVFNGHQASLPWLHTTSDEMSERVSQYQALLHSLPRVNRATLGAVINHLYCVQCFADENQMNMHNLAIVFGPTLFQMDGTDNS-PGQVVEDLIQNYQDIFNVSVSPLPAPLSQISQEVSAEELVCK 827          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. TrEMBL
Match: A0A060WR07 (Uncharacterized protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00013490001 PE=4 SV=1)

HSP 1 Score: 124.405 bits (311), Expect = 9.375e-27
Identity = 80/273 (29.30%), Postives = 141/273 (51.65%), Query Frame = 3
Query:  534 YILIRSDEYLLHIYENLVEHAQNICSHVINLKFYSLEXXXXXXXXXXXXLKLFGKSITFKIRFESSELVNEWKIILSEAINIAFMGGENKILKQIYTNESNKLCADCGYPNPEWVSINLCVILCINCSGLHRSLATSHSRIQSAILDQRIWEDSFLIEIMKKIGNENSNLFWYKNKQNSSTIFPSDLSEINSKYIEKKFIDTEFIN----LSDNEIKNR-LRSSVATDDVFLTMKLYHSIK----FPYDSEFIKEILLIARNSNQYLQEKFLS 1325
            Y++I +D   L  Y N  EH+Q +    I +   +++++   S       +      TF    ES++  ++W   L + ++ +     + + ++I+  E+N+ CADCG P+P+W S+NLCV+LC  C+G+HR L  S S+++S  +D+++W D+ LI++   +GN   NLFW  N   S  + PS  SE   +++  K+   ++          E  N+ L S+V TDDV  T+ L         +  D E    +  +A++  Q LQ +FL+
Sbjct:   61 YVVICADRVFL--YGNAEEHSQGVGITYIEMNVGTVKSTDKRSFNLTTFYR------TFSFLAESAQQRDQWVEALQDCVSRSL--SSDVVAQKIWAVEANQRCADCGAPHPDWASVNLCVVLCKCCAGVHRGLGQSVSKVRSLRMDEKVWTDN-LIQVF-LLGNNRVNLFWAANTPPSEALQPSSDSEKRQRFVSAKYCQGKYRRYHALFGQQEALNKALCSTVQTDDVLETLSLVFCGADVNCYTGDPELPSPV-SVAQHYGQILQVEFLT 320          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. TrEMBL
Match: A0A210PGH0 (Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT12956 PE=4 SV=1)

HSP 1 Score: 129.798 bits (325), Expect = 2.169e-26
Identity = 80/223 (35.87%), Postives = 124/223 (55.61%), Query Frame = 3
Query:  681 LKLFGKSITFKIRFESSELVNEWKIILSEAINIAFMGGENKILKQIYTNESNKLCADCGYPNPEWVSINLCVILCINCSGLHRSLATSHSRIQSAILDQRIWEDSFLIEIMKKIGNENSNLFWYKNKQNSSTIFPSDLSEINSK-YIEKKFIDTEFIN---LSDNE--IKNRLRSSVATDDVFLTMKLYHS---IKFPYDSEFIKEILLIARNSNQYLQEKFL 1322
            L+L      F + FE+ E    W++ + E+I  A   G+N IL+QI  N SN  CADC  P+P W SIN+ ++LC  C+G+HR    + S+++S  +D  +W  S LIE+MK+IGN N+NLFW K+ +  S  F  D+     K ++E K+ + ++I+   LSDN+  +   L  + +T D+ LTM L  S   +K        +    IA+ + Q LQ + L
Sbjct: 1008 LRLATHYTQFVLAFETYEDCVTWRMAMEESIADAL--GDNTILEQIKKNPSNHECADCSAPDPHWASINMGIVLCKQCAGIHRKFDLNVSKVRSLRMDTSVWSPS-LIEMMKQIGNHNANLFWEKHLRAKSG-FNQDMESAQRKQHLENKYENRKYIDKHPLSDNKPALNEELLKAASTADILLTMMLVFSGADVKVIKPGTQEETAFSIAKAAGQRLQMELL 1226          

HSP 2 Score: 71.633 bits (174), Expect = 1.387e-8
Identity = 36/128 (28.12%), Postives = 69/128 (53.91%), Query Frame = 3
Query: 2022 IDKMITFIITRGLKSEFIFRKVGAVRKINALYELIEKSPNDFFIDPNVYNVNDVASCLKKYFRSFNEPIITDSLFNLFCDACKLENTSSKLAQLEFTVSSMPEINYQVLRKTVELLYMIQKFADENKM 2405
            +DK + FI   GL+ E I+R      K++ L     K  +   ++   + V++VA+ LK++FR+  +P++T  L+N + +  K   T +KL    + +  +P ++ + LR+ V  L  +  ++ ENKM
Sbjct: 1505 VDKCLKFIDDHGLQEEGIYRLAATNSKVDTLLATFAKDAHAVKLELGTHTVHEVANALKRFFRNLKDPLLTSHLYNTWIEKSKTTMTQTKLDWYHYYIRELPTVHSRTLRRLVIHLAKLSGYSVENKM 1632          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Cavefish
Match: ARAP1 (ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 1 [Source:NCBI gene;Acc:103028333])

HSP 1 Score: 109.383 bits (272), Expect = 1.288e-23
Identity = 60/173 (34.68%), Postives = 96/173 (55.49%), Query Frame = 3
Query:  723 ESSELVNEWKIILSEAINIAFMGGENKILKQIYTNESNKLCADCGYPNPEWVSINLCVILCINCSGLHRSLATSHSRIQSAILDQRIWEDSFLIEIMKKIGNENSNLFWYKNKQNSSTIFPSDLSE-----INSKYIEKKFIDTEFINLSDNEIKNRLRSSVATDDVFLTMKL 1226
            E+ +L ++W   +  +I  A    E  + ++I+    N+ CADCG P PEW +INLCV+ C  C+G HRSL  S S+++S  +D+++W +  LI++ + +GNE +N FW  N   S  +     SE     I +KY E K+     +  +  EI N L  +V ++DV  T+ L
Sbjct:  663 ETDQLKDQWVEAMRNSIAEALSNYE--VAEKIWAEPDNQKCADCGAPKPEWAAINLCVVFCKRCAGEHRSLGPSISKVRSLKMDKKVWTNE-LIQLFRVLGNERANQFWAANVPPSEALSVCSSSEERRRFITAKYREGKYRRYHPLFGNQKEINNALCINVQSNDVCETLAL 832          

HSP 2 Score: 66.6254 bits (161), Expect = 1.578e-10
Identity = 36/129 (27.91%), Postives = 67/129 (51.94%), Query Frame = 3
Query: 2022 IDKMITFIITRGLKSEFIFRKVGAVRKINALYELIEKSPNDFFIDPNVYNVNDVASCLKKYFRSFNEPIITDSLFNLFCDACKLENTSSKLAQLEFTVSSMPEINYQVLRKTVELLYMIQKFADENKMD 2408
            +++ I +I   GL SE I+RK G   KI AL E   ++    ++      V+DV++ LK++FR   E +      N       + + S +++  +   +++P +N   LR  V  LY +Q+F++ N+M+
Sbjct: 1121 VERCIHYITQYGLTSEGIYRKSGVNSKIAALLEAFRRNARSVWLKEAEQQVDDVSNVLKRFFRDIEEGLFGQHAQNWLTTTA-VSDESKRISHYQLLFNNLPRVNKATLRTLVNHLYCVQRFSEMNQMN 1248          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Cavefish
Match: arap3 (ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 3 [Source:ZFIN;Acc:ZDB-GENE-091019-1])

HSP 1 Score: 100.908 bits (250), Expect = 4.360e-21
Identity = 48/115 (41.74%), Postives = 72/115 (62.61%), Query Frame = 3
Query:  705 TFKIRFESSELVNEWKIILSEAINIAFMGGENKILKQIYTNESNKLCADCGYPNPEWVSINLCVILCINCSGLHRSLATSHSRIQSAILDQRIWEDSFLIEIMKKIGNENSNLFW 1049
            TF    ES     EW   L E+I  A    + ++ ++I++N SNK+CADC   NP+W SINLCV++C NC+G HRSL T  S++QS  LD  +W +  ++++   +GN+ +N FW
Sbjct:  544 TFSFTAESDRDKREWMEALQESI--AETLSDYEVAEKIWSNRSNKICADCKAINPDWASINLCVVICKNCAGQHRSLGTMVSKVQSLKLDTSVWSNE-IVQLFIMLGNDRANEFW 655          

HSP 2 Score: 74.3294 bits (181), Expect = 7.082e-13
Identity = 60/190 (31.58%), Postives = 93/190 (48.95%), Query Frame = 3
Query: 1983 NLFTNQRPIMFNPIDKMITFIITRGLKSEFIFRKVGAVRKINALYELIEKSPNDFFIDPNVYNVNDVASCLKKYFRSFNEPIITDSLFNLFCDACKLENTSSKLAQLEFTVSSMPEINYQVLRKTVELLYMIQKFADENKMDXXXXXXXXXXXXXXEDENHGEISTEILKDLIDYFETVFGYSPKERTAL 2552
             L  N  PI+   +D  I FI   GL  E I+RK GA  +I  L +   K   +  +      + DV   LK++FR  ++PI    L   + DA K  N   +L + +  +  +P +N   L   +  LY +QK AD N+M +K+L+L  A S+   D   GE   +I++DLID +  VF    + +T +
Sbjct:  992 QLSRNDIPII---VDSCIAFITQYGLGHEGIYRKNGAKSRIKLLMDEFRKDARNVKLRIGDNFIEDVTDVLKRFFREIDDPIFMADLHPYWKDAAKTSNKMQRLDRYKELIRGLPRVNRTTLAALISHLYRVQKCADLNQMCTKNLSLLFAPSLFQTD-GKGEHEVKIVEDLIDNYLYVFDIDEEHKTQI 1177          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Cavefish
Match: arap3 (ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 3 [Source:ZFIN;Acc:ZDB-GENE-091019-1])

HSP 1 Score: 100.908 bits (250), Expect = 4.653e-21
Identity = 48/115 (41.74%), Postives = 72/115 (62.61%), Query Frame = 3
Query:  705 TFKIRFESSELVNEWKIILSEAINIAFMGGENKILKQIYTNESNKLCADCGYPNPEWVSINLCVILCINCSGLHRSLATSHSRIQSAILDQRIWEDSFLIEIMKKIGNENSNLFW 1049
            TF    ES     EW   L E+I  A    + ++ ++I++N SNK+CADC   NP+W SINLCV++C NC+G HRSL T  S++QS  LD  +W +  ++++   +GN+ +N FW
Sbjct:  649 TFSFTAESDRDKREWMEALQESI--AETLSDYEVAEKIWSNRSNKICADCKAINPDWASINLCVVICKNCAGQHRSLGTMVSKVQSLKLDTSVWSNE-IVQLFIMLGNDRANEFW 760          

HSP 2 Score: 74.3294 bits (181), Expect = 7.370e-13
Identity = 60/190 (31.58%), Postives = 93/190 (48.95%), Query Frame = 3
Query: 1983 NLFTNQRPIMFNPIDKMITFIITRGLKSEFIFRKVGAVRKINALYELIEKSPNDFFIDPNVYNVNDVASCLKKYFRSFNEPIITDSLFNLFCDACKLENTSSKLAQLEFTVSSMPEINYQVLRKTVELLYMIQKFADENKMDXXXXXXXXXXXXXXEDENHGEISTEILKDLIDYFETVFGYSPKERTAL 2552
             L  N  PI+   +D  I FI   GL  E I+RK GA  +I  L +   K   +  +      + DV   LK++FR  ++PI    L   + DA K  N   +L + +  +  +P +N   L   +  LY +QK AD N+M +K+L+L  A S+   D   GE   +I++DLID +  VF    + +T +
Sbjct: 1097 QLSRNDIPII---VDSCIAFITQYGLGHEGIYRKNGAKSRIKLLMDEFRKDARNVKLRIGDNFIEDVTDVLKRFFREIDDPIFMADLHPYWKDAAKTSNKMQRLDRYKELIRGLPRVNRTTLAALISHLYRVQKCADLNQMCTKNLSLLFAPSLFQTD-GKGEHEVKIVEDLIDNYLYVFDIDEEHKTQI 1282          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Cavefish
Match: ENSAMXT00000000841.2 (arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like [Source:NCBI gene;Acc:103047121])

HSP 1 Score: 98.5969 bits (244), Expect = 1.672e-20
Identity = 69/211 (32.70%), Postives = 102/211 (48.34%), Query Frame = 3
Query:  705 TFKIRFESSELVNEWKIILSEAINIAFMGGENKILKQIYTNESNKLCADCGYPNPEWVSINLCVILCINCSGLHRSLATSHSRIQSAILDQRIWEDSFLIEIMKKIGNENSNLFWYKNKQNSSTIFPSDLSE-----INSKYIEKKFIDTEFINLSDNEIKNRLRSSVATDDVFLTMKLYHSIKFPYDSEFIKEILLIARNSNQYLQEKFL 1322
            +F    +SS+    W   L+E I  A    E  +  +++ +  NK+CADCG  NPEW SINL V++C  C+G+HRS+ TS S+++S  LD +IW +  LI++    GN+ SN  W  N   +  I P    E     I +KY    +  T  +  +   +  RL   V   DV  T+ L  S             + IA N+ Q LQ + L
Sbjct:  335 SFNFSADSSKDQTTWLNQLNEVIRSALSCSE--VALRLWASPWNKVCADCGSSNPEWASINLLVVICEACAGVHRSIGTSRSKVRSLKLDSKIWTEP-LIKLFIIYGNKASNNVWGHNVPAAEQILPDAGQEERDAFIKAKYCSGLYRKTHPLISNQTLLNQRLCEVVCGVDVEETLCLLCSGAKVLTDPQSPSAISIAENAGQALQTELL 542          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Cavefish
Match: ENSAMXT00000019510.2 (ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 2 [Source:NCBI gene;Acc:103040621])

HSP 1 Score: 92.4337 bits (228), Expect = 1.920e-18
Identity = 69/215 (32.09%), Postives = 107/215 (49.77%), Query Frame = 3
Query:  705 TFKIRFESSELVNEWKIILSEAINIAFMGGENKILKQIYTNESNKLCADCGYPNPEWVSINLCVILCINCSGLHRSLATSHSRIQSAILDQRIWEDSFLIEIMKKIGNENSNLFWYKN----KQNSSTIFPSDLSEINSKYIEKKFIDTEFINLSDNEIKNR-LRSSVATDDVFLTMKLYHS----IKFPYDSEFIKEILLIARNSNQYLQEKFL 1322
            +F    ES     EW   + E+I       E  + ++++ N+SN+ CADC  PNPEW SINL V++C  C+G HR L +  S+++S  LD  IW +  L+E+  ++GNEN+N FW  N    ++      P   +  + +   ++        L + E  N+ L ++V   DV +TM L  S    +    D E     LL A+   Q LQ +FL
Sbjct:  592 SFCFTAESEREREEWIEAVQESIVETLSNYE--VAEKVWFNQSNRNCADCRAPNPEWASINLGVVICKLCAGQHRFLGSGISQVRSLKLDSSIWTNE-LVELFLEVGNENANKFWAFNLPLEEELHMGATPEQRATFHRRKYRERKYRRVLGGLHNQEGLNQALCAAVLQSDVLVTMALVFSGADVMCATGDPEHSTPYLL-AQKGGQRLQMEFL 802          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007633.1 (pep scaffold:Pmarinus_7.0:GL488501:137984:146551:-1 gene:ENSPMAG00000006898.1 transcript:ENSPMAT00000007633.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 106.301 bits (264), Expect = 5.127e-24
Identity = 60/181 (33.15%), Postives = 95/181 (52.49%), Query Frame = 3
Query:  804 ILKQIYTNESNKLCADCGYPNPEWVSINLCVILCINCSGLHRSLATSHSRIQSAILDQRIWEDSFLIEIMKKIGNENSNLFWYKNKQNSSTIFPSDLSEINSKYIEKKFIDTEFINLSD-----NEIKNRLRSSVATDDVFLTMKLYH---SIKFPYDSEFIKEILLIARNSNQYLQEKFL 1322
            I  +I+   +N+LCADCG   P W SINLCV++C  C+G HR+L  + S+++S  +D++IW D  LIE+  +IGNE  N FW  N   S  I P+ +     +++  K+   ++    +      E+   L S+V T DV  +M L +    +          + LL+A  + Q LQ + L
Sbjct:  210 IADRIWALPANRLCADCGAAKPAWASINLCVVICKLCAGQHRALGPNISKVRSLKMDKKIWTDD-LIELFVQIGNERVNEFWAANVPPSEEIDPASMPNERREFVVAKYRSGKYRRYHEFFGDQAELNRALCSAVVTSDVLESMALVYCGADVTGAPGCSPDDDPLLLAEQAGQKLQLQML 389          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000232.1 (pep scaffold:Pmarinus_7.0:GL480628:15362:26221:1 gene:ENSPMAG00000000209.1 transcript:ENSPMAT00000000232.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 102.449 bits (254), Expect = 1.588e-23
Identity = 49/147 (33.33%), Postives = 83/147 (56.46%), Query Frame = 3
Query:  705 TFKIRFESSELVNEWKIILSEAINIAFMGGENKILKQIYTNESNKLCADCGYPNPEWVSINLCVILCINCSGLHRSLATSHSRIQSAILDQRIWEDSFLIEIMKKIGNENSNLFWYKNKQNSSTIFPSDLSEINSKYIEKKFIDTEF 1145
            TF    E+    +EW   + ++I  +       + KQI+ NE N+ CADCG   P+W S+NLCV++C  C+G HR+L  + S+++S  +D+ IW  + LIE+ +++GN   N FW  +   S  + PS  +E   +Y+  K+ +  +
Sbjct:  185 TFSFMAENERERDEWLETMRDSIATSL--SHLDVAKQIWANEHNRRCADCGAAWPDWASVNLCVVICKRCAGEHRNLGQTVSKVRSLKMDKNIWTKN-LIELFQELGNAQVNKFWAASVPPSEAVDPSSEAERRREYVFAKYREGRY 328          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Sea Lamprey
Match: acap3b (ArfGAP with coiled-coil, ankyrin repeat and PH domains 3b [Source:ZFIN;Acc:ZDB-GENE-070209-274])

HSP 1 Score: 84.7297 bits (208), Expect = 2.191e-17
Identity = 44/132 (33.33%), Postives = 71/132 (53.79%), Query Frame = 3
Query:  762 SEAINIAFMGGENKILKQIYTNESNKLCADCGYPNPEWVSINLCVILCINCSGLHRSLATSHSRIQSAILDQRIWEDSFLIEIMKKIGNENSNLFWYKNKQNSSTIFPSDLSEINSK--YIEKKFIDTEFIN 1151
            S+A +    G  + +L ++     N+ C DCG P+P W SINL + LCI CSG+HRSL    S+++S  LD   WE   L+++M ++GN   N  +  +  +     P+  S    K  +I  K++D +F+ 
Sbjct:   55 SDARDRGARGCSDNVLARVQAIRGNERCCDCGQPDPRWASINLGIALCIECSGIHRSLGVHCSKVRSLTLDS--WEPE-LLKLMCELGNHVINDIYEASADDVGGKKPTPSSSRQEKEMWIRAKYVDRKFLR 183          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009914.1 (pep scaffold:Pmarinus_7.0:GL476634:533628:626389:1 gene:ENSPMAG00000008958.1 transcript:ENSPMAT00000009914.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 78.1814 bits (191), Expect = 5.679e-15
Identity = 33/74 (44.59%), Postives = 48/74 (64.86%), Query Frame = 3
Query:  828 ESNKLCADCGYPNPEWVSINLCVILCINCSGLHRSLATSHSRIQSAILDQRIWEDSFLIEIMKKIGNENSNLFW 1049
            + N +C DCG PNP+W S+NL  ++CI CSG+HR+L +  SR++S  LD+  W D  L ++M  +GN  S   W
Sbjct:  542 QGNDVCIDCGAPNPDWASLNLGALICIECSGIHRNLGSHVSRVRSLDLDE--WPDE-LAQVMVSVGNAMSRGVW 612          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006444.1 (pep scaffold:Pmarinus_7.0:GL477103:5377:54062:-1 gene:ENSPMAG00000005792.1 transcript:ENSPMAT00000006444.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 73.559 bits (179), Expect = 1.454e-13
Identity = 33/79 (41.77%), Postives = 45/79 (56.96%), Query Frame = 3
Query:  831 SNKLCADCGYPNPEWVSINLCVILCINCSGLHRSLATSHSRIQSAILDQRIWEDSFLIEIMKKIGNENSNLFWYKNKQN 1067
             N  C DC  P+P+W S+NL  ++CI CSG+HR+L T  SR++S  LD    E   L  +M  IGN  +N  W  + Q 
Sbjct:  573 GNAFCVDCDAPSPDWASLNLGALMCIECSGIHRNLGTHLSRVRSLDLDDWPLE---LAAVMLAIGNATANGVWEADTQG 648          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Yeast
Match: GCS1 (ADP-ribosylation factor GTPase activating protein (ARF GAP); involved in ER-Golgi transport; required for prospore membrane formation; regulates phospholipase Spo14p; shares functional similarity with Glo3p; GCS1 has a paralog, SPS18, that arose from the whole genome duplication [Source:SGD;Acc:S000002385])

HSP 1 Score: 60.4622 bits (145), Expect = 6.086e-10
Identity = 26/67 (38.81%), Postives = 39/67 (58.21%), Query Frame = 3
Query:  831 SNKLCADCGYPNPEWVSINLCVILCINCSGLHRSLATSHSRIQSAILDQRIWEDSFLIEIMKKIGNE 1031
            +NK C DCG PNP+W +      +C+ C+G+HR L    S ++S  +DQ   E+   +  M+K GNE
Sbjct:   22 ANKKCMDCGAPNPQWATPKFGAFICLECAGIHRGLGVHISFVRSITMDQFKPEE---LLRMEKGGNE 85          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Yeast
Match: AGE2 (ADP-ribosylation factor (ARF) GTPase activating protein (GAP) effector; involved in Trans-Golgi-Network (TGN) transport; contains C2C2H2 cysteine/histidine motif [Source:SGD;Acc:S000001306])

HSP 1 Score: 58.5362 bits (140), Expect = 1.457e-9
Identity = 29/84 (34.52%), Postives = 49/84 (58.33%), Query Frame = 3
Query:  801 KILKQIYTNESNKLCADCGYP-NPEWVSINLCVILCINCSGLHRSLATSHSRIQSAILDQRIWEDSFLIEIMKKIGNENSNLFW 1049
            K L  +  +  N  CADC    +P W S +L V +CI C+G+HRSL T  S+++S  LD   W++  L+++++   N  +N ++
Sbjct:    9 KALSALLRDPGNSHCADCKAQLHPRWASWSLGVFICIKCAGIHRSLGTHISKVKSVDLD--TWKEEHLVKLIQFKNNLRANSYY 90          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Yeast
Match: GLO3 (ADP-ribosylation factor GTPase activating protein (ARF GAP); involved in ER-Golgi transport; shares functional similarity with Gcs1p [Source:SGD;Acc:S000000924])

HSP 1 Score: 59.6918 bits (143), Expect = 1.592e-9
Identity = 29/86 (33.72%), Postives = 50/86 (58.14%), Query Frame = 3
Query:  801 KILKQIYTNESNKLCADCGYPNPEWVSINLCVILCINCSGLHRSLATSHSRIQSAILDQRIWEDSFLIEIMKKIGNENSNLFWYKN 1058
            ++ +++ +N  N++C DCG  NP W S+   V+LCI CS +HR++    + ++S+ LD+  W  + L    K  GN  +  F+ KN
Sbjct:   17 QVFQKLGSNMENRVCFDCGNKNPTWTSVPFGVMLCIQCSAVHRNMGVHITFVKSSTLDK--WTINNLRRF-KLGGNHKARDFFLKN 99          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Yeast
Match: AGE1 (ADP-ribosylation factor (ARF) GTPase activating protein (GAP) effector; involved in the secretory and endocytic pathways; contains C2C2H2 cysteine/histidine motif [Source:SGD;Acc:S000002932])

HSP 1 Score: 59.3066 bits (142), Expect = 1.789e-9
Identity = 34/77 (44.16%), Postives = 47/77 (61.04%), Query Frame = 3
Query:  762 SEAINIAFMGGENK-----ILKQIYTNESNKLCADCG-YPNPEWVSINLCVILCINCSGLHRSLATSHSRIQSAILD 974
            ++  + A  G  N+     I+++I  ++SN  C DCG     EWVSINL  ILCI CSG+HRSL +  S+I+S  LD
Sbjct:  156 TQHFSFANAGASNRDELLSIVRKI--DKSNLKCCDCGSTATVEWVSINLLCILCIKCSGVHRSLGSHISKIRSLTLD 230          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Yeast
Match: GTS1 (Protein involved in Arf3p regulation and in transcription regulation; localizes to the nucleus and to endocytic patches; contains an N-terminal Zn-finger and ArfGAP homology domain, a C-terminal glutamine-rich region, and a UBA (ubiquitin associated) domain; gts1 mutations affect budding, cell size, heat tolerance, sporulation, life span, ultradian rhythms, endocytosis; expression oscillates in a pattern similar to metabolic oscillations [Source:SGD;Acc:S000003149])

HSP 1 Score: 52.7582 bits (125), Expect = 1.686e-7
Identity = 39/123 (31.71%), Postives = 63/123 (51.22%), Query Frame = 3
Query:  798 NKILKQ-IYTNESNKLCADCGYPNPEWVSINLCVILCINCSGLHRSLATSH-----SRIQSAILDQRIWEDSFLIEIMKKIGNENSNLFWYKNKQNSSTIFPSDLSE-INSKYIEKKFIDTEF 1145
            ++ LK+ I ++E+   C +CG   P W S+NL V LC  C+ +HR +  S      S ++S  +D+   ED  + E++   GN+ +  FW  N +N    F  D  + I   YI  K+I  +F
Sbjct:   14 DRELKELINSSENANKCGECGNFYPTWCSVNLGVFLCGRCASVHRKVFGSRDDDAFSNVKSLSMDRWTRED--IDELVSLGGNKGNARFW--NPKNVPFPFDGDDDKAIVEHYIRDKYILGKF 132          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Nematostella
Match: EDO34673 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNK8])

HSP 1 Score: 102.834 bits (255), Expect = 4.821e-22
Identity = 77/218 (35.32%), Postives = 116/218 (53.21%), Query Frame = 3
Query:  705 TFKIRFESSELVNEWKIILSEAINIAFMGGENKILKQIYTNESNKLCADCGYPNP-EWVSINLCVILCINCSGLHRSLATSHSRIQSAILDQRIWEDSFLIEIMKKIGNENSNLFWYKNKQNSSTIFPSDLSE-----INSKYIEKKF--IDTEFINLSDNEIKNRLRSSVATDDVFLTMKLY---HSIKF-PYDSEFIKEILLIARNSNQYLQEKFL 1322
            TF  + E+   V+ W   +  AI I     +  +L+ ++TN SN+ CADCG  +P    S+N  V +C NC G HRSL ++ S+ +S ++D++IW D  L E+M KIGNEN+N        +   I P   S      I +KY  KK+  I  E+ N+  + +   LR SV TDDV  T +L     ++K+ P DSE  +  L +A  + + LQ + L
Sbjct:  948 TFSFQVENDFEVSSWIEAVQRAIQIGL--SDPAVLEYVFTNPSNRKCADCGNKDPYPHASVNHLVCICGNCCGSHRSLGSNISKPRSLLMDKKIWNDD-LKELMVKIGNENANKLLEFKIPDDDRIRPDADSAKRREFICAKYEYKKYSKILPEYGNV--DVLGQALRESVQTDDVMRTFELIINRVNVKYVPTDSEDQRTPLELAVAAGKNLQAELL 1160          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Nematostella
Match: EDO42956 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S052])

HSP 1 Score: 85.8853 bits (211), Expect = 4.643e-17
Identity = 42/119 (35.29%), Postives = 64/119 (53.78%), Query Frame = 3
Query:  795 ENKILKQIYTNESNKLCADCGYPNPEWVSINLCVILCINCSGLHRSLATSHSRIQSAILDQRIWEDSFLIEIMKKIGNENSNLFWYKNKQNSSTIFPSDLSEINSKYIEKKFIDTEFIN 1151
            E   ++ I     N +C DCG PNP+W S+NL  ++CI CSG+HR++ T  SR++S  LD   W  S +  +M  IGN  +N  W     N     PS   E   ++I  K+ + +F++
Sbjct:  548 EGNDIQAIRAIPGNNICVDCGAPNPDWASLNLGALMCIECSGVHRNIGTHVSRVRSLDLDD--WP-SEVTAVMCSIGNSLANSIWEGRIGNREKPTPSSSREEKERWIRSKYENKDFLS 663          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Nematostella
Match: EDO43007 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZU7])

HSP 1 Score: 78.9518 bits (193), Expect = 7.174e-15
Identity = 41/113 (36.28%), Postives = 64/113 (56.64%), Query Frame = 3
Query:  810 KQIYTNESNKLCADCGYPNPEWVSINLCVILCINCSGLHRSLATSHSRIQSAILDQRIWEDSFLIEIMKKIGNENSNLFWYKNKQNSSTIFPSDLSEINSKYIEKKFIDTEFI 1148
            ++I   E NK CADC  P P+W SINL + +CI CSG+HRS+    S+++S  LD+  W D   +E M+ +GN   N  +  N  +    FP  L+  + K+  + FI  +++
Sbjct:  513 ERIRKVEGNKYCADCSAPRPDWASINLGITVCIECSGVHRSMGVHVSKVRSLTLDK--W-DGDTVEFMEAMGNTKVNKIFEANLND----FPK-LTRDSGKHDRQAFIKLKYV 617          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Nematostella
Match: EDO47919 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKJ9])

HSP 1 Score: 75.8702 bits (185), Expect = 1.756e-14
Identity = 46/116 (39.66%), Postives = 61/116 (52.59%), Query Frame = 3
Query:  807 LKQIYTNESNKLCADCGYPNPEWVSINLCVILCINCSGLHRSLATSHSRIQSAILDQRIWEDSFLIEIMKKIGNENSNLFWYKN----KQNSSTIFPSDLSE--INSKYIEKKFID 1136
            L ++     N  CADCG  +PEW S +  + +CI CSG+HR+L T  S ++S  LD   W D  L + M + GNE SN  W KN     +      P  L E  I +KY  K+FID
Sbjct:    8 LLELAKRPGNNTCADCGAKHPEWASASKGIFICITCSGVHRNLGTQISVVKSLRLD--TWTDERL-QFMIENGNEKSNAIWAKNVPICYRRPKCTDPHVLREQWIRAKYERKEFID 120          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Nematostella
Match: EDO33091 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7ST58])

HSP 1 Score: 70.0922 bits (170), Expect = 3.825e-14
Identity = 41/120 (34.17%), Postives = 60/120 (50.00%), Query Frame = 3
Query:  804 ILKQIYTNESNKLCADCGYPNPEWVSINLCVILCINCSGLHRSLATSHSRIQSAILDQRIWEDSFLIEIMKKIGNENSNLFW-------YKNKQNSSTIFPSDLSEINSKYIEKKFIDTE 1142
            IL  +   E NK CADC    P W S NL V +CI C+G+HR+L    S+++S  LD   W +  +  I +  GN  + L+W       ++  Q  S +     + I  KY +KKFI  +
Sbjct:   19 ILVDMLKEEKNKYCADCAAKGPRWASWNLGVFICIRCAGIHRNLGVHISKVKSVNLDS--WTEEQMASI-QSWGNRRAGLYWECYLPEDFRRPQTDSAM----EAFIRKKYEQKKFIKKD 131          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Medaka
Match: arap3 (ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 3 [Source:NCBI gene;Acc:101162821])

HSP 1 Score: 105.145 bits (261), Expect = 2.437e-22
Identity = 76/302 (25.17%), Postives = 139/302 (46.03%), Query Frame = 3
Query:  261 LIIFKNSNDIISSKRLPINKSIRLQYIDNSNQFLILLGNFQYLFMHSDASIIKNWVNKINTLLLNYEDLQLNYF-------KYAEVRIDSNEASNVSSYILIRSDEYLLHIYENLVEHAQNICSHVINLKFYSLEXXXXXXXXXXXXLKLFGKSITFKIRFESSELVNEWKIILSEAINIAFMGGENKILKQIYTNESNKLCADCGYPNPEWVSINLCVILCINCSGLHRSLATSHSRIQSAILDQRIWEDSFLIEIMKKIGNENSNLFWYKNKQNSSTIFPSDLSEINSKYIEKKFIDTEF 1145
            L+ F +  DI     +P+   I++  +   N+F I+  N  ++F   +  + + WV  +   + +        F       K+  + +   + +    Y  I +D+  LH  E    +   I   VI  +  ++ + +  S        L     +F    ES     +W   L EAI  A    + ++ ++I++N SN++CADC   NP+W SINLCV++C NC+G HRSL +  S++QS  LD  +W +  ++++   +GN+ +N FW  +   S  +      E    +I +K+ +  F
Sbjct:  499 LMYFGSEKDIYPRGVIPL-AVIQMARLAKDNKFEIVTSNRIFVFRTDNEVLRRRWVTTLQEHIRDQLVFGRRRFGPGSHCQKHGVLEL---KGTKSKVYTAISTDQIWLHKSEQCFRNGIGIT--VIEARGATIRDGKHRS------FDLITPYKSFSFTAESERDKRDWMEALQEAI--AETLSDYEVAEKIWSNRSNRMCADCKAVNPDWASINLCVVICKNCAGQHRSLGSMVSKVQSLKLDTSVWSNE-IVQLFIMVGNDRANDFWAAHLSQSEELDCDASPEQRKDFITQKYKEGRF 785          

HSP 2 Score: 76.2554 bits (186), Expect = 1.957e-13
Identity = 55/167 (32.93%), Postives = 86/167 (51.50%), Query Frame = 3
Query: 2022 IDKMITFIITRGLKSEFIFRKVGAVRKINALYELIEKSPNDFFIDPNVYNVNDVASCLKKYFRSFNEPIITDSLFNLFCDACKLENTSSKLAQLEFTVSSMPEINYQVLRKTVELLYMIQKFADENKMDXXXXXXXXXXXXXXEDENHGEISTEILKDLIDYFETVF 2522
            +D  I FI   GL  E I+RK GA  +I  L E   K   +  +    + + DV   LK++FR  ++PI    L   + +A K+     +L + +  + S+P +N   L   +  LY +QK AD N+M +K+L+L  A S+   D   GE   +I++DLID +  VF
Sbjct: 1098 VDSCIAFITQYGLGHEGIYRKNGAKTRIRLLMEEFRKDARNVKLRIGDHFIEDVTDVLKRFFREIDDPIFMAELHAFWQEAAKIPQKRQRLERYKEIIRSLPRVNQTTLAALIGHLYRVQKCADLNQMCTKNLSLLFAPSLFQTD-GKGEHEVKIVEDLIDNYLFVF 1263          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Medaka
Match: arap3 (ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 3 [Source:NCBI gene;Acc:101162821])

HSP 1 Score: 105.145 bits (261), Expect = 2.746e-22
Identity = 76/302 (25.17%), Postives = 139/302 (46.03%), Query Frame = 3
Query:  261 LIIFKNSNDIISSKRLPINKSIRLQYIDNSNQFLILLGNFQYLFMHSDASIIKNWVNKINTLLLNYEDLQLNYF-------KYAEVRIDSNEASNVSSYILIRSDEYLLHIYENLVEHAQNICSHVINLKFYSLEXXXXXXXXXXXXLKLFGKSITFKIRFESSELVNEWKIILSEAINIAFMGGENKILKQIYTNESNKLCADCGYPNPEWVSINLCVILCINCSGLHRSLATSHSRIQSAILDQRIWEDSFLIEIMKKIGNENSNLFWYKNKQNSSTIFPSDLSEINSKYIEKKFIDTEF 1145
            L+ F +  DI     +P+   I++  +   N+F I+  N  ++F   +  + + WV  +   + +        F       K+  + +   + +    Y  I +D+  LH  E    +   I   VI  +  ++ + +  S        L     +F    ES     +W   L EAI  A    + ++ ++I++N SN++CADC   NP+W SINLCV++C NC+G HRSL +  S++QS  LD  +W +  ++++   +GN+ +N FW  +   S  +      E    +I +K+ +  F
Sbjct:  543 LMYFGSEKDIYPRGVIPL-AVIQMARLAKDNKFEIVTSNRIFVFRTDNEVLRRRWVTTLQEHIRDQLVFGRRRFGPGSHCQKHGVLEL---KGTKSKVYTAISTDQIWLHKSEQCFRNGIGIT--VIEARGATIRDGKHRS------FDLITPYKSFSFTAESERDKRDWMEALQEAI--AETLSDYEVAEKIWSNRSNRMCADCKAVNPDWASINLCVVICKNCAGQHRSLGSMVSKVQSLKLDTSVWSNE-IVQLFIMVGNDRANDFWAAHLSQSEELDCDASPEQRKDFITQKYKEGRF 829          

HSP 2 Score: 76.2554 bits (186), Expect = 1.919e-13
Identity = 55/167 (32.93%), Postives = 86/167 (51.50%), Query Frame = 3
Query: 2022 IDKMITFIITRGLKSEFIFRKVGAVRKINALYELIEKSPNDFFIDPNVYNVNDVASCLKKYFRSFNEPIITDSLFNLFCDACKLENTSSKLAQLEFTVSSMPEINYQVLRKTVELLYMIQKFADENKMDXXXXXXXXXXXXXXEDENHGEISTEILKDLIDYFETVF 2522
            +D  I FI   GL  E I+RK GA  +I  L E   K   +  +    + + DV   LK++FR  ++PI    L   + +A K+     +L + +  + S+P +N   L   +  LY +QK AD N+M +K+L+L  A S+   D   GE   +I++DLID +  VF
Sbjct: 1142 VDSCIAFITQYGLGHEGIYRKNGAKTRIRLLMEEFRKDARNVKLRIGDHFIEDVTDVLKRFFREIDDPIFMAELHAFWQEAAKIPQKRQRLERYKEIIRSLPRVNQTTLAALIGHLYRVQKCADLNQMCTKNLSLLFAPSLFQTD-GKGEHEVKIVEDLIDNYLFVF 1307          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Medaka
Match: ENSORLT00000045891.1 (ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 2 [Source:NCBI gene;Acc:105356443])

HSP 1 Score: 100.138 bits (248), Expect = 8.322e-21
Identity = 62/208 (29.81%), Postives = 105/208 (50.48%), Query Frame = 3
Query:  723 ESSELVNEWKIILSEAINIAFMGGENKILKQIYTNESNKLCADCGYPNPEWVSINLCVILCINCSGLHRSLATSHSRIQSAILDQRIWEDSFLIEIMKKIGNENSNLFWYKNKQNSSTIFPSDLSEINSKYIEKKFIDTEFINLSDN-----EIKNRLRSSVATDDVFLTMKLYHS---IKFPYDSEFIKEILLIARNSNQYLQEKFL 1322
            ES +   EW   + E+I       + ++ ++I+ NE+N+ CADC  P PEW S NL V++C  C+G HR L  S S+++S  LD  IW +  L+E   ++GN+ +N FW  N      +     +E  + +I +K+ + ++  L +      ++   L +SV T DV  TM L  +   +             L+A+ + Q +Q +FL
Sbjct:  616 ESEQEKAEWVEAIQESIVETL--SDYEVAEKIWFNEANRSCADCRAPQPEWASTNLGVVICKKCAGQHRFLGPSISKVRSLKLDSSIWSNE-LVEFFLEVGNKKANSFWAANLPLEEELHIGASTEQRATFIRRKYKERKYRRLLEGFEYVVQLNQALCASVVTPDVLQTMALVFTGANVMCATGDPTYSTPYLLAQRAGQKVQMEFL 820          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Medaka
Match: ENSORLT00000040486.1 (arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1 [Source:NCBI gene;Acc:101156673])

HSP 1 Score: 93.2041 bits (230), Expect = 9.618e-19
Identity = 65/213 (30.52%), Postives = 110/213 (51.64%), Query Frame = 3
Query:  705 TFKIRFESSELVNEWKIILSEAINIAFMGGENKILKQIYTNESNKLCADCGYPNPEWVSINLCVILCINCSGLHRSLATSHSRIQSAILDQRIWEDSFLIEIMKKIGNENSNLFWYKNKQNSSTIFPSDLSEINSKYIEKKFIDTEF-----INLSDNEIKNRLRSSVATDDVFLTMKLYHSIK--FPYDSEFIKEILLIARNSNQYLQEKFL 1322
            T  +  ES++ +  W   L  AI  A     +++  ++  N  NK+CADCG  NP+W S+NL + +C +C+  HR+L+++ S+++S +LD +IW +  +I++    GN+ +N  W      +  + P    E  SK+I+ K+    +     ++ S   ++ RL   V T D+  TM L  S     P D +    I L A  +NQ LQ +FL
Sbjct:  479 TLNLTVESNKDLTTWLNCLEAAICSALSC--SQVALRLRENPHNKVCADCGEANPDWASVNLLLSICKSCADHHRNLSSNLSKVRS-MLDTKIWTEP-IIQLFVTYGNKLANQVWAPAVPAAEQLHPKSTDEERSKFIQDKYSRGRYRRVHPLSSSRAMMEQRLCQVVCTSDLEETMSLICSGAKVCPSDPQSPSPISL-AEKANQALQMQFL 686          

HSP 2 Score: 67.0106 bits (162), Expect = 1.173e-10
Identity = 39/128 (30.47%), Postives = 63/128 (49.22%), Query Frame = 3
Query: 2022 IDKMITFIITRGLKSEFIFRKVGAVRKINALYELIEKSPNDFFIDPNVYNVNDVASCLKKYFRSFNEPIITDSLFNLFCDACKLENTSSKLAQLEFTVSSMPEINYQVLRKTVELLYMIQKFADENKM 2405
            I++ I+ I T GLK E ++R+ G   K+N L E ++ SPN   ++ +   V D  S LKKY R   + I+  +    +  A    + S +  +    +  +P+ N   L       YM+Q F+ ENKM
Sbjct:  921 IERCISHITTYGLKVEGVYRRCGLATKVNKLVEALKTSPNSAPLEGDEQGVLDACSALKKYIRD-QDSIVPTTQRQRWLQAAANPDESCRFKEYRRLLRQLPDNNKATLNALFGHFYMVQVFSQENKM 1047          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Medaka
Match: acap2 (ArfGAP with coiled-coil, ankyrin repeat and PH domains 2 [Source:NCBI gene;Acc:101158345])

HSP 1 Score: 92.0485 bits (227), Expect = 1.546e-18
Identity = 50/144 (34.72%), Postives = 77/144 (53.47%), Query Frame = 3
Query:  789 GGENK--------ILKQIYTNESNKLCADCGYPNPEWVSINLCVILCINCSGLHRSLATSHSRIQSAILDQRIWEDSFLIEIMKKIGNENSNLFWYKNKQ--NSSTIFPSDLSEINSKYIEKKFIDTEFINL-SDNEIKNRLRS 1187
            GGE K         L+++     N  C DCG P+P W SINL + LCI CSG+HRSL    S+++S  LD   WE   L+++M ++GN+  N  +   ++   +    P D       YI+ K++D  F+   SD E++N++ S
Sbjct:  391 GGEPKERLLKGESALQKVLAIPGNSCCCDCGQPDPRWASINLGITLCIQCSGIHRSLGVHFSKVRSLTLDS--WEPE-LLKLMCELGNKAINEIYEARREELGARKPQPGDPRHEVEAYIKAKYVDRRFVRRPSDEELRNKVVS 531          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Planmine SMEST
Match: SMESG000070668.1 (SMESG000070668.1)

HSP 1 Score: 1954.1 bits (5061), Expect = 0.000e+0
Identity = 1001/1022 (97.95%), Postives = 1006/1022 (98.43%), Query Frame = 3
Query:  153 MTVTCLSEIEDNILIHSNLKVNGSGCDCYCALIKYRLIIFKNSNDIISSKRLPINKSIRLQYIDNSNQFLILLGNFQYLFMHSDASIIKNWVNKINTLLLNYEDLQLNYFKYAEVRIDSNEASNVSSYILIRSDEYLLHIYENLVEHAQNICSHVINLKFYSLEXXXXXXXXXXXXLKLFGKSITFKIRFESSELVNEWKIILSEAINIAFMGGENKILKQIYTNESNKLCADCGYPNPEWVSINLCVILCINCSGLHRSLATSHSRIQSAILDQRIWEDSFLIEIMKKIGNENSNLFWYKNKQNSSTIFPSDLSEINSKYIEKKFIDTEFINLSDNEIKNRLRSSVATDDVFLTMKLYHSIKFPYDSEFIKEILLIARNSNQYLQEKFLSVQPDLSNSIQDQTIIKDKIFKISYNNEEKLADLFSVSLLCTCISINIEELLTPAIYINICCIYYTDIELIWYDSTNESLVITLFNNCQFFKNPKSRTSKKYPITVHRLSFFDQSNVIKQFQLDLFKLLMPNHFVELTFNSNLFMNLEVKLNENNTIKCKSHVDEQGIIFYFPIAIIFDLKNSTKIQLIDDKIISIKFNNDQIEIVTNNFGSQNLVYNYLNLFTNQRPIMFNPIDKMITFIITRGLKSEFIFRKVGAVRKINALYELIEKSPNDFFIDPNVYNVNDVASCLKKYFRSFNEPIITDSLFNLFCDACKLENTSSKLAQLEFTVSSMPEINYQVLRKTVELLYMIQKFADENKMDXXXXXXXXXXXXXXEDENHGEISTEILKDLIDYFETVFGYSPKERTALIKHIENPVEKEPIIIREFYIHPFLKNFLLIPTNENKRVGFLDRGISFSMIRMTINQCATVKQVVQKLFRNLEVELWNFQTKTTRFGNKTLKRFVNLNENTENSIVCPRKISDCYENYFVFLPKQSNADRNIRCLFKCEIKLKLENYRDFTLNLQYPNSYEFFPRNQTLESNFKLPWTDVKVLRYHMRNVNKIIMLSENGIYKCNFCNTETLREFLIFFDQFK 3218
            MTVTCLSEIEDNILIHSNLKVNGSGCDCYCALIKYRLIIFKNSNDIISSKRLPINKSIRLQYIDNSNQFLILLGNFQYLFM+SDASIIKNWVNKINTLLLNYEDLQLNYFKYAEVRIDSNEASNVSSYILIRSDEYLLHIYENL EHAQNICSHVINLKFYSLENSRS SSVNNRCLKLFGKSITFKI+FESSELVNEWKIILSEAINIAFMGGENKILKQIYTNESNKLCADCGYPNPEWVSINLCVILCI+CSGLHRSLATSHSRIQSAILDQRIWEDSFLIEIMKKIGNENSNLFW KNKQ  S IFPSDLSEINSKYIEKKFIDTEFINLSDNEIKNRLRSSVATDDVFLTMKLYHSIKFPYDSEFIKEILLIARNSNQYLQEKFLSVQPDLSN IQDQTIIK+KIFKISYNNEEKLADLFSVSLLCTCISINIEEL+TPAIYINICCIYYTDIELIWYDSTNESLVITLFNNCQFFKNPKSRTSKK PITVHRLSFFDQSNVIKQFQLDLFKLLMPNHFVELTFNSNLFMNLEVKLNENNTIKCKSHVDEQGIIFYFPIAIIFDLKNSTKIQLIDDKIISIKFNNDQIEI TNNFGSQNLVYNYLNLFTNQRPIMFNPIDKMITFIITRGLKSEFIFRKVGAVRKINALYELIEKSPNDFFIDPNVYNVNDVASC KKYFRSFNEPIITDSLFNLFCDACKLENTSSKLAQLEFTVSSMPEINYQVL KTVELLYMIQKFADENKMDSKSLALSTALSIISEDENH EISTEILKDLIDYFETVFGYSPKERTALIKHIENPVEKEPIIIREFYIHPFLKNFLLIPTNENKRVGFLDRGISFSMIRMTINQCATVKQVVQKLFRN E ELWNFQ KTTRFGNKTLKRFVNLNENTENSIVCPRKISDCYENYFVFLPKQSNADRNIRCLFKCEIKLKLENYRDFTLNLQYPNSYEFFPRNQTLESNFKLPWT VKVLRYHMRNVNKIIMLSENGIYKCNFCNTETLREFLIFFDQFK
Sbjct:    1 MTVTCLSEIEDNILIHSNLKVNGSGCDCYCALIKYRLIIFKNSNDIISSKRLPINKSIRLQYIDNSNQFLILLGNFQYLFMNSDASIIKNWVNKINTLLLNYEDLQLNYFKYAEVRIDSNEASNVSSYILIRSDEYLLHIYENLDEHAQNICSHVINLKFYSLENSRSLSSVNNRCLKLFGKSITFKIKFESSELVNEWKIILSEAINIAFMGGENKILKQIYTNESNKLCADCGYPNPEWVSINLCVILCISCSGLHRSLATSHSRIQSAILDQRIWEDSFLIEIMKKIGNENSNLFWNKNKQKLSIIFPSDLSEINSKYIEKKFIDTEFINLSDNEIKNRLRSSVATDDVFLTMKLYHSIKFPYDSEFIKEILLIARNSNQYLQEKFLSVQPDLSNFIQDQTIIKEKIFKISYNNEEKLADLFSVSLLCTCISINIEELVTPAIYINICCIYYTDIELIWYDSTNESLVITLFNNCQFFKNPKSRTSKKNPITVHRLSFFDQSNVIKQFQLDLFKLLMPNHFVELTFNSNLFMNLEVKLNENNTIKCKSHVDEQGIIFYFPIAIIFDLKNSTKIQLIDDKIISIKFNNDQIEIATNNFGSQNLVYNYLNLFTNQRPIMFNPIDKMITFIITRGLKSEFIFRKVGAVRKINALYELIEKSPNDFFIDPNVYNVNDVASCFKKYFRSFNEPIITDSLFNLFCDACKLENTSSKLAQLEFTVSSMPEINYQVLLKTVELLYMIQKFADENKMDSKSLALSTALSIISEDENHREISTEILKDLIDYFETVFGYSPKERTALIKHIENPVEKEPIIIREFYIHPFLKNFLLIPTNENKRVGFLDRGISFSMIRMTINQCATVKQVVQKLFRNFEFELWNFQNKTTRFGNKTLKRFVNLNENTENSIVCPRKISDCYENYFVFLPKQSNADRNIRCLFKCEIKLKLENYRDFTLNLQYPNSYEFFPRNQTLESNFKLPWTGVKVLRYHMRNVNKIIMLSENGIYKCNFCNTETLREFLIFFDQFK 1022          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Planmine SMEST
Match: SMESG000070925.1 (SMESG000070925.1)

HSP 1 Score: 806.209 bits (2081), Expect = 0.000e+0
Identity = 461/1035 (44.54%), Postives = 685/1035 (66.18%), Query Frame = 3
Query:  153 MTVTCLSEIEDNILIHSNLKVN-GSGCDCYCALIKYRLIIFKNSNDIISSKRLPINKSIRLQYIDNSNQFLILLGNFQYLFMHSDASIIKNWVNKINTLLLNYEDLQ-LNYFKYAEVRIDSNEASNVSSYILIRSDEYLLHIYENLVEHAQNICSHVINLKFYSLEXXXX----XXXXXXXXLKLFGKSITFKIRFESSELVNEWKIILSEAINIAFMGGENKILKQIYTNESNKLCADCGYPNPEWVSINLCVILCINCSGLHRSLATSHSRIQSAILDQRIWEDSFLIEIMKKIGNENSNLFWYKNKQNSSTIFPSDLSEINSKYIEKKFIDTEFINLSDNEIKNRLRSSVATDDVFLTMKLYHSIKFPYDSEFIKEILLIARNSNQYLQEKFLSVQPDLSNSIQDQTIIKDKIFKISYNNEEKLADLFSVSLLCTCISINIEE-LLTPAIYINICCIYYTDIELIWYDSTNESLVITLFNNCQF--FKNPKSRTSKKYPITVHRLSFFDQS-NVIKQFQLDLFKLLMPNHFVELTFNSNLFMNLEVKLNENNTIKCKSHVDEQGIIFYFPIAIIFDLKNSTKIQLIDD-KIISIKFNNDQIEIVTNNFGSQNLVYNYLNLFTNQRPIMFNPIDKMITFIITRGLKSEFIFRKVGAVRKINALYELIEKSPNDFFIDPNVYNVNDVASCLKKYFRSFNEPIITDSLFNLFCDACKLENTSSKLAQLEFTVSSMPEINYQVLRKTVELLYMIQKFADENKMDXXXXXXXXXXXXXXEDENHGEISTEILKDLIDYFETVFGYSPKERTALIKHIENPVEKEPIIIREFYIHPFLKNFLLIPTNENKRVGFLDRGISFSMIRMTINQCATVKQVVQKLFRNLEVELWNFQTKTTRFGNKTLKRFVNLNENTENSIVCPRKISDCYENYFVFLPKQSNADRNIRCLFKCEIKLKLENYRDFTLNLQYPNSYEFF-PRNQTLESNFKLPWTDVKVLRYHMRNVNKI-IMLSENGIYKCNFCNTETLREFLIFFDQFK 3218
            M++ CLSE+E+  + HS+L ++     + YC LI+  +IIFK S DIIS KRLPI    +++  +  +QF I++    + F   D +II+ W+  +N L+ N+   + L  + YAEV+ID    S V  +IL+  ++Y L I+ +L EH+ NI +HV+N KFYS++N        S    + L L GK ++FKI F+    + EW+ IL +A+  AF   EN++L +IY NESN+ CADCG P+PEW+SINL VI+CINC+G+HRS  TS SRIQSA+LD+ IW DS+LI+I+K IGNE SN FWYKN++  ++        + +KY+ KKFID EFINLS+ + K+ L+ SVA DDVFLTM+L+HSI F Y+SEF++E+L IARNSNQ+LQEKFLSVQP+ S + ++     +K+F+ISYN+ EKL  LF V+L    ISI +E+ ++TP   +N+C I+Y +I L+WYD   ESL+I++   C F  F N K   + +  I ++R++FF QS  ++  F+ +L KLLMP+ F+ +   S LFM+L VK N  +  KCKS + +  IIF  PI+ ++DLK S K  LID+ K I IKF  D +E+   N  +Q ++Y Y+   +    ++ +PI+KMI+FII+RGLKSE IFR  G ++K+N L++ IEKS N+FFIDP +YNV DV+SCLKKYFRS +EPIIT +LF++F  A   EN S K+   +  +S +P  NY V R  +EL YMIQ    + +MD  SLA+S + S IS D  + EIS++I+K+LI+ F  +F YS K+   L + +  P      IIR FYIHP + N + I  +E+K++ F+D+  +F  + + +++  TVKQ++++LF +  VELW+F +K TRF  KT+KR +  ++   +SI+ PR I   Y++YFVF  K++++   +R L++CE+KLK + Y +FTL + +PN+ +FF  ++++L+ ++    +DV V R+H +N+ KI I+   NG  KC F + E L+EFL F+DQF+
Sbjct:    1 MSLLCLSELEEQHIFHSSLILHLKQQSNMYCVLIESYMIIFKKSTDIISFKRLPITNKTKVECNEFGDQFSIIIRENTFTFSSPDVTIIETWIKNLNFLIGNFVLTKPLIDYNYAEVKIDQIGGSIV--FILLFCNDYNLIIFSSLKEHSDNIVTHVVNCKFYSVKNDSRDNSIASRSTIKSLVLIGKHLSFKISFKDESTLKEWECILLKAVKTAFGINENEVLTEIYENESNRCCADCGSPDPEWISINLSVIICINCAGIHRSFGTSFSRIQSAVLDECIWSDSYLIKILKTIGNEKSNSFWYKNQRKLTSTSTDYSLFVKNKYVSKKFIDDEFINLSEYDFKSHLQKSVAADDVFLTMRLWHSINFDYNSEFVEELLEIARNSNQFLQEKFLSVQPNSSKNFRNTITQNEKVFQISYNDSEKLKKLFLVTLSNNGISITMEDVIVTPVKLLNVCFIFYDNINLVWYDHDIESLIISINPQCNFNKFTNGKPINNCQ-QIDINRMAFFSQSKQILMDFRFELMKLLMPDEFINVNDESILFMDLYVKKNFESLSKCKSFIVDHEIIFSSPISALYDLKKSEKCDLIDEKKSIQIKFKVDYLELHAGNSENQKIIYTYIKRASKCLELLMDPINKMISFIISRGLKSEGIFRICGTIKKVNILHKSIEKSGNNFFIDPLIYNVYDVSSCLKKYFRSLDEPIITSNLFDIFRGALIEENQSRKITLYKEGLSFLPRDNYSVFRDLLELFYMIQMSVTDTRMDCSSLAISVSSSFISFDHINTEISSKIMKELIENFIALFDYSGKKINDLERFVAGPEIVAQKIIRNFYIHPNI-NSVTIRNSESKKLNFIDKDANFVSVIINVDEYVTVKQIIERLFTDSNVELWHFLSKETRFSFKTIKRLIFPSDGIHDSILYPRTIL-TYDSYFVFRTKRNSSHVPLRQLYQCEVKLKTDKYHEFTLLMNFPNTLQFFNHKSRSLDPDYNFLLSDVIVFRFHTKNIAKIFILFGTNGFLKCKFDSNEVLQEFLSFYDQFR 1030          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Planmine SMEST
Match: SMESG000070925.1 (SMESG000070925.1)

HSP 1 Score: 733.021 bits (1891), Expect = 0.000e+0
Identity = 409/891 (45.90%), Postives = 600/891 (67.34%), Query Frame = 3
Query:  579 NLVEHAQNICSHVINLKFYSLEXXXX----XXXXXXXXLKLFGKSITFKIRFESSELVNEWKIILSEAINIAFMGGENKILKQIYTNESNKLCADCGYPNPEWVSINLCVILCINCSGLHRSLATSHSRIQSAILDQRIWEDSFLIEIMKKIGNENSNLFWYKNKQNSSTIFPSDLSEINSKYIEKKFIDTEFINLSDNEIKNRLRSSVATDDVFLTMKLYHSIKFPYDSEFIKEILLIARNSNQYLQEKFLSVQPDLSNSIQDQTIIKDKIFKISYNNEEKLADLFSVSLLCTCISINIEE-LLTPAIYINICCIYYTDIELIWYDSTNESLVITLFNNCQF--FKNPKSRTSKKYPITVHRLSFFDQS-NVIKQFQLDLFKLLMPNHFVELTFNSNLFMNLEVKLNENNTIKCKSHVDEQGIIFYFPIAIIFDLKNSTKIQLIDD-KIISIKFNNDQIEIVTNNFGSQNLVYNYLNLFTNQRPIMFNPIDKMITFIITRGLKSEFIFRKVGAVRKINALYELIEKSPNDFFIDPNVYNVNDVASCLKKYFRSFNEPIITDSLFNLFCDACKLENTSSKLAQLEFTVSSMPEINYQVLRKTVELLYMIQKFADENKMDXXXXXXXXXXXXXXEDENHGEISTEILKDLIDYFETVFGYSPKERTALIKHIENPVEKEPIIIREFYIHPFLKNFLLIPTNENKRVGFLDRGISFSMIRMTINQCATVKQVVQKLFRNLEVELWNFQTKTTRFGNKTLKRFVNLNENTENSIVCPRKISDCYENYFVFLPKQSNADRNIRCLFKCEIKLKLENYRDFTLNLQYPNSYEFF-PRNQTLESNFKLPWTDVKVLRYHMRNVNKI-IMLSENGIYKCNFCNTETLREFLIFFDQFK 3218
            +L EH+ NI +HV+N KFYS++N        S    + L L GK ++FKI F+    + EW+ IL +A+  AF   EN++L +IY NESN+ CADCG P+PEW+SINL VI+CINC+G+HRS  TS SRIQSA+LD+ IW DS+LI+I+K IGNE SN FWYKN++  ++        + +KY+ KKFID EFINLS+ + K+ L+ SVA DDVFLTM+L+HSI F Y+SEF++E+L IARNSNQ+LQEKFLSVQP+ S + ++     +K+F+ISYN+ EKL  LF V+L    ISI +E+ ++TP   +N+C I+Y +I L+WYD   ESL+I++   C F  F N K   + +  I ++R++FF QS  ++  F+ +L KLLMP+ F+ +   S LFM+L VK N  +  KCKS + +  IIF  PI+ ++DLK S K  LID+ K I IKF  D +E+   N  +Q ++Y Y+   +    ++ +PI+KMI+FII+RGLKSE IFR  G ++K+N L++ IEKS N+FFIDP +YNV DV+SCLKKYFRS +EPIIT +LF++F  A   EN S K+   +  +S +P  NY V R  +EL YMIQ    + +MD  SLA+S + S IS D  + EIS++I+K+LI+ F  +F YS K+   L + +  P      IIR FYIHP + N + I  +E+K++ F+D+  +F  + + +++  TVKQ++++LF +  VELW+F +K TRF  KT+KR +  ++   +SI+ PR I   Y++YFVF  K++++   +R L++CE+KLK + Y +FTL + +PN+ +FF  ++++L+ ++    +DV V R+H +N+ KI I+   NG  KC F + E L+EFL F+DQF+
Sbjct:   14 SLKEHSDNIVTHVVNCKFYSVKNDSRDNSIASRSTIKSLVLIGKHLSFKISFKDESTLKEWECILLKAVKTAFGINENEVLTEIYENESNRCCADCGSPDPEWISINLSVIICINCAGIHRSFGTSFSRIQSAVLDECIWSDSYLIKILKTIGNEKSNSFWYKNQRKLTSTSTDYSLFVKNKYVSKKFIDDEFINLSEYDFKSHLQKSVAADDVFLTMRLWHSINFDYNSEFVEELLEIARNSNQFLQEKFLSVQPNSSKNFRNTITQNEKVFQISYNDSEKLKKLFLVTLSNNGISITMEDVIVTPVKLLNVCFIFYDNINLVWYDHDIESLIISINPQCNFNKFTNGKPINNCQ-QIDINRMAFFSQSKQILMDFRFELMKLLMPDEFINVNDESILFMDLYVKKNFESLSKCKSFIVDHEIIFSSPISALYDLKKSEKCDLIDEKKSIQIKFKVDYLELHAGNSENQKIIYTYIKRASKCLELLMDPINKMISFIISRGLKSEGIFRICGTIKKVNILHKSIEKSGNNFFIDPLIYNVYDVSSCLKKYFRSLDEPIITSNLFDIFRGALIEENQSRKITLYKEGLSFLPRDNYSVFRDLLELFYMIQMSVTDTRMDCSSLAISVSSSFISFDHINTEISSKIMKELIENFIALFDYSGKKINDLERFVAGPEIVAQKIIRNFYIHPNI-NSVTIRNSESKKLNFIDKDANFVSVIINVDEYVTVKQIIERLFTDSNVELWHFLSKETRFSFKTIKRLIFPSDGIHDSILYPRTIL-TYDSYFVFRTKRNSSHVPLRQLYQCEVKLKTDKYHEFTLLMNFPNTLQFFNHKSRSLDPDYNFLLSDVIVFRFHTKNIAKIFILFGTNGFLKCKFDSNEVLQEFLSFYDQFR 901          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Planmine SMEST
Match: SMESG000006535.1 (SMESG000006535.1)

HSP 1 Score: 125.561 bits (314), Expect = 8.788e-29
Identity = 153/582 (26.29%), Postives = 249/582 (42.78%), Query Frame = 3
Query:  159 VTCLSEIEDN--ILIHSNL-----KVNGSGCDCYCALIKYRLIIFKNSNDIISSKRLPINKSIRLQYID--------NSNQFLILLGNFQYLFMHSDASIIKNWVNKINTLLLNYEDLQLNYFKYAEVRIDSNEASNVSS-YILIRSDEYLLHIYENLVEHAQNICSHVINLKFYSLEXXXXXXXXXXXXLKLFGKSITFKIRFESSELVNEW----KIILSEAINIA----FMGGENKILKQIYTNESNKLCADCGYPNPEWVSINLCVILCINCSGLHRSLATSHSRIQSAILDQRIWEDSFLIEIMKKIGNENSNLFWYKNKQNSSTIFPSDLSEINSKYIEKKFIDTE---FINLSDNEIKNR-LRSSVATDDVFLTMKLYHSIKFPYDSEFIKE-----ILLIARNSNQYLQEKFL-----------------SVQPDLSNSIQDQTIIKDKIF-KISYNNEEKLADLFSVSLLC-TCISINIEELLTPAIYINICCIYYTDIELIWYDSTNESLVITL---FNNCQFFKNPKSRTSKKYPITVHRLSFFDQSNVIKQFQLDLFKLLMPNHFVELTF 1739
            + C SE +DN  +  H  +     K+  S    Y  L+  +LI+F+     +S  ++P+     + ++D        + N+F +      + F  S       W+N I  L+  Y+  Q++    + +        NV    I     ++ +  Y+N  +    I  H I L+   ++   + S+     L L      +K+ FES  L NEW     II+ +AI+         GE+ I+++I  N SN+ CA+C   + EW S+NL + LC  CSGLHR +  + S+IQ    D+  WE+  LI I + IGN N+N FW  N          D   IN KY  K+F + +   F    D++  NR L   V T+++  TM+L+H      D  ++ E      L  A   +Q LQ  +L                 S+ PD  N+   QT  + K +  I+ N +E     F + L+  +CI I             +C I + +I LI  +  NES  I+L        +   P         I+V  +S  DQSN ++ F+  + + L PN     ++
Sbjct:   97 LPCFSEFDDNDRLEYHGPIVQIVQKLTSSRKSRYAVLMSNKLILFEKPEHKVSKVQIPLKSMKGIDWVDSVNCSNKDDCNKFKLETPVKSFKFQCSSHENAGKWINHIGKLI--YDKQQIDESDNSHLLKALVSLENVKGKRIFTIEPKFTIAYYDNDEDFKYGIAMHRIQLRSSGVKRDGNDSNS----LSLITSYRRYKLTFESINLCNEWFHQITIIIQKAISATCSRNARPGED-IMREINKNASNRFCAECKSTDIEWASVNLFITLCAKCSGLHRKMGPNISKIQGIFTDESTWENGNLIRIFQIIGNNNANKFWLANFDGEQPEI--DYRFINDKYSRKRFSERKEAIFDKYKDSQALNRELIECVKTENIIRTMQLFH---IGADINYVSEPSGLNALETAGKYHQMLQLTYLNSQCKCQIRDWRSDLFDSIDPDPDNT--KQTPYQGKYWLSINQNPKE-----FRIILIWKSCIQI------LDCSNKEVCKILFRNICLI-REKLNESEGISLVIVVQETDYSTKPADYVESG--ISVIEISSADQSNNLRDFKNAIGQNLSPNFVPSFSY 650          

HSP 2 Score: 74.3294 bits (181), Expect = 4.266e-13
Identity = 71/260 (27.31%), Postives = 123/260 (47.31%), Query Frame = 3
Query: 2019 PIDKMITFIITRGLKSEFIFRKVGAVRKINALYELIEKSPNDFFI---DPNVYNVNDVASCLKKYFRSFNEPIITDSLFNLFCDACKLENTSSKLAQLEFTVSSMPEINYQVLRKTVELLYMIQKFADENKMDXXXXXXXXXX-XXXXEDENHGEISTEILKDLIDYFETVFGYSPKERTALIK-------HIENPVEKEPIIIREFYIHPFLKNFLLIPTNENKRVGFLDRGISFSMI--RMTINQCATVKQVVQKLFR 2759
            P+ KMI  +   G + E +FRKVG+V++   +Y+ +   PN + +   DP      DVAS LK +FR   +P++T   +  +  A  + ++  K    +  ++ +P INYQ LR  + LL  I K  D  +M+  +L+ S     I   D+     + +IL  LI  ++ +F  + +E   + K        I++    E  ++R+ YI P L+ FL    N  +  G         ++  ++ I Q  T K +  KLF+
Sbjct:  772 PVSKMIRHLQLHGTQIEGLFRKVGSVKEAERIYDQLISDPNSYVLTNSDPY-----DVASALKLFFRKLEDPLLTKLYYENWIAAVDIRDSEKKFEYFKEIINKLPVINYQTLRLLIFLLVNIDKNNDVTQMNPDNLSTSFNTCLISGSDQMFNAKNLQILPYLIRNYQDLFDVT-QEELEMEKLYNKERMKIKDFTPLEISLLRQIYILPELERFLKPDINFERESGHKKTDFFKELLTKQLRIEQSMTSKSLFGKLFK 1025          
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Planmine SMEST
Match: SMESG000018614.1 (SMESG000018614.1)

HSP 1 Score: 82.8037 bits (203), Expect = 9.827e-16
Identity = 46/124 (37.10%), Postives = 69/124 (55.65%), Query Frame = 3
Query:  801 KILKQIYTNESNKLCADCGYPNPEWVSINLCVILCINCSGLHRSLATSHSRIQSAILDQRIWEDSFLIEIMKKIGNENSNLFWYKNKQNSSTIFPSDL--SEINS------KYIEKKFIDTEFI 1148
            K++++I     N  CADCG P P+W S+NL  ++CI CSG+HR L T  SR++S  LDQ  W   +   +MK IGN  +N  W    + +  + P +L   E+NS      ++I  K+   EF+
Sbjct:  659 KMIQEIGFVSGNDFCADCGQPKPDWASLNLGELVCIECSGVHRKLGTHISRVRSLQLDQ--WAPEWQA-VMKAIGNTVANTVW----EAAVNVSPRNLKKPELNSPAKDKEEWIRSKYERREFL 775          
The following BLAST results are available for this feature:
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ARAP24.422e-2533.64ArfGAP with RhoGAP domain, ankyrin repeat and PH d... [more]
ARAP11.648e-2426.84ArfGAP with RhoGAP domain, ankyrin repeat and PH d... [more]
ARAP11.720e-2426.84ArfGAP with RhoGAP domain, ankyrin repeat and PH d... [more]
ARAP11.787e-2426.84ArfGAP with RhoGAP domain, ankyrin repeat and PH d... [more]
ARAP11.904e-2426.84ArfGAP with RhoGAP domain, ankyrin repeat and PH d... [more]
back to top
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cnt-16.140e-1735.54Arf-GAP with ANK repeat and PH domain-containing p... [more]
cnt-18.720e-1735.54Arf-GAP with ANK repeat and PH domain-containing p... [more]
cnt-19.168e-1735.54Arf-GAP with ANK repeat and PH domain-containing p... [more]
cnt-21.502e-1635.61Arf-GAP with ANK repeat and PH domain-containing p... [more]
cnt-21.510e-1635.61Arf-GAP with ANK repeat and PH domain-containing p... [more]
back to top
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CenG1A2.045e-1531.21gene:FBgn0028509 transcript:FBtr0080546[more]
CenG1A2.291e-1531.21gene:FBgn0028509 transcript:FBtr0080547[more]
CenG1A2.334e-1531.21gene:FBgn0028509 transcript:FBtr0080548[more]
CenB1A6.997e-1436.70gene:FBgn0039056 transcript:FBtr0084368[more]
CenB1A8.808e-1436.70gene:FBgn0039056 transcript:FBtr0084369[more]
back to top
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CR387919.13.716e-2232.26zmp:0000000660 [Source:NCBI gene;Acc:559690][more]
CR387919.13.716e-2232.26zmp:0000000660 [Source:NCBI gene;Acc:559690][more]
FO704810.15.136e-2027.20arf-GAP with Rho-GAP domain, ANK repeat and PH dom... [more]
arap36.930e-2033.33ArfGAP with RhoGAP domain, ankyrin repeat and PH d... [more]
arap1a6.132e-1932.00ArfGAP with RhoGAP domain, ankyrin repeat and PH d... [more]
back to top
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ccn41.277e-2331.14cellular communication network factor 4 [Source:Xe... [more]
itgav2.523e-1723.53integrin subunit alpha V [Source:Xenbase;Acc:XB-GE... [more]
itgav2.673e-1723.53integrin subunit alpha V [Source:Xenbase;Acc:XB-GE... [more]
itgav2.818e-1723.53integrin subunit alpha V [Source:Xenbase;Acc:XB-GE... [more]
ikzf23.002e-1733.51IKAROS family zinc finger 2 [Source:Xenbase;Acc:XB... [more]
back to top
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Arap22.627e-2534.11ArfGAP with RhoGAP domain, ankyrin repeat and PH d... [more]
Arap12.484e-2222.73ArfGAP with RhoGAP domain, ankyrin repeat and PH d... [more]
Arap12.544e-2223.20ArfGAP with RhoGAP domain, ankyrin repeat and PH d... [more]
Arap12.779e-2223.20ArfGAP with RhoGAP domain, ankyrin repeat and PH d... [more]
Arap32.496e-1826.95ArfGAP with RhoGAP domain, ankyrin repeat and PH d... [more]
back to top
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8WZ64|ARAP2_HUMAN2.124e-2433.64Arf-GAP with Rho-GAP domain, ANK repeat and PH dom... [more]
sp|Q8BZ05|ARAP2_MOUSE8.262e-2433.64Arf-GAP with Rho-GAP domain, ANK repeat and PH dom... [more]
sp|Q96P48|ARAP1_HUMAN8.579e-2426.84Arf-GAP with Rho-GAP domain, ANK repeat and PH dom... [more]
sp|Q4LDD4|ARAP1_MOUSE1.944e-2123.20Arf-GAP with Rho-GAP domain, ANK repeat and PH dom... [more]
sp|Q8WWN8|ARAP3_HUMAN7.465e-1928.37Arf-GAP with Rho-GAP domain, ANK repeat and PH dom... [more]
back to top
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G1KLB45.276e-3225.46ArfGAP with RhoGAP domain, ankyrin repeat and PH d... [more]
A0A3P8XRP35.278e-2825.19Uncharacterized protein OS=Esox lucius OX=8010 PE=... [more]
A0A4W5P1Z87.311e-2725.52Uncharacterized protein OS=Hucho hucho OX=62062 PE... [more]
A0A060WR079.375e-2729.30Uncharacterized protein OS=Oncorhynchus mykiss OX=... [more]
A0A210PGH02.169e-2635.87Arf-GAP with Rho-GAP domain, ANK repeat and PH dom... [more]
back to top
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ARAP11.288e-2334.68ArfGAP with RhoGAP domain, ankyrin repeat and PH d... [more]
arap34.360e-2141.74ArfGAP with RhoGAP domain, ankyrin repeat and PH d... [more]
arap34.653e-2141.74ArfGAP with RhoGAP domain, ankyrin repeat and PH d... [more]
ENSAMXT00000000841.21.672e-2032.70arf-GAP with Rho-GAP domain, ANK repeat and PH dom... [more]
ENSAMXT00000019510.21.920e-1832.09ArfGAP with RhoGAP domain, ankyrin repeat and PH d... [more]
back to top
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000007633.15.127e-2433.15pep scaffold:Pmarinus_7.0:GL488501:137984:146551:-... [more]
ENSPMAT00000000232.11.588e-2333.33pep scaffold:Pmarinus_7.0:GL480628:15362:26221:1 g... [more]
acap3b2.191e-1733.33ArfGAP with coiled-coil, ankyrin repeat and PH dom... [more]
ENSPMAT00000009914.15.679e-1544.59pep scaffold:Pmarinus_7.0:GL476634:533628:626389:1... [more]
ENSPMAT00000006444.11.454e-1341.77pep scaffold:Pmarinus_7.0:GL477103:5377:54062:-1 g... [more]
back to top
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
GCS16.086e-1038.81ADP-ribosylation factor GTPase activating protein ... [more]
AGE21.457e-934.52ADP-ribosylation factor (ARF) GTPase activating pr... [more]
GLO31.592e-933.72ADP-ribosylation factor GTPase activating protein ... [more]
AGE11.789e-944.16ADP-ribosylation factor (ARF) GTPase activating pr... [more]
GTS11.686e-731.71Protein involved in Arf3p regulation and in transc... [more]
back to top
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO346734.821e-2235.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO429564.643e-1735.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO430077.174e-1536.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO479191.756e-1439.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO330913.825e-1434.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arap32.437e-2225.17ArfGAP with RhoGAP domain, ankyrin repeat and PH d... [more]
arap32.746e-2225.17ArfGAP with RhoGAP domain, ankyrin repeat and PH d... [more]
ENSORLT00000045891.18.322e-2129.81ArfGAP with RhoGAP domain, ankyrin repeat and PH d... [more]
ENSORLT00000040486.19.618e-1930.52arf-GAP with Rho-GAP domain, ANK repeat and PH dom... [more]
acap21.546e-1834.72ArfGAP with coiled-coil, ankyrin repeat and PH dom... [more]
back to top
BLAST of arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000070668.10.000e+097.95SMESG000070668.1[more]
SMESG000070925.10.000e+044.54SMESG000070925.1[more]
SMESG000070925.10.000e+045.90SMESG000070925.1[more]
SMESG000006535.18.788e-2926.29SMESG000006535.1[more]
SMESG000018614.19.827e-1637.10SMESG000018614.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012050 ID=SMED30012050|Name=arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1-like|organism=Schmidtea mediterranea sexual|type=transcript|length=3266bp
CCCGGATGCTTTAAAGTTAATTTTATAATTAATTTTCAATAATTTCATTT
AATAAATTCAATTTGATATGATATTTTAACACTTTGATTTTAACAATATA
CTGATTCAATTAATTCATTTAAAGGATTATAATCTAATAAATGCAATTTT
AAATGACAGTTACATGTTTATCGGAAATTGAAGATAATATCTTGATTCAT
TCAAACCTCAAAGTGAATGGTAGTGGATGTGATTGTTATTGCGCATTAAT
CAAATACCGATTAATTATTTTCAAAAATTCAAATGATATAATCTCATCGA
AACGTCTTCCTATTAATAAATCAATTAGATTACAATATATAGATAACTCT
AATCAATTTTTGATTCTTCTTGGAAATTTTCAATATTTATTTATGCACTC
TGATGCTTCAATAATCAAGAATTGGGTAAATAAAATAAATACACTTCTTC
TAAACTATGAAGATCTTCAGTTAAATTATTTTAAATATGCGGAAGTAAGA
ATTGATTCAAATGAAGCATCAAATGTTAGTTCTTATATTTTGATCCGTTC
AGATGAATATTTATTACATATCTATGAAAACCTTGTTGAACATGCACAAA
ATATATGTTCACACGTTATTAATTTAAAATTTTATTCTTTGGAAAATTCT
AGAAGCTGTTCATCTGTTAATAATAGATGTCTTAAATTGTTTGGAAAATC
AATTACATTTAAAATAAGGTTTGAAAGTTCCGAATTAGTAAACGAGTGGA
AAATAATACTTTCTGAAGCTATAAATATAGCCTTTATGGGAGGAGAAAAT
AAAATCCTCAAACAAATATATACTAATGAGTCAAACAAATTATGTGCTGA
TTGTGGTTATCCTAATCCGGAATGGGTCTCAATAAATCTATGCGTGATTC
TTTGTATTAACTGTTCAGGACTTCATCGATCTTTAGCCACTTCGCATTCT
CGTATTCAAAGTGCTATTTTGGATCAGCGAATTTGGGAAGATTCGTTTTT
AATAGAAATCATGAAAAAAATTGGTAATGAAAATTCCAATTTGTTTTGGT
ATAAAAACAAACAAAATTCTTCTACAATTTTTCCTTCTGATTTATCAGAA
ATTAACAGTAAATACATTGAAAAAAAATTTATTGATACAGAGTTTATTAA
TTTATCGGATAATGAAATAAAAAACCGTTTGAGATCCTCCGTCGCGACTG
ATGATGTATTTTTGACAATGAAATTGTATCATTCCATTAAATTTCCATAC
GATTCGGAGTTCATTAAAGAGATATTGTTAATTGCTAGAAATTCCAATCA
ATATTTGCAAGAGAAGTTTCTTTCTGTTCAACCAGATCTATCTAACTCCA
TTCAAGATCAAACGATAATAAAAGATAAAATCTTTAAAATTTCATATAAT
AATGAAGAAAAACTTGCTGATTTATTTTCTGTTTCATTGTTGTGTACTTG
TATATCTATTAATATTGAAGAATTACTAACACCCGCTATTTACATAAATA
TATGTTGTATTTATTATACCGATATCGAGTTAATTTGGTACGATTCAACG
AATGAAAGTCTCGTTATAACTTTATTTAACAATTGTCAATTTTTCAAGAA
CCCTAAAAGTAGAACCTCGAAAAAGTATCCAATCACTGTGCATCGATTAT
CATTTTTTGACCAATCAAATGTTATTAAGCAATTTCAGTTAGATTTATTT
AAATTGTTAATGCCTAATCATTTTGTTGAATTAACTTTCAACTCGAATTT
ATTTATGAATTTAGAAGTTAAGCTCAATGAAAATAATACGATAAAATGCA
AATCTCATGTTGATGAACAAGGAATTATTTTTTATTTTCCTATTGCTATT
ATATTTGATTTGAAAAATTCTACTAAAATTCAATTGATAGATGATAAAAT
TATTTCTATTAAATTTAATAACGATCAAATTGAAATAGTTACCAATAACT
TTGGTAGTCAGAATTTGGTTTATAATTATTTAAATTTGTTTACTAACCAA
AGACCGATTATGTTCAATCCCATAGATAAAATGATTACATTTATTATTAC
TAGAGGATTGAAGTCTGAGTTCATTTTTAGAAAGGTTGGTGCTGTTAGAA
AAATTAATGCTCTCTATGAGTTAATAGAAAAATCTCCAAATGATTTCTTT
ATTGATCCAAATGTTTACAATGTTAATGATGTTGCGTCATGTTTGAAGAA
ATATTTCAGATCTTTTAATGAACCAATTATTACAGATAGTTTATTCAATT
TGTTTTGTGACGCTTGTAAATTAGAGAATACAAGTTCGAAATTAGCCCAA
TTGGAATTCACTGTTTCTTCGATGCCCGAAATTAATTATCAGGTACTCCG
AAAAACGGTCGAGTTGTTGTACATGATTCAAAAGTTTGCCGATGAAAATA
AAATGGACAGTAAAAGTTTAGCACTTTCGACAGCACTATCAATAATATCA
GAGGATGAGAATCATGGAGAAATTTCAACTGAGATATTGAAAGATTTGAT
TGATTATTTCGAAACTGTGTTTGGTTATTCGCCAAAAGAAAGAACTGCTT
TGATAAAACATATCGAAAATCCAGTGGAAAAAGAACCAATCATCATCCGG
GAGTTTTATATCCATCCATTTTTGAAAAATTTTCTGTTGATTCCAACCAA
TGAAAACAAAAGAGTTGGATTTCTAGATCGTGGAATTAGTTTTTCAATGA
TTCGCATGACAATTAATCAATGTGCCACTGTGAAGCAAGTTGTGCAAAAA
TTATTTCGGAATTTAGAAGTTGAATTGTGGAATTTCCAGACTAAAACAAC
ACGATTCGGCAATAAAACATTGAAGCGATTTGTTAATTTGAATGAAAATA
CCGAAAATTCAATTGTATGTCCGAGAAAAATATCTGATTGTTATGAGAAC
TATTTTGTGTTTCTGCCAAAACAATCGAATGCCGACAGAAATATCAGATG
TCTGTTCAAGTGTGAAATCAAACTAAAATTGGAAAACTATCGAGATTTTA
CGCTGAATTTGCAATATCCAAATTCATATGAATTTTTCCCACGAAATCAA
ACTCTTGAATCCAATTTTAAATTGCCATGGACAGATGTAAAGGTTCTCCG
ATACCACATGAGAAATGTCAACAAAATTATTATGTTATCTGAGAATGGTA
TTTATAAATGCAATTTTTGTAATACTGAAACTTTGAGAGAGTTCTTAATT
TTTTTTGATCAATTCAAATAAGGATTATTTTTATTAACAAAAGATGACAT
TTTTTTCATAAACGAC
back to top

protein sequence of SMED30012050-orf-1

>SMED30012050-orf-1 ID=SMED30012050-orf-1|Name=SMED30012050-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1023bp
MTVTCLSEIEDNILIHSNLKVNGSGCDCYCALIKYRLIIFKNSNDIISSK
RLPINKSIRLQYIDNSNQFLILLGNFQYLFMHSDASIIKNWVNKINTLLL
NYEDLQLNYFKYAEVRIDSNEASNVSSYILIRSDEYLLHIYENLVEHAQN
ICSHVINLKFYSLENSRSCSSVNNRCLKLFGKSITFKIRFESSELVNEWK
IILSEAINIAFMGGENKILKQIYTNESNKLCADCGYPNPEWVSINLCVIL
CINCSGLHRSLATSHSRIQSAILDQRIWEDSFLIEIMKKIGNENSNLFWY
KNKQNSSTIFPSDLSEINSKYIEKKFIDTEFINLSDNEIKNRLRSSVATD
DVFLTMKLYHSIKFPYDSEFIKEILLIARNSNQYLQEKFLSVQPDLSNSI
QDQTIIKDKIFKISYNNEEKLADLFSVSLLCTCISINIEELLTPAIYINI
CCIYYTDIELIWYDSTNESLVITLFNNCQFFKNPKSRTSKKYPITVHRLS
FFDQSNVIKQFQLDLFKLLMPNHFVELTFNSNLFMNLEVKLNENNTIKCK
SHVDEQGIIFYFPIAIIFDLKNSTKIQLIDDKIISIKFNNDQIEIVTNNF
GSQNLVYNYLNLFTNQRPIMFNPIDKMITFIITRGLKSEFIFRKVGAVRK
INALYELIEKSPNDFFIDPNVYNVNDVASCLKKYFRSFNEPIITDSLFNL
FCDACKLENTSSKLAQLEFTVSSMPEINYQVLRKTVELLYMIQKFADENK
MDSKSLALSTALSIISEDENHGEISTEILKDLIDYFETVFGYSPKERTAL
IKHIENPVEKEPIIIREFYIHPFLKNFLLIPTNENKRVGFLDRGISFSMI
RMTINQCATVKQVVQKLFRNLEVELWNFQTKTTRFGNKTLKRFVNLNENT
ENSIVCPRKISDCYENYFVFLPKQSNADRNIRCLFKCEIKLKLENYRDFT
LNLQYPNSYEFFPRNQTLESNFKLPWTDVKVLRYHMRNVNKIIMLSENGI
YKCNFCNTETLREFLIFFDQFK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0046872metal ion binding
GO:0005096GTPase activator activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR038508ArfGAP_dom_sf
IPR037278ARFGAP/RecO
IPR001164ArfGAP_dom
IPR000198RhoGAP_dom
IPR011993PH-like_dom_sf
IPR008936Rho_GTPase_activation_prot
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction
GO:0043547positive regulation of GTPase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 88..108
NoneNo IPR availablePANTHERPTHR45899FAMILY NOT NAMEDcoord: 623..791
coord: 137..397
NoneNo IPR availableCDDcd08837ArfGap_ARAPcoord: 218..326
e-value: 3.95132E-35
score: 127.492
NoneNo IPR availableCDDcd00159RhoGAPcoord: 623..785
e-value: 3.86119E-29
score: 112.395
NoneNo IPR availableSUPERFAMILYSSF50729PH domain-likecoord: 24..102
IPR001164Arf GTPase activating proteinPRINTSPR00405REVINTRACTNGcoord: 247..264
score: 43.3
coord: 228..247
score: 46.21
IPR001164Arf GTPase activating proteinSMARTSM00105arf_gap_3coord: 217..339
e-value: 2.4E-23
score: 93.6
IPR001164Arf GTPase activating proteinPFAMPF01412ArfGapcoord: 217..332
e-value: 2.7E-27
score: 95.2
IPR001164Arf GTPase activating proteinPROSITEPS50115ARFGAPcoord: 216..339
score: 20.944
IPR000198Rho GTPase-activating protein domainSMARTSM00324RhoGAP_3coord: 618..787
e-value: 8.0E-26
score: 101.8
IPR000198Rho GTPase-activating protein domainPFAMPF00620RhoGAPcoord: 624..770
e-value: 3.3E-29
score: 101.7
IPR000198Rho GTPase-activating protein domainPROSITEPS50238RHOGAPcoord: 607..790
score: 26.664
IPR038508ArfGAP domain superfamilyGENE3DG3DSA:3.30.40.160coord: 205..339
e-value: 8.4E-31
score: 108.6
IPR008936Rho GTPase activation proteinGENE3DG3DSA:1.10.555.10coord: 597..800
e-value: 1.9E-35
score: 124.1
IPR008936Rho GTPase activation proteinSUPERFAMILYSSF48350GTPase activation domain, GAPcoord: 623..791
IPR037278ARFGAP/RecO-like zinc fingerSUPERFAMILYSSF57863ArfGap/RecO-like zinc fingercoord: 216..327