5'-AMP-activated protein kinase subunit beta-1

Overview
Name5'-AMP-activated protein kinase subunit beta-1
Smed IDSMED30012046
Length (bp)981
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of 5'-AMP-activated protein kinase subunit beta-1 (SMED30012046) t-SNE clustered cells

Violin plots show distribution of expression levels for 5'-AMP-activated protein kinase subunit beta-1 (SMED30012046) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of 5'-AMP-activated protein kinase subunit beta-1 (SMED30012046) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for 5'-AMP-activated protein kinase subunit beta-1 (SMED30012046) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012046

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30012046SMESG000037698.1 SmedASXL_001433SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30012046SMESG000037698.1 dd_Smed_v4_6112_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30012046SMESG000037698.1 dd_Smed_v4_6112_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30012046SMESG000037698.1 dd_Smed_v4_6112_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30012046SMESG000037698.1 dd_Smed_v6_6112_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30012046SMESG000037698.1 OX_Smed_1.0.16686ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30012046SMESG000037698.1 dd_Smed_v4_6112_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of 5'-AMP-activated protein kinase subunit beta-1 vs. Ensembl Human
Match: PRKAB2 (protein kinase AMP-activated non-catalytic subunit beta 2 [Source:HGNC Symbol;Acc:HGNC:9379])

HSP 1 Score: 146.362 bits (368), Expect = 2.622e-41
Identity = 83/204 (40.69%), Postives = 117/204 (57.35%), Query Frame = 1
Query:  262 PTFFRWTGKVNKSISISGSFNNWENNIPLSKCGEDSYFVIINCSAGSHMYKYFIDGNWYHDPSQEVVQNTFGTFDNIVHVKEADSTSIXXXXXXXXXXXXXYQAPSISNPDMKRLSPTGDYSQNVPRRTITDYDIVPMQFPSYLNESILDAATQSNLEPSLLPHPQHVQLNHMYASSIKDGLICLSATIRYRSKFITIILYKTI 873
            PT  RW+ +  K + ISGSFNNW   IPL K   D +  I++   G H YK+F+DG W HDPS+ VV +  GT +N++HVK++D      F   D+      ++   S  D+   SP G Y Q +      +    P   P +L + IL+  T  + +P+LLP P HV LNH+YA SIKD ++ LSAT RY+ K++T +LYK I
Sbjct:   78 PTVIRWS-EGGKEVFISGSFNNWSTKIPLIKSHND-FVAILDLPEGEHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIHVKKSD------FEVFDALKLDSMESSETSCRDLSS-SPPGPYGQEMYAFRSEERFKSPPILPPHLLQVILNKDTNISCDPALLPEPNHVMLNHLYALSIKDSVMVLSATHRYKKKYVTTLLYKPI 272          
BLAST of 5'-AMP-activated protein kinase subunit beta-1 vs. Ensembl Human
Match: PRKAB1 (protein kinase AMP-activated non-catalytic subunit beta 1 [Source:HGNC Symbol;Acc:HGNC:9378])

HSP 1 Score: 144.05 bits (362), Expect = 1.928e-40
Identity = 82/204 (40.20%), Postives = 116/204 (56.86%), Query Frame = 1
Query:  262 PTFFRWTGKVNKSISISGSFNNWENNIPLSKCGEDSYFVIINCSAGSHMYKYFIDGNWYHDPSQEVVQNTFGTFDNIVHVKEADSTSIXXXXXXXXXXXXXYQAPSISNPDMKRLSPTGDYSQNVPRRTITDYDIVPMQFPSYLNESILDAATQSNLEPSLLPHPQHVQLNHMYASSIKDGLICLSATIRYRSKFITIILYKTI 873
            PT FRWTG   K + +SGSFNNW + +PL++   +++  I++   G H YK+F+DG W HDPS+ +V +  GT +NI+ VK+ D    D    D    S   +  S         SP G Y Q        +    P   P +L + IL+  T  + +P+LLP P HV LNH+YA SIKDG++ LSAT RY+ K++T +LYK I
Sbjct:   79 PTVFRWTGG-GKEVYLSGSFNNW-SKLPLTRS-HNNFVAILDLPEGEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDVSELSS---------SPPGPYHQEPYVCKPEERFRAPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTTLLYKPI 270          
BLAST of 5'-AMP-activated protein kinase subunit beta-1 vs. Ensembl Human
Match: PRKAB1 (protein kinase AMP-activated non-catalytic subunit beta 1 [Source:HGNC Symbol;Acc:HGNC:9378])

HSP 1 Score: 144.05 bits (362), Expect = 1.928e-40
Identity = 82/204 (40.20%), Postives = 116/204 (56.86%), Query Frame = 1
Query:  262 PTFFRWTGKVNKSISISGSFNNWENNIPLSKCGEDSYFVIINCSAGSHMYKYFIDGNWYHDPSQEVVQNTFGTFDNIVHVKEADSTSIXXXXXXXXXXXXXYQAPSISNPDMKRLSPTGDYSQNVPRRTITDYDIVPMQFPSYLNESILDAATQSNLEPSLLPHPQHVQLNHMYASSIKDGLICLSATIRYRSKFITIILYKTI 873
            PT FRWTG   K + +SGSFNNW + +PL++   +++  I++   G H YK+F+DG W HDPS+ +V +  GT +NI+ VK+ D    D    D    S   +  S         SP G Y Q        +    P   P +L + IL+  T  + +P+LLP P HV LNH+YA SIKDG++ LSAT RY+ K++T +LYK I
Sbjct:   79 PTVFRWTGG-GKEVYLSGSFNNW-SKLPLTRS-HNNFVAILDLPEGEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDVSELSS---------SPPGPYHQEPYVCKPEERFRAPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTTLLYKPI 270          
BLAST of 5'-AMP-activated protein kinase subunit beta-1 vs. Ensembl Human
Match: PRKAB1 (protein kinase AMP-activated non-catalytic subunit beta 1 [Source:HGNC Symbol;Acc:HGNC:9378])

HSP 1 Score: 74.3294 bits (181), Expect = 4.756e-16
Identity = 40/89 (44.94%), Postives = 54/89 (60.67%), Query Frame = 1
Query:  607 SPTGDYSQNVPRRTITDYDIVPMQFPSYLNESILDAATQSNLEPSLLPHPQHVQLNHMYASSIKDGLICLSATIRYRSKFITIILYKTI 873
            SP G Y Q        +    P   P +L + IL+  T  + +P+LLP P HV LNH+YA SIKDG++ LSAT RY+ K++T +LYK I
Sbjct:   16 SPPGPYHQEPYVCKPEERFRAPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTTLLYKPI 104          
BLAST of 5'-AMP-activated protein kinase subunit beta-1 vs. Ensembl Celegans
Match: aakb-2 (AMP-Activated Kinase Beta subunit [Source:UniProtKB/TrEMBL;Acc:Q9NAH7])

HSP 1 Score: 125.946 bits (315), Expect = 5.629e-34
Identity = 75/260 (28.85%), Postives = 127/260 (48.85%), Query Frame = 1
Query:  136 PNSKASKYHHSPLFISMHRKAHIFERTNEKPKEFYDEIN----FSIPTFFRWTGKVN---KSISISGSFNNWENNIPLSKCGEDSYFVIINCSAGSHMYKYFIDGNWYHDPSQEVVQNTFGTFDNIVHVKEADSTSIXXX----XXXXXXXXXXYQAPSISN---PDMKRLSPTGDYSQNVPRRTITDYDIVPMQFPSYLNESILDAATQSNLEPSLLPHPQHVQLNHMYASSIKDGLICLSATIRYRSKFITIILYKTI 873
            PN KA    H  +  +      +    +  P   +D+ N       P  FRW+   N   + + I GS++NW+  IP+ K   D +  II+   G + YK+ +DG+W  D +Q   Q+  G  +N+++++++D    +          +      ++ S  N   P+ + L     ++Q +P   +      P   P  L + +L+  T  + +P++LP P HV LNHMYA SIKD ++ LS+T RYR KF+T +LYK +
Sbjct:   16 PNDKAGLRRHRMMSETAKIAGQVLPNPDGGPPMIFDDGNEDKSGECPVVFRWSFTQNAQPRVVHIVGSWDNWQTRIPMVKSTND-FSTIIDLQPGQYEYKFQVDGSWVVDDNQGKAQDVHGNENNMINIQDSDFAVFEALDEDFQSSTAGEVLRGESESTKNHDTPNDRELEKLRSFTQEIPSMDMLRKAAGPPVIPPQLMQVLLNKETPESCDPNVLPEPNHVMLNHMYALSIKDSVMVLSSTQRYRKKFVTTLLYKPV 274          
BLAST of 5'-AMP-activated protein kinase subunit beta-1 vs. Ensembl Celegans
Match: aakb-1 (AMP-Activated Kinase Beta subunit [Source:UniProtKB/TrEMBL;Acc:Q9XUY2])

HSP 1 Score: 125.561 bits (314), Expect = 7.460e-34
Identity = 71/213 (33.33%), Postives = 105/213 (49.30%), Query Frame = 1
Query:  262 PTFFRWT--GKVNKSISISGSFNNWENNIPLSKCGEDSYFVIINCSAGSHMYKYFIDGNWYHDPSQEVVQNTFGTFDNIVHVKEAD-------STSIXXXXXXXXXXXXXYQAPSISNPDMKRLSPTGDYSQNVPRRTITDYDIVPMQFPSYLNESILDAATQSNLEPSLLPHPQHVQLNHMYASSIKDGLICLSATIRYRSKFITIILYKTI 873
            P  F+W       + + I GS++ W   IPL K   D +  I++   G H YK+ +D  W  D +Q+   N  G  +N+V + EAD          +      ++  +S     S   P+ + L     + Q  P R   +    P   P +L + IL+  T    +P++LP P HV LNH+YA SIKDG++ LSAT RYR KF+T +LYK I
Sbjct:   58 PVVFKWNINNATPRQVYICGSWDGWNTKIPLVKSTSD-FSTIVDLEPGKHEYKFMVDSKWVVDDNQQKTGNNLGGENNVVMIDEADFEVFDALDKDLASSNAGEALRNSHPTKESHDTPNDRELEKLHQFGQETPTRVDFNKAAAPPVLPPHLLQVILNKDTPVQCDPNVLPEPDHVMLNHLYALSIKDGVMVLSATHRYRKKFVTTLLYKPI 269          
BLAST of 5'-AMP-activated protein kinase subunit beta-1 vs. Ensembl Celegans
Match: aakb-1 (AMP-Activated Kinase Beta subunit [Source:UniProtKB/TrEMBL;Acc:Q9XUY2])

HSP 1 Score: 125.561 bits (314), Expect = 7.460e-34
Identity = 71/213 (33.33%), Postives = 105/213 (49.30%), Query Frame = 1
Query:  262 PTFFRWT--GKVNKSISISGSFNNWENNIPLSKCGEDSYFVIINCSAGSHMYKYFIDGNWYHDPSQEVVQNTFGTFDNIVHVKEAD-------STSIXXXXXXXXXXXXXYQAPSISNPDMKRLSPTGDYSQNVPRRTITDYDIVPMQFPSYLNESILDAATQSNLEPSLLPHPQHVQLNHMYASSIKDGLICLSATIRYRSKFITIILYKTI 873
            P  F+W       + + I GS++ W   IPL K   D +  I++   G H YK+ +D  W  D +Q+   N  G  +N+V + EAD          +      ++  +S     S   P+ + L     + Q  P R   +    P   P +L + IL+  T    +P++LP P HV LNH+YA SIKDG++ LSAT RYR KF+T +LYK I
Sbjct:   58 PVVFKWNINNATPRQVYICGSWDGWNTKIPLVKSTSD-FSTIVDLEPGKHEYKFMVDSKWVVDDNQQKTGNNLGGENNVVMIDEADFEVFDALDKDLASSNAGEALRNSHPTKESHDTPNDRELEKLHQFGQETPTRVDFNKAAAPPVLPPHLLQVILNKDTPVQCDPNVLPEPDHVMLNHLYALSIKDGVMVLSATHRYRKKFVTTLLYKPI 269          
BLAST of 5'-AMP-activated protein kinase subunit beta-1 vs. Ensembl Fly
Match: alc (gene:FBgn0260972 transcript:FBtr0088625)

HSP 1 Score: 136.732 bits (343), Expect = 1.805e-38
Identity = 78/207 (37.68%), Postives = 118/207 (57.00%), Query Frame = 1
Query:  256 SIPTFFRWTGKVNKSISISGSFNNWENNIPLSKCGEDSYFV-IINCSAGSHMYKYFIDGNWYHDPSQEVVQNTFGTFDNIVHVKEADSTSIXXXXXXXXXXXXXYQAPSISNPDMKRLSPTGDYSQNVPRRTITDYDIVPMQFPSYLNESILDAATQSNLEPSLLPHPQHVQLNHMYASSIKDGLICLSATIRYRSKFITIILYKTI 873
            ++PT  RW G   K+++ISG+F++W+   P++       FV II+   G H YK+ +DG W HDP  + V+N  G  +N+V V+E+D                 +QA +  + ++   +   +YSQ VP+    +    P   P +L + IL+  T  + EP+LLP P HV LNH+YA SIKDG++ LSAT RYR K++T +LYK I
Sbjct:   33 ALPTVLRWDGG-GKNVTISGTFSDWK---PMAMVRSHQNFVTIIDLPEGDHQYKFCVDGEWKHDPKLKSVENAEGQRNNLVSVRESD--------------FEVFQALAKDSENVTNYA-EKEYSQEVPQVKPWEKVSGPPVLPPHLLQVILNKDTPLSCEPTLLPEPNHVMLNHLYALSIKDGVMVLSATHRYRKKYVTTLLYKPI 220          
BLAST of 5'-AMP-activated protein kinase subunit beta-1 vs. Ensembl Fly
Match: alc (gene:FBgn0260972 transcript:FBtr0088624)

HSP 1 Score: 136.346 bits (342), Expect = 3.836e-37
Identity = 78/207 (37.68%), Postives = 118/207 (57.00%), Query Frame = 1
Query:  256 SIPTFFRWTGKVNKSISISGSFNNWENNIPLSKCGEDSYFV-IINCSAGSHMYKYFIDGNWYHDPSQEVVQNTFGTFDNIVHVKEADSTSIXXXXXXXXXXXXXYQAPSISNPDMKRLSPTGDYSQNVPRRTITDYDIVPMQFPSYLNESILDAATQSNLEPSLLPHPQHVQLNHMYASSIKDGLICLSATIRYRSKFITIILYKTI 873
            ++PT  RW G   K+++ISG+F++W+   P++       FV II+   G H YK+ +DG W HDP  + V+N  G  +N+V V+E+D                 +QA +  + ++   +   +YSQ VP+    +    P   P +L + IL+  T  + EP+LLP P HV LNH+YA SIKDG++ LSAT RYR K++T +LYK I
Sbjct:  154 ALPTVLRWDGG-GKNVTISGTFSDWK---PMAMVRSHQNFVTIIDLPEGDHQYKFCVDGEWKHDPKLKSVENAEGQRNNLVSVRESD--------------FEVFQALAKDSENVTNYAEK-EYSQEVPQVKPWEKVSGPPVLPPHLLQVILNKDTPLSCEPTLLPEPNHVMLNHLYALSIKDGVMVLSATHRYRKKYVTTLLYKPI 341          
BLAST of 5'-AMP-activated protein kinase subunit beta-1 vs. Ensembl Zebrafish
Match: prkab1a (protein kinase, AMP-activated, beta 1 non-catalytic subunit, a [Source:ZFIN;Acc:ZDB-GENE-040718-377])

HSP 1 Score: 155.221 bits (391), Expect = 5.283e-45
Identity = 92/244 (37.70%), Postives = 132/244 (54.10%), Query Frame = 1
Query:  148 ASKYHHSPLFISMHRKAHIFERTNEKPKEFYDEINFSIPTFFRWTGKVNKSISISGSFNNWENNIPLSKCGEDSYFVIINCSAGSHMYKYFIDGNWYHDPSQEVVQNTFGTFDNIVHVKEADSTSIXXXXXXXXXXXXXYQAPSISNPDMKRLS--PTGDYSQNVPRRTITDYDIVPMQFPSYLNESILDAATQSNLEPSLLPHPQHVQLNHMYASSIKDGLICLSATIRYRSKFITIILYKTI 873
            A  +H   L   + ++  I  R + +  E  D ++   PT FRWTG   K + ISGSFNNW N IPL +  ++++  I++   G H YK+++DG W HDP++ VV N  GT +NI+ VK+ D            +        S    DM  LS  P G Y Q+       +    P   P +L + IL+  T  + +P+LLP P HV LNH+YA SIKDG++ LSAT RY+ K++T +LYK I
Sbjct:   40 ADIFHGEDLKAPLEKEEFIEWRPDLEGSEKTDTLDR--PTVFRWTG-AGKEVYISGSFNNWTNKIPLIRS-QNNFVAIVDLPEGEHQYKFYVDGLWTHDPTEPVVTNQLGTVNNIIQVKKTD-----------FEVFDALMVDSQKCSDMSDLSSSPPGPYHQDAYTPKQEEKFKSPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTTLLYKPI 268          
BLAST of 5'-AMP-activated protein kinase subunit beta-1 vs. Ensembl Zebrafish
Match: prkab1b (protein kinase, AMP-activated, beta 1 non-catalytic subunit, b [Source:ZFIN;Acc:ZDB-GENE-030131-7172])

HSP 1 Score: 143.28 bits (360), Expect = 2.098e-40
Identity = 81/206 (39.32%), Postives = 114/206 (55.34%), Query Frame = 1
Query:  262 PTFFRWTGKVNKSISISGSFNNWENNIPLSKCGEDSYFVIINCSAGSHMYKYFIDGNWYHDPSQEVVQNTFGTFDNIVHVKEADSTSIXXXXXXXXXXXXXYQAPSISNPDMKRLS--PTGDYSQNVPRRTITDYDIVPMQFPSYLNESILDAATQSNLEPSLLPHPQHVQLNHMYASSIKDGLICLSATIRYRSKFITIILYKTI 873
            PT FRW G   K I +SGSFNNW   IPL+K   +++  II+   G H YK+++DG+W  DP + VV N  G  +N++ V++ D            +     +  S    DM  LS  P G Y Q+       D    P   P +L + +L+  T  + +P+LLP P HV LNH+YA SIKDG++ LSAT RY+ K++T +LYK I
Sbjct:   68 PTVFRWKGP-GKEIYLSGSFNNWATKIPLNKS-HNNFVAIIDLPEGEHQYKFYVDGHWTLDPKEPVVTNKSGVVNNVIKVRKTD-----------FEVFDALKTDSEKCADMSDLSSSPPGPYHQDPYSTKSEDKLRSPPILPPHLLQVLLNKDTGISCDPTLLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTTLLYKPI 260          
BLAST of 5'-AMP-activated protein kinase subunit beta-1 vs. Ensembl Zebrafish
Match: prkab1b (protein kinase, AMP-activated, beta 1 non-catalytic subunit, b [Source:ZFIN;Acc:ZDB-GENE-030131-7172])

HSP 1 Score: 143.28 bits (360), Expect = 2.098e-40
Identity = 81/206 (39.32%), Postives = 114/206 (55.34%), Query Frame = 1
Query:  262 PTFFRWTGKVNKSISISGSFNNWENNIPLSKCGEDSYFVIINCSAGSHMYKYFIDGNWYHDPSQEVVQNTFGTFDNIVHVKEADSTSIXXXXXXXXXXXXXYQAPSISNPDMKRLS--PTGDYSQNVPRRTITDYDIVPMQFPSYLNESILDAATQSNLEPSLLPHPQHVQLNHMYASSIKDGLICLSATIRYRSKFITIILYKTI 873
            PT FRW G   K I +SGSFNNW   IPL+K   +++  II+   G H YK+++DG+W  DP + VV N  G  +N++ V++ D            +     +  S    DM  LS  P G Y Q+       D    P   P +L + +L+  T  + +P+LLP P HV LNH+YA SIKDG++ LSAT RY+ K++T +LYK I
Sbjct:   68 PTVFRWKGP-GKEIYLSGSFNNWATKIPLNKS-HNNFVAIIDLPEGEHQYKFYVDGHWTLDPKEPVVTNKSGVVNNVIKVRKTD-----------FEVFDALKTDSEKCADMSDLSSSPPGPYHQDPYSTKSEDKLRSPPILPPHLLQVLLNKDTGISCDPTLLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTTLLYKPI 260          
BLAST of 5'-AMP-activated protein kinase subunit beta-1 vs. Ensembl Zebrafish
Match: CABZ01083448.1 (pep chromosome:GRCz11:2:58739111:58742863:1 gene:ENSDARG00000067817.5 transcript:ENSDART00000097690.5 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CABZ01083448.1)

HSP 1 Score: 113.235 bits (282), Expect = 5.750e-29
Identity = 68/203 (33.50%), Postives = 105/203 (51.72%), Query Frame = 1
Query:  265 TFFRWTGKVNKSISISGSFNNWENNIPLSKCGEDSYFVIINCSAGSHMYKYFIDGNWYHDPSQEVVQNTFGTFDNIVHVKEADSTSIXXXXXXXXXXXXXYQAPSISNPDMKRLSPTGDYSQNVPRRTITDYDIVPMQFPSYLNESILDAATQSNLEPSLLPHPQHVQLNHMYASSIKDGLICLSATIRYRSKFITIILYKTI 873
            T  RW G   + + I+GSFNNW + IPL+K   D +  I++   G H YK+F+DG W HDPS+ ++            +K +D   +  F           ++ S++     + S   D  +   + T +         PS+ +   L+     + +P+LLP P HV LNH+YA SIKDG++ LSAT RY+ K++T +LYK I
Sbjct:   77 TVIRWAGG-GREVFITGSFNNWSSKIPLNKSHND-FVAILDLPEGEHQYKFFVDGQWLHDPSEVMMMMMMNQISQRSVIKRSD---VHMFTELQVSLFKCSESSSLTCSRPAQFSKLVDVVKAETQWTSS------FIIPSHFSHRRLNRNFNISCDPALLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTSLLYKPI 268          
BLAST of 5'-AMP-activated protein kinase subunit beta-1 vs. Ensembl Zebrafish
Match: prkab1a (protein kinase, AMP-activated, beta 1 non-catalytic subunit, a [Source:ZFIN;Acc:ZDB-GENE-040718-377])

HSP 1 Score: 97.0561 bits (240), Expect = 2.070e-23
Identity = 48/122 (39.34%), Postives = 72/122 (59.02%), Query Frame = 1
Query:  148 ASKYHHSPLFISMHRKAHIFERTNEKPKEFYDEINFSIPTFFRWTGKVNKSISISGSFNNWENNIPLSKCGEDSYFVIINCSAGSHMYKYFIDGNWYHDPSQEVVQNTFGTFDNIVHVKEAD 513
            A  +H   L   + ++  I  R + +  E  D ++   PT FRWTG   K + ISGSFNNW N IPL +  ++++  I++   G H YK+++DG W HDP++ VV N  GT +NI+ VK+ D
Sbjct:   40 ADIFHGEDLKAPLEKEEFIEWRPDLEGSEKTDTLDR--PTVFRWTG-AGKEVYISGSFNNWTNKIPLIRS-QNNFVAIVDLPEGEHQYKFYVDGLWTHDPTEPVVTNQLGTVNNIIQVKKTD 157          
BLAST of 5'-AMP-activated protein kinase subunit beta-1 vs. Ensembl Xenopus
Match: prkab2 (protein kinase, AMP-activated, beta 2 non-catalytic subunit [Source:NCBI gene;Acc:100127782])

HSP 1 Score: 149.828 bits (377), Expect = 1.136e-42
Identity = 85/204 (41.67%), Postives = 118/204 (57.84%), Query Frame = 1
Query:  262 PTFFRWTGKVNKSISISGSFNNWENNIPLSKCGEDSYFVIINCSAGSHMYKYFIDGNWYHDPSQEVVQNTFGTFDNIVHVKEADSTSIXXXXXXXXXXXXXYQAPSISNPDMKRLSPTGDYSQNVPRRTITDYDIVPMQFPSYLNESILDAATQSNLEPSLLPHPQHVQLNHMYASSIKDGLICLSATIRYRSKFITIILYKTI 873
            PT  RWT +  K + ISGSFNNW   IPL K   D +  I++   G H YK+F+DG W HDPS+ VV +  GT +N++HVK++D      F   D+      ++   S  D+   SP G Y Q +      +    P   P +L + IL+  T  + +P+LLP P HV LNH+YA SIKDG++ LSAT RY+ K++T +LYK I
Sbjct:   77 PTVIRWT-EGGKEVFISGSFNNWTAKIPLIKSHND-FVAILDLPEGEHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIHVKKSD------FEVFDALKLDSMESSDTSARDLSS-SPPGLYGQELYAYKPEERYKSPPILPPHLLQVILNKDTNISCDPALLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTTLLYKPI 271          
BLAST of 5'-AMP-activated protein kinase subunit beta-1 vs. Ensembl Xenopus
Match: PRKAB1 (protein kinase, AMP-activated, beta 1 non-catalytic subunit [Source:NCBI gene;Acc:100380160])

HSP 1 Score: 113.235 bits (282), Expect = 4.880e-29
Identity = 80/266 (30.08%), Postives = 129/266 (48.50%), Query Frame = 1
Query:   25 MGNQSAVLKYKNEIEKDLSF------DRSRLSPYKCEVSSEVFPNSKASKYHHSPLFISMHRKAHIFERTNEKPKEFYDEINFSIPTFFRWTGKVNKSISISGSFNNWENNIPLSKCGEDSYFVIINCSAGSHMYKYFIDGNWYHDPSQEVVQNTFGTFDNIVHVKEADSTSIXXXXXXXXXXXXXYQAPSISNPDMKRL--SPTGDYSQNVPRRTITDYDIVPMQFPSYLNESILDAATQSNLEPSLLPHPQHVQLNHMYASSIK 798
            MGN S+     +++ +D +       DR+++     E  +++FP  ++        F++     H  E  ++ P +       + PT FRWTG   K I +SG+FNNW   IPL +   +++F I++   G H YK+ +DG W HDP++ V  +  GT +NI+ V++ D            +        S    D+  L  SP G Y Q+     + +    P   P +L + IL+  T  + +P+LLP P HV LNH+YA SIK
Sbjct:    1 MGNTSSERPGPHKVRRDSTGAVSKGDDRAKILMDSPE-DADMFPAEESKGSTEKEEFLAWQ---HDLEVNDKMPSQ-------ARPTVFRWTGG-GKEIYLSGTFNNWAK-IPLIRS-HNNFFAILDLPEGEHQYKFLVDGQWTHDPAEPVTTSQLGTVNNIIQVQKTD-----------FEVFDALMVDSQKGSDISDLSSSPPGPYQQDPYNCKLEERFKTPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLYALSIK 241          
BLAST of 5'-AMP-activated protein kinase subunit beta-1 vs. Ensembl Xenopus
Match: PRKAB1 (protein kinase, AMP-activated, beta 1 non-catalytic subunit [Source:NCBI gene;Acc:100380160])

HSP 1 Score: 77.411 bits (189), Expect = 2.985e-17
Identity = 40/89 (44.94%), Postives = 56/89 (62.92%), Query Frame = 1
Query:  607 SPTGDYSQNVPRRTITDYDIVPMQFPSYLNESILDAATQSNLEPSLLPHPQHVQLNHMYASSIKDGLICLSATIRYRSKFITIILYKTI 873
            SP G Y Q+     + +    P   P +L + IL+  T  + +P+LLP P HV LNH+YA SIKDG++ LSAT RY+ K++T +LYK I
Sbjct:   16 SPPGPYQQDPYNCKLEERFKTPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTTLLYKPI 104          
BLAST of 5'-AMP-activated protein kinase subunit beta-1 vs. Ensembl Mouse
Match: Prkab1 (protein kinase, AMP-activated, beta 1 non-catalytic subunit [Source:MGI Symbol;Acc:MGI:1336167])

HSP 1 Score: 146.747 bits (369), Expect = 1.130e-41
Identity = 82/204 (40.20%), Postives = 117/204 (57.35%), Query Frame = 1
Query:  262 PTFFRWTGKVNKSISISGSFNNWENNIPLSKCGEDSYFVIINCSAGSHMYKYFIDGNWYHDPSQEVVQNTFGTFDNIVHVKEADSTSIXXXXXXXXXXXXXYQAPSISNPDMKRLSPTGDYSQNVPRRTITDYDIVPMQFPSYLNESILDAATQSNLEPSLLPHPQHVQLNHMYASSIKDGLICLSATIRYRSKFITIILYKTI 873
            PT FRWTG   K + +SGSFNNW + +PL++  ++++  I++   G H YK+F+DG W HDPS+ +V +  GT +NI+ VK+ D    D    D    S   +  S         SP G Y Q        +    P   P +L + IL+  T  + +P+LLP P HV LNH+YA SIKDG++ LSAT RY+ K++T +LYK I
Sbjct:   79 PTVFRWTGG-GKEVYLSGSFNNW-SKLPLTRS-QNNFVAILDLPEGEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDVSELSS---------SPPGPYHQEPYMSKPEERFKAPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTTLLYKPI 270          
BLAST of 5'-AMP-activated protein kinase subunit beta-1 vs. Ensembl Mouse
Match: Prkab1 (protein kinase, AMP-activated, beta 1 non-catalytic subunit [Source:MGI Symbol;Acc:MGI:1336167])

HSP 1 Score: 146.747 bits (369), Expect = 1.130e-41
Identity = 82/204 (40.20%), Postives = 117/204 (57.35%), Query Frame = 1
Query:  262 PTFFRWTGKVNKSISISGSFNNWENNIPLSKCGEDSYFVIINCSAGSHMYKYFIDGNWYHDPSQEVVQNTFGTFDNIVHVKEADSTSIXXXXXXXXXXXXXYQAPSISNPDMKRLSPTGDYSQNVPRRTITDYDIVPMQFPSYLNESILDAATQSNLEPSLLPHPQHVQLNHMYASSIKDGLICLSATIRYRSKFITIILYKTI 873
            PT FRWTG   K + +SGSFNNW + +PL++  ++++  I++   G H YK+F+DG W HDPS+ +V +  GT +NI+ VK+ D    D    D    S   +  S         SP G Y Q        +    P   P +L + IL+  T  + +P+LLP P HV LNH+YA SIKDG++ LSAT RY+ K++T +LYK I
Sbjct:   79 PTVFRWTGG-GKEVYLSGSFNNW-SKLPLTRS-QNNFVAILDLPEGEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDVSELSS---------SPPGPYHQEPYMSKPEERFKAPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTTLLYKPI 270          
BLAST of 5'-AMP-activated protein kinase subunit beta-1 vs. Ensembl Mouse
Match: Prkab2 (protein kinase, AMP-activated, beta 2 non-catalytic subunit [Source:MGI Symbol;Acc:MGI:1336185])

HSP 1 Score: 145.591 bits (366), Expect = 3.246e-41
Identity = 83/204 (40.69%), Postives = 117/204 (57.35%), Query Frame = 1
Query:  262 PTFFRWTGKVNKSISISGSFNNWENNIPLSKCGEDSYFVIINCSAGSHMYKYFIDGNWYHDPSQEVVQNTFGTFDNIVHVKEADSTSIXXXXXXXXXXXXXYQAPSISNPDMKRLSPTGDYSQNVPRRTITDYDIVPMQFPSYLNESILDAATQSNLEPSLLPHPQHVQLNHMYASSIKDGLICLSATIRYRSKFITIILYKTI 873
            PT  RW+ +  K + ISGSFNNW   IPL K   D +  I++   G H YK+F+DG W HDPS+ VV +  GT +N++HVK++D      F   D+      ++   S  D+   SP G Y Q +      +    P   P +L + IL+  T  + +P+LLP P HV LNH+YA SIKD ++ LSAT RY+ K++T +LYK I
Sbjct:   77 PTVIRWS-EGGKEVFISGSFNNWSTKIPLIKSHND-FVAILDLPEGEHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIHVKKSD------FEVFDALKLDSMESSETSCRDLSS-SPPGPYGQEMYVFRSEERFKSPPILPPHLLQVILNKDTNISCDPALLPEPNHVMLNHLYALSIKDSVMVLSATHRYKKKYVTTLLYKPI 271          
BLAST of 5'-AMP-activated protein kinase subunit beta-1 vs. Ensembl Mouse
Match: Prkab2 (protein kinase, AMP-activated, beta 2 non-catalytic subunit [Source:MGI Symbol;Acc:MGI:1336185])

HSP 1 Score: 89.3521 bits (220), Expect = 5.753e-21
Identity = 40/84 (47.62%), Postives = 55/84 (65.48%), Query Frame = 1
Query:  262 PTFFRWTGKVNKSISISGSFNNWENNIPLSKCGEDSYFVIINCSAGSHMYKYFIDGNWYHDPSQEVVQNTFGTFDNIVHVKEAD 513
            PT  RW+ +  K + ISGSFNNW   IPL K   D +  I++   G H YK+F+DG W HDPS+ VV +  GT +N++HVK++D
Sbjct:   77 PTVIRWS-EGGKEVFISGSFNNWSTKIPLIKSHND-FVAILDLPEGEHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIHVKKSD 158          
BLAST of 5'-AMP-activated protein kinase subunit beta-1 vs. Ensembl Mouse
Match: Prkab1 (protein kinase, AMP-activated, beta 1 non-catalytic subunit [Source:MGI Symbol;Acc:MGI:1336167])

HSP 1 Score: 70.4774 bits (171), Expect = 4.430e-14
Identity = 30/64 (46.88%), Postives = 45/64 (70.31%), Query Frame = 1
Query:  262 PTFFRWTGKVNKSISISGSFNNWENNIPLSKCGEDSYFVIINCSAGSHMYKYFIDGNWYHDPSQ 453
            PT FRWTG   K + +SGSFNNW + +PL++  ++++  I++   G H YK+F+DG W HDPS+
Sbjct:   79 PTVFRWTGG-GKEVYLSGSFNNW-SKLPLTR-SQNNFVAILDLPEGEHQYKFFVDGQWTHDPSE 139          
BLAST of 5'-AMP-activated protein kinase subunit beta-1 vs. UniProt/SwissProt
Match: sp|Q9R078|AAKB1_MOUSE (5'-AMP-activated protein kinase subunit beta-1 OS=Mus musculus OX=10090 GN=Prkab1 PE=1 SV=2)

HSP 1 Score: 146.747 bits (369), Expect = 7.908e-41
Identity = 82/204 (40.20%), Postives = 117/204 (57.35%), Query Frame = 1
Query:  262 PTFFRWTGKVNKSISISGSFNNWENNIPLSKCGEDSYFVIINCSAGSHMYKYFIDGNWYHDPSQEVVQNTFGTFDNIVHVKEADSTSIXXXXXXXXXXXXXYQAPSISNPDMKRLSPTGDYSQNVPRRTITDYDIVPMQFPSYLNESILDAATQSNLEPSLLPHPQHVQLNHMYASSIKDGLICLSATIRYRSKFITIILYKTI 873
            PT FRWTG   K + +SGSFNNW + +PL++  ++++  I++   G H YK+F+DG W HDPS+ +V +  GT +NI+ VK+ D    D    D    S   +  S         SP G Y Q        +    P   P +L + IL+  T  + +P+LLP P HV LNH+YA SIKDG++ LSAT RY+ K++T +LYK I
Sbjct:   79 PTVFRWTGG-GKEVYLSGSFNNW-SKLPLTRS-QNNFVAILDLPEGEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDVSELSS---------SPPGPYHQEPYMSKPEERFKAPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTTLLYKPI 270          
BLAST of 5'-AMP-activated protein kinase subunit beta-1 vs. UniProt/SwissProt
Match: sp|O43741|AAKB2_HUMAN (5'-AMP-activated protein kinase subunit beta-2 OS=Homo sapiens OX=9606 GN=PRKAB2 PE=1 SV=1)

HSP 1 Score: 146.362 bits (368), Expect = 1.259e-40
Identity = 83/204 (40.69%), Postives = 117/204 (57.35%), Query Frame = 1
Query:  262 PTFFRWTGKVNKSISISGSFNNWENNIPLSKCGEDSYFVIINCSAGSHMYKYFIDGNWYHDPSQEVVQNTFGTFDNIVHVKEADSTSIXXXXXXXXXXXXXYQAPSISNPDMKRLSPTGDYSQNVPRRTITDYDIVPMQFPSYLNESILDAATQSNLEPSLLPHPQHVQLNHMYASSIKDGLICLSATIRYRSKFITIILYKTI 873
            PT  RW+ +  K + ISGSFNNW   IPL K   D +  I++   G H YK+F+DG W HDPS+ VV +  GT +N++HVK++D      F   D+      ++   S  D+   SP G Y Q +      +    P   P +L + IL+  T  + +P+LLP P HV LNH+YA SIKD ++ LSAT RY+ K++T +LYK I
Sbjct:   78 PTVIRWS-EGGKEVFISGSFNNWSTKIPLIKSHND-FVAILDLPEGEHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIHVKKSD------FEVFDALKLDSMESSETSCRDLSS-SPPGPYGQEMYAFRSEERFKSPPILPPHLLQVILNKDTNISCDPALLPEPNHVMLNHLYALSIKDSVMVLSATHRYKKKYVTTLLYKPI 272          
BLAST of 5'-AMP-activated protein kinase subunit beta-1 vs. UniProt/SwissProt
Match: sp|P80386|AAKB1_RAT (5'-AMP-activated protein kinase subunit beta-1 OS=Rattus norvegicus OX=10116 GN=Prkab1 PE=1 SV=4)

HSP 1 Score: 145.976 bits (367), Expect = 1.510e-40
Identity = 82/204 (40.20%), Postives = 117/204 (57.35%), Query Frame = 1
Query:  262 PTFFRWTGKVNKSISISGSFNNWENNIPLSKCGEDSYFVIINCSAGSHMYKYFIDGNWYHDPSQEVVQNTFGTFDNIVHVKEADSTSIXXXXXXXXXXXXXYQAPSISNPDMKRLSPTGDYSQNVPRRTITDYDIVPMQFPSYLNESILDAATQSNLEPSLLPHPQHVQLNHMYASSIKDGLICLSATIRYRSKFITIILYKTI 873
            PT FRWTG   K + +SGSFNNW + +PL++  ++++  I++   G H YK+F+DG W HDPS+ +V +  GT +NI+ VK+ D    D    D    S   +  S         SP G Y Q        +    P   P +L + IL+  T  + +P+LLP P HV LNH+YA SIKDG++ LSAT RY+ K++T +LYK I
Sbjct:   79 PTVFRWTGG-GKEVYLSGSFNNW-SKLPLTRS-QNNFVAILDLPEGEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDVSELSS---------SPPGPYHQEPYISKPEERFKAPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTTLLYKPI 270          
BLAST of 5'-AMP-activated protein kinase subunit beta-1 vs. UniProt/SwissProt
Match: sp|Q6PAM0|AAKB2_MOUSE (5'-AMP-activated protein kinase subunit beta-2 OS=Mus musculus OX=10090 GN=Prkab2 PE=1 SV=1)

HSP 1 Score: 145.591 bits (366), Expect = 2.271e-40
Identity = 83/204 (40.69%), Postives = 117/204 (57.35%), Query Frame = 1
Query:  262 PTFFRWTGKVNKSISISGSFNNWENNIPLSKCGEDSYFVIINCSAGSHMYKYFIDGNWYHDPSQEVVQNTFGTFDNIVHVKEADSTSIXXXXXXXXXXXXXYQAPSISNPDMKRLSPTGDYSQNVPRRTITDYDIVPMQFPSYLNESILDAATQSNLEPSLLPHPQHVQLNHMYASSIKDGLICLSATIRYRSKFITIILYKTI 873
            PT  RW+ +  K + ISGSFNNW   IPL K   D +  I++   G H YK+F+DG W HDPS+ VV +  GT +N++HVK++D      F   D+      ++   S  D+   SP G Y Q +      +    P   P +L + IL+  T  + +P+LLP P HV LNH+YA SIKD ++ LSAT RY+ K++T +LYK I
Sbjct:   77 PTVIRWS-EGGKEVFISGSFNNWSTKIPLIKSHND-FVAILDLPEGEHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIHVKKSD------FEVFDALKLDSMESSETSCRDLSS-SPPGPYGQEMYVFRSEERFKSPPILPPHLLQVILNKDTNISCDPALLPEPNHVMLNHLYALSIKDSVMVLSATHRYKKKYVTTLLYKPI 271          
BLAST of 5'-AMP-activated protein kinase subunit beta-1 vs. UniProt/SwissProt
Match: sp|Q5BIS9|AAKB1_BOVIN (5'-AMP-activated protein kinase subunit beta-1 OS=Bos taurus OX=9913 GN=PRKAB1 PE=2 SV=3)

HSP 1 Score: 145.206 bits (365), Expect = 3.882e-40
Identity = 82/204 (40.20%), Postives = 116/204 (56.86%), Query Frame = 1
Query:  262 PTFFRWTGKVNKSISISGSFNNWENNIPLSKCGEDSYFVIINCSAGSHMYKYFIDGNWYHDPSQEVVQNTFGTFDNIVHVKEADSTSIXXXXXXXXXXXXXYQAPSISNPDMKRLSPTGDYSQNVPRRTITDYDIVPMQFPSYLNESILDAATQSNLEPSLLPHPQHVQLNHMYASSIKDGLICLSATIRYRSKFITIILYKTI 873
            PT FRWTG   K + +SGSFNNW + +PL++   +++  I++   G H YK+F+DG W HDPS+ VV +  GT +N++ VK+ D    D    D    S   +  S         SP G Y Q        +    P   P +L + IL+  T  + +P+LLP P HV LNH+YA SIKDG++ LSAT RY+ K++T +LYK I
Sbjct:   79 PTVFRWTGG-GKEVYLSGSFNNW-SKLPLTRS-HNNFVAILDLPEGEHQYKFFVDGQWTHDPSEPVVTSQLGTVNNVIQVKKTDFEVFDALMVDSQKCSDVSELSS---------SPPGPYHQEPYISKPEERFKAPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTTLLYKPI 270          
BLAST of 5'-AMP-activated protein kinase subunit beta-1 vs. TrEMBL
Match: A0A0L8H7W3 (AMPKBI domain-containing protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22020788mg PE=4 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 2.109e-44
Identity = 89/212 (41.98%), Postives = 124/212 (58.49%), Query Frame = 1
Query:  259 IPTFFRWTGKVNKSISISGSFNNWENNIPLSKCGEDSYFVIINCSAGSHMYKYFIDGNWYHDPSQEVVQNTFGTFDNIVHVKEADSTSIXXXXXXXXXXXXXYQAPSI--SNPDMKRL-----SPTGDYSQNVPRRTITDYDIVPMQFPSYLNESILDAATQSNLEPSLLPHPQHVQLNHMYASSIKDGLICLSATIRYRSKFITIILYKTI 873
            +PT FRW G   K + +SGSFNNW+N IPL+K   D +F I+N   G H YK+++DG W HD ++  V N+ GT +N+V V ++D                 ++A +I   N   KR      SP+GDY Q +P R  +D    P   P +L + IL+  T ++ EP LLP P HV LNH+YA SIKDG++ LS T R+R K++T +LYK I
Sbjct:   72 LPTVFRWEGAA-KEVCLSGSFNNWKNTIPLAKSNGD-FFTILNLPEGEHQYKFYVDGQWLHDQNEPTVPNSMGTLNNVVVVNKSD--------------FEVFEALAIDSENSGNKRKNDVAGSPSGDYGQEIPPRR-SDKIAGPPFIPPHLLQVILNKDTPAHCEPILLPEPNHVMLNHLYALSIKDGVMVLSTTHRFRKKYVTTLLYKPI 266          
BLAST of 5'-AMP-activated protein kinase subunit beta-1 vs. TrEMBL
Match: W4YLN6 (AMPKBI domain-containing protein OS=Strongylocentrotus purpuratus OX=7668 PE=4 SV=1)

HSP 1 Score: 160.999 bits (406), Expect = 1.024e-43
Identity = 83/210 (39.52%), Postives = 120/210 (57.14%), Query Frame = 1
Query:  256 SIPTFFRWTGKVNKSISISGSFNNWENNIPLSKCGEDSYFVIINCSAGSHMYKYFIDGNWYHDPSQEVVQNTFGTFDNIVHVKEADSTSIXXXXXXXXXXXXXYQAPSISNPDMKRL----SPTGDYSQNVPRRTITDYDIVPMQFPSYLNESILDAATQSNLEPSLLPHPQHVQLNHMYASSIKDGLICLSATIRYRSKFITIILYKTI 873
            ++P  FRW G   KS++++GSFNNW   IP+ K   D +  I+N   G H YK+++DG W H+P Q +  NTFGT +N + V ++D                 ++A +I +   K +    SP GDY+Q++P + +      P   P  L + IL+       EP+LLP P HV LNH+YA SIKDG++ LSAT RYR K++T +LYK I
Sbjct:   81 ALPVVFRWEGG-GKSVAVAGSFNNWNTKIPMIKSQGD-FTAIVNLPEGQHEYKFYVDGQWIHNPRQPLQSNTFGTVNNFISVSKSD--------------FEVFEALAIDSEREKGVDMSGSPPGDYNQDIPSQELQQRTTGPPILPPQLLQVILNKDIGPQYEPALLPEPNHVMLNHLYALSIKDGVMVLSATHRYRKKYVTSLLYKPI 274          
BLAST of 5'-AMP-activated protein kinase subunit beta-1 vs. TrEMBL
Match: A0A4S2LKB1 (AMPKBI domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_006547 PE=4 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 1.424e-43
Identity = 109/309 (35.28%), Postives = 159/309 (51.46%), Query Frame = 1
Query:   31 NQSAVLKYKNEIEKDLSFDRSRLSPYKCEVSSE---VFPNSKASKYHHSPLFISMHRK-----AHIFERTNEKPKEFYD--EINFSIPTFFRWTGKVNKSISISGSFNNWENNIPLSKCGEDSYFVIINCSAGSHMYKYFIDGNWYHDPSQEVVQNTFGTFDNIVHVKEADSTSIXXXXXXXXXXXXXYQAPSISNPDMKRLSPTGDYSQNVP-------RRTITDYDIVPMQ-----------FPSYLNESILDAATQSNLEPSLLPHPQHVQLNHMYASSIKDGLICLSATIRYRSKFITIILYKTI 873
            +  +++ Y +E+ +D S  + R +   C   ++     P S AS    SP+ +          A    RT ++ +  +   +     PT FRW G   K I ISG+FNNWE  IP+ K     Y VII+C+ G+H YKYFIDG WYHDP++  V N  GT +N+VHVK +D  +I     D ++S         S+PD    SP G+Y + +P       RR+ +     P+             P +L + IL+  T  + +P+LLP P HV +NH+YA SIKDG+I LS   RYR KF++ + YK I
Sbjct:   35 DHQSLVPYPDELLRDDSLRKHRPASTGCPSPTDRRLFLPQSGASTCS-SPVTVDRPTTLTQTFARPARRTAQQQRSSHQTPDSELKCPTVFRWDGG-GKDIYISGTFNNWEKRIPMVKRNSGVY-VIIDCTPGTHEYKYFIDGAWYHDPTKPTVDNGLGTKNNVVHVKFSDFDAIQALELDQANSRHRSSVMESSDPDSMGHSPPGNYGRYIPSHPSEFQRRSGSFGSPGPIAPGIGTLTQPPLLPPHLLQGILNMDTGVHCDPNLLPPPNHVIVNHLYALSIKDGVIVLSVITRYRQKFVSTVFYKPI 340          
BLAST of 5'-AMP-activated protein kinase subunit beta-1 vs. TrEMBL
Match: H2KT28 (5'-AMP-activated protein kinase subunit beta-2 OS=Clonorchis sinensis OX=79923 GN=CLF_111537 PE=4 SV=1)

HSP 1 Score: 163.31 bits (412), Expect = 6.090e-43
Identity = 110/309 (35.60%), Postives = 159/309 (51.46%), Query Frame = 1
Query:   31 NQSAVLKYKNEIEKDLSFDRSRLSPYKCEVSSE---VFPNSKASKYHHSPLFISMHRK-----AHIFERTNEKPKEFYD--EINFSIPTFFRWTGKVNKSISISGSFNNWENNIPLSKCGEDSYFVIINCSAGSHMYKYFIDGNWYHDPSQEVVQNTFGTFDNIVHVKEADSTSIXXXXXXXXXXXXXYQAPSISNPDMKRLSPTGDYSQNVP-------RRTITDYDIVPMQ-----------FPSYLNESILDAATQSNLEPSLLPHPQHVQLNHMYASSIKDGLICLSATIRYRSKFITIILYKTI 873
            +  +V+ Y +E+ +D S  + R +   C   ++     P S AS    SP+ +          A    RT ++ +  +   +     PT FRW G   K I ISG+FNNWE  IP+ K     Y VII+C+ G+H YKYFIDG WYHDP++  V N  GT +N+VHVK +D  +I     D ++S         S+PD    SP G+Y + +P       RR+ +     P+             P +L + IL+  T  + +P+LLP P HV +NH+YA SIKDG+I LS   RYR KF++ + YK I
Sbjct:  129 DHQSVIPYPDELLRDTSLRKHRPASTGCPSPTDRRLFLPQSGASTCS-SPVTVDRPTTLTQTFARPARRTAQQQRFNHQTPDSELKCPTVFRWDGG-GKDIYISGTFNNWEKRIPMVKRNSGVY-VIIDCTPGTHEYKYFIDGAWYHDPTKPTVDNGLGTKNNVVHVKFSDFDAIQALELDQANSRHRSSVMESSDPDSMGHSPPGNYGRYIPSHPSEFQRRSGSFGSPGPIAPGIGTLTQPPLLPPHLLQGILNMDTGVHCDPNLLPPPNHVIVNHLYALSIKDGVIVLSVITRYRQKFVSTVFYKPI 434          
BLAST of 5'-AMP-activated protein kinase subunit beta-1 vs. TrEMBL
Match: A0A4V3SED2 (AMPKBI domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_006547 PE=4 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 8.674e-43
Identity = 109/309 (35.28%), Postives = 159/309 (51.46%), Query Frame = 1
Query:   31 NQSAVLKYKNEIEKDLSFDRSRLSPYKCEVSSE---VFPNSKASKYHHSPLFISMHRK-----AHIFERTNEKPKEFYD--EINFSIPTFFRWTGKVNKSISISGSFNNWENNIPLSKCGEDSYFVIINCSAGSHMYKYFIDGNWYHDPSQEVVQNTFGTFDNIVHVKEADSTSIXXXXXXXXXXXXXYQAPSISNPDMKRLSPTGDYSQNVP-------RRTITDYDIVPMQ-----------FPSYLNESILDAATQSNLEPSLLPHPQHVQLNHMYASSIKDGLICLSATIRYRSKFITIILYKTI 873
            +  +++ Y +E+ +D S  + R +   C   ++     P S AS    SP+ +          A    RT ++ +  +   +     PT FRW G   K I ISG+FNNWE  IP+ K     Y VII+C+ G+H YKYFIDG WYHDP++  V N  GT +N+VHVK +D  +I     D ++S         S+PD    SP G+Y + +P       RR+ +     P+             P +L + IL+  T  + +P+LLP P HV +NH+YA SIKDG+I LS   RYR KF++ + YK I
Sbjct:  109 DHQSLVPYPDELLRDDSLRKHRPASTGCPSPTDRRLFLPQSGASTCS-SPVTVDRPTTLTQTFARPARRTAQQQRSSHQTPDSELKCPTVFRWDGG-GKDIYISGTFNNWEKRIPMVKRNSGVY-VIIDCTPGTHEYKYFIDGAWYHDPTKPTVDNGLGTKNNVVHVKFSDFDAIQALELDQANSRHRSSVMESSDPDSMGHSPPGNYGRYIPSHPSEFQRRSGSFGSPGPIAPGIGTLTQPPLLPPHLLQGILNMDTGVHCDPNLLPPPNHVIVNHLYALSIKDGVIVLSVITRYRQKFVSTVFYKPI 414          
BLAST of 5'-AMP-activated protein kinase subunit beta-1 vs. Ensembl Cavefish
Match: prkab1a (5'-AMP-activated protein kinase subunit beta-1-like [Source:NCBI gene;Acc:111195052])

HSP 1 Score: 157.147 bits (396), Expect = 1.028e-45
Identity = 86/216 (39.81%), Postives = 123/216 (56.94%), Query Frame = 1
Query:  232 EFYDEINFSIPTFFRWTGKVNKSISISGSFNNWENNIPLSKCGEDSYFVIINCSAGSHMYKYFIDGNWYHDPSQEVVQNTFGTFDNIVHVKEADSTSIXXXXXXXXXXXXXYQAPSISNPDMKRLS--PTGDYSQNVPRRTITDYDIVPMQFPSYLNESILDAATQSNLEPSLLPHPQHVQLNHMYASSIKDGLICLSATIRYRSKFITIILYKTI 873
            E  D+   + PT FRWTG   + + ISGSFNNW N IPL++  ++++  I++   G H YK+++DG W HDP++ VV N  GT +NI+ VK+ D            +        S    DM  LS  P G Y Q+     + +    P   P +L + IL+  T  + +P+LLP P HV LNH+YA SIKDG++ LSAT RY+ K++T +LYK I
Sbjct:   66 EGGDKGLLARPTVFRWTGS-GREVYISGSFNNWTNKIPLTRS-QNNFVAIVDLPEGEHQYKFYVDGQWTHDPTEPVVTNQLGTVNNIIQVKKTD-----------FEVFDALMVDSQKCSDMSDLSSSPPGPYHQDAYVPKLDEKFKSPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTTLLYKPI 268          
BLAST of 5'-AMP-activated protein kinase subunit beta-1 vs. Ensembl Cavefish
Match: prkab1b (5'-AMP-activated protein kinase subunit beta-1 [Source:NCBI gene;Acc:103026611])

HSP 1 Score: 151.369 bits (381), Expect = 1.253e-43
Identity = 84/206 (40.78%), Postives = 115/206 (55.83%), Query Frame = 1
Query:  262 PTFFRWTGKVNKSISISGSFNNWENNIPLSKCGEDSYFVIINCSAGSHMYKYFIDGNWYHDPSQEVVQNTFGTFDNIVHVKEADSTSIXXXXXXXXXXXXXYQAPSISNPDMKRLS--PTGDYSQNVPRRTITDYDIVPMQFPSYLNESILDAATQSNLEPSLLPHPQHVQLNHMYASSIKDGLICLSATIRYRSKFITIILYKTI 873
            PT FRWTG   K + +SGSFNNW N IPLSK    ++  +++   G H YK+++DGNW  DP Q VV +  GT +NI+ VK+ D            +     +  S    DM  +S  P G Y Q        D    P   P +L + +L+  T  + +P+LLP P HV LNH+YA SIKDG++ LSAT RY+ K++T +LYK I
Sbjct:   66 PTVFRWTGPA-KDVYVSGSFNNWANKIPLSKS-HSNFVAVVDLPEGEHQYKFYVDGNWTLDPKQPVVTSKSGTVNNIIQVKKTD-----------FEVFDALKTDSEKCADMSDMSGSPPGPYHQEPYSTKSEDRLRSPPILPPHLLQVLLNKDTGVSCDPALLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTTLLYKPI 258          
BLAST of 5'-AMP-activated protein kinase subunit beta-1 vs. Ensembl Cavefish
Match: PRKAB2 (5'-AMP-activated protein kinase subunit beta-2-like [Source:NCBI gene;Acc:103047649])

HSP 1 Score: 151.369 bits (381), Expect = 1.344e-43
Identity = 84/206 (40.78%), Postives = 115/206 (55.83%), Query Frame = 1
Query:  262 PTFFRWTGKVNKSISISGSFNNWENNIPLSKCGEDSYFVIINCSAGSHMYKYFIDGNWYHDPSQEVVQNTFGTFDNIVHVKEADSTSIXXXXXXXXXXXXXYQAPSISNPDMKRLS--PTGDYSQNVPRRTITDYDIVPMQFPSYLNESILDAATQSNLEPSLLPHPQHVQLNHMYASSIKDGLICLSATIRYRSKFITIILYKTI 873
            PT  RW G   K + I+GSFNNW   IPL+K   D +  I++   G H YK+F+DG W HDPS+ VV +  GT +N++ VK++D            +     Q  S+   D   LS  P G Y Q V      +    P   P +L + IL+  T  + +P+LLP P HV LNH+YA SIKDG++ LSAT RY+ K++T +LYK I
Sbjct:   75 PTVIRWGGG-GKEVYIAGSFNNWSTKIPLNKSHND-FVAILDLPEGEHQYKFFVDGQWLHDPSEPVVTSQMGTINNLIQVKKSD-----------FEVFDALQVDSLECSDTSDLSSSPPGPYGQEVYMFRPEERFKAPPILPPHLLQVILNKDTNISCDPALLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTSLLYKPI 267          
BLAST of 5'-AMP-activated protein kinase subunit beta-1 vs. Ensembl Cavefish
Match: prkab1b (5'-AMP-activated protein kinase subunit beta-1 [Source:NCBI gene;Acc:103026611])

HSP 1 Score: 136.732 bits (343), Expect = 7.286e-38
Identity = 78/194 (40.21%), Postives = 106/194 (54.64%), Query Frame = 1
Query:  262 PTFFRWTGKVNKSISISGSFNNWENNIPLSKCGEDSYFVIINCSAGSHMYKYFIDGNWYHDPSQEVVQNTFGTFDNIVHVKEADSTSIXXXXXXXXXXXXXYQAPSISNPDMKRLS--PTGDYSQNVPRRTITDYDIVPMQFPSYLNESILDAATQSNLEPSLLPHPQHVQLNHMYASSIKDGLICLSATIRYR 837
            PT FRWTG   K + +SGSFNNW N IPLSK    ++  +++   G H YK+++DGNW  DP Q VV +  GT +NI+ VK+ D            +     +  S    DM  +S  P G Y Q        D    P   P +L + +L+  T  + +P+LLP P HV LNH+YA SIKDG++ LSAT RY+
Sbjct:   66 PTVFRWTGPA-KDVYVSGSFNNWANKIPLSKS-HSNFVAVVDLPEGEHQYKFYVDGNWTLDPKQPVVTSKSGTVNNIIQVKKTD-----------FEVFDALKTDSEKCADMSDMSGSPPGPYHQEPYSTKSEDRLRSPPILPPHLLQVLLNKDTGVSCDPALLPEPNHVMLNHLYALSIKDGVMVLSATHRYK 246          
BLAST of 5'-AMP-activated protein kinase subunit beta-1 vs. Ensembl Cavefish
Match: prkab1a (5'-AMP-activated protein kinase subunit beta-1-like [Source:NCBI gene;Acc:111195052])

HSP 1 Score: 126.716 bits (317), Expect = 2.634e-34
Identity = 73/193 (37.82%), Postives = 104/193 (53.89%), Query Frame = 1
Query:  232 EFYDEINFSIPTFFRWTGKVNKSISISGSFNNWENNIPLSKCGEDSYFVIINCSAGSHMYKYFIDGNWYHDPSQEVVQNTFGTFDNIVHVKEADSTSIXXXXXXXXXXXXXYQAPSISNPDMKRL--SPTGDYSQNVPRRTITDYDIVPMQFPSYLNESILDAATQSNLEPSLLPHPQHVQLNHMYASSIKDG 804
            E  D+   + PT FRWTG   + + ISGSFNNW N IPL++  ++++  I++   G H YK+++DG W HDP++ VV N  GT +NI+ VK+ D            +        S    DM  L  SP G Y Q+     + +    P   P +L + IL+  T  + +P+LLP P HV LNH+YA SIK G
Sbjct:   66 EGGDKGLLARPTVFRWTGS-GREVYISGSFNNWTNKIPLTRS-QNNFVAIVDLPEGEHQYKFYVDGQWTHDPTEPVVTNQLGTVNNIIQVKKTD-----------FEVFDALMVDSQKCSDMSDLSSSPPGPYHQDAYVPKLDEKFKSPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLYALSIKVG 245          
BLAST of 5'-AMP-activated protein kinase subunit beta-1 vs. Ensembl Yeast
Match: SIP2 (One of three beta subunits of the Snf1 kinase complex; involved in the response to glucose starvation; null mutants exhibit accelerated aging; N-myristoylprotein localized to the cytoplasm and the plasma membrane; SIP2 has a paralog, GAL83, that arose from the whole genome duplication [Source:SGD;Acc:S000003176])

HSP 1 Score: 60.8474 bits (146), Expect = 6.029e-11
Identity = 60/257 (23.35%), Postives = 100/257 (38.91%), Query Frame = 1
Query:  259 IPTFFRWTGKVNKSISISGSFNNWENNIPLSKCGED--SYFVIINCSAGSHMYKYFIDGNWYHDPSQEVVQNTFGTFDNIVHVKEADSTSIXXXXXXXXXXXXXYQAPSISNPDMKRLS--------------------------PTGDYSQNVP------------------RRTITDYD-IVPMQFPSYLNESILDA--ATQSNLEP---SLLPHPQHVQLNHMYASSIKDGLICLSATIRYRSKFITIILYKTI 873
            +P   RW    +K + ++GSF  W   I L    ++  S+ V +    G+H +++ +D             +  G F N + V++ +    +E            +A S+  P   R S                          P  +Y+ ++P                  +++ TD   + P Q P  L   IL+   ATQ          LP P HV LNH+  SSIK   +C+++ +RY+ K++T ILY  I
Sbjct:  164 VPVEIRWQQGGSK-VYVTGSFTKWRKMIGLIPDSDNNGSFHVKLRLLPGTHRFRFIVDNELRVSDFLPTATDQMGNFVNYIEVRQPEKNPTNEKIRSK-------EADSMRPPTSDRSSIALQIGKDPDDFGDGYTRFHEDLSPRPPLEYTTDIPAVFTDPSVMERYYYTLDRQQSNTDTSWLTPPQLPPQLENVILNKYYATQDQFNENNSGALPIPNHVVLNHLVTSSIKHNTLCVASIVRYKQKYVTQILYTPI 412          
BLAST of 5'-AMP-activated protein kinase subunit beta-1 vs. Ensembl Yeast
Match: GAL83 (One of three possible beta-subunits of the Snf1 kinase complex; allows nuclear localization of the Snf1 kinase complex in the presence of a nonfermentable carbon source; necessary and sufficient for phosphorylation of the Mig2p transcription factor in response to alkaline stress; functionally redundant with SIP1 and SIP2 for the phosphorylation of Mig1p in response to glucose deprivation; contains a glycogen-binding domain [Source:SGD;Acc:S000000829])

HSP 1 Score: 56.6102 bits (135), Expect = 1.729e-9
Identity = 27/72 (37.50%), Postives = 43/72 (59.72%), Query Frame = 1
Query:  664 IVPMQFPSYLNESILDA--ATQSNLEPSLLPHPQHVQLNHMYASSIKDGLICLSATIRYRSKFITIILYKTI 873
            + P Q P +L   IL++    Q++     LP P HV LNH+  SSIK   +C+++ +RY+ K++T ILY  +
Sbjct:  345 LTPPQLPPHLENVILNSYSNAQTDNTSGALPIPNHVILNHLATSSIKHNTLCVASIVRYKQKYVTQILYTPL 416          
BLAST of 5'-AMP-activated protein kinase subunit beta-1 vs. Ensembl Nematostella
Match: EDO33540 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRX9])

HSP 1 Score: 134.42 bits (337), Expect = 1.986e-37
Identity = 79/214 (36.92%), Postives = 115/214 (53.74%), Query Frame = 1
Query:  253 FSIPTFFRWTGKVNKSISISGSFNNWENNIPLSKCGEDSYFVIINCSAGSHMYKYFIDGNWYHDPSQEVVQNTFGTFDNIVHVKEADSTSIXXXXXXXXXXXXXYQAPSISNPDMKRLSPTGDYSQNVPR-------RTITDYDIVPMQFPSYLNESILDAATQSNLEPSLLPHPQHVQLNHMYASSIKDGLICLSATIRYRSKFITIILYKTI 873
             +IPT  RW     + + +SGSFN+W+  IP++    + +  II    G H YK+ +DG W HDP+     + FG  +N++ V++ D    D    D + S +     S+S       SP G Y Q +P        R  T+  + P+  P +L   IL+     + +PSLLP P +V LNH+YA SIKDG++ LSAT RYR KF+T +LYK I
Sbjct:   67 MTIPTVIRWENG-GRKVLLSGSFNDWKTRIPMNYS-NNEFTAIIELPEGDHEYKFCVDGRWVHDPNGPTTNDNFGGRNNVISVRKTDMDVFDALDTDANLSINSGSIKSVSG------SPPGTYGQIIPSHVTPVIVRDGTNASVPPI-LPPHLLHVILNKDIVDHDDPSLLPEPDYVSLNHLYALSIKDGVMTLSATFRYREKFVTTLLYKPI 271          
BLAST of 5'-AMP-activated protein kinase subunit beta-1 vs. Ensembl Medaka
Match: prkab1a (5'-AMP-activated protein kinase subunit beta-1 [Source:NCBI gene;Acc:101155912])

HSP 1 Score: 150.214 bits (378), Expect = 5.097e-43
Identity = 85/210 (40.48%), Postives = 122/210 (58.10%), Query Frame = 1
Query:  250 NFSIPTFFRWTGKVNKSISISGSFNNWENNIPLSKCGEDSYFVIINCSAGSHMYKYFIDGNWYHDPSQEVVQNTFGTFDNIVHVKEADSTSIXXXXXXXXXXXXXYQAPSISNPDMKRLSPTGDYSQN--VPRRTITDYDIVPMQFPSYLNESILDAATQSNLEPSLLPHPQHVQLNHMYASSIKDGLICLSATIRYRSKFITIILYKTI 873
            N   PT FRWTG   K + +SGSFNNW N IPL +  ++++  I++   G H YK+++DG W HDP++ V+ +  GT +NI+ VK+ D    D    D   SS                SP G Y Q+  VP++    +   P+  P +L + IL+  T  + +P+LLP P HV LNH+YA SIKDG++ LSAT RY+ K++T +LYK I
Sbjct:   73 NLDRPTVFRWTGD-GKEVFVSGSFNNWANKIPLIRS-QNTFVAIVDLPEGEHQYKFYVDGQWTHDPTEPVITSQLGTVNNIIQVKKTDFEVFDALMVDSQKSSDMSDL---------SSSPPGPYHQDPYVPKQE-EKFKSPPI-LPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTTLLYKPI 269          
BLAST of 5'-AMP-activated protein kinase subunit beta-1 vs. Ensembl Medaka
Match: PRKAB2 (5'-AMP-activated protein kinase subunit beta-2 [Source:NCBI gene;Acc:101166167])

HSP 1 Score: 148.288 bits (373), Expect = 2.221e-42
Identity = 83/206 (40.29%), Postives = 114/206 (55.34%), Query Frame = 1
Query:  262 PTFFRWTGKVNKSISISGSFNNWENNIPLSKCGEDSYFVIINCSAGSHMYKYFIDGNWYHDPSQEVVQNTFGTFDNIVHVKEADSTSIXXXXXXXXXXXXXYQAPSISNPDMKRLS--PTGDYSQNVPRRTITDYDIVPMQFPSYLNESILDAATQSNLEPSLLPHPQHVQLNHMYASSIKDGLICLSATIRYRSKFITIILYKTI 873
            PT  RW G   K + I+GSFNNW   IPL+K   D +  I++   G H YK+F+DG W HDPS+ VV +  GT +N++ VK++D            +     Q  S+   D   LS  P G Y Q         +   P   P +L + IL+  T  + +P+LLP P HV LNH+YA SIKDG++ LSAT RY+ K++T +LYK I
Sbjct:   76 PTVIRWGGG-GKEVYIAGSFNNWNTKIPLNKSHND-FVAILDLPEGEHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIQVKKSD-----------FEVFDALQVDSLECSDTSDLSSSPPGPYGQEQYIFRPEKHFKAPPILPPHLLQVILNKDTNISCDPALLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTSLLYKPI 268          
BLAST of 5'-AMP-activated protein kinase subunit beta-1 vs. Ensembl Medaka
Match: prkab1b (5'-AMP-activated protein kinase subunit beta-1 [Source:NCBI gene;Acc:101165238])

HSP 1 Score: 141.739 bits (356), Expect = 7.972e-40
Identity = 84/250 (33.60%), Postives = 128/250 (51.20%), Query Frame = 1
Query:  172 LFISMHRKAHIFERTNEK-PKEFYDEINF-------------SIPTFFRWTGKVNKSISISGSFNNWENNIPLSKCGEDSYFVIINCSAGSHMYKYFIDGNWYHDPSQEVVQNTFGTFDNIVHVKEADSTSIXXXXXXXXXXXXXYQAPSISNPDMKRLS--PTGDYSQNVPRRTITDYDIVPMQFPSYLNESILDAATQSNLEPSLLPHPQHVQLNHMYASSIKDGLICLSATIRYRSKFITIILYKTI 873
            + +     A +F+R + K P+E  + + +             + PT FRW G   K + +SGSFNNW   IPL++  + ++  I++   G H YK+ +DG W  DP+  V  +  G+ +N++ VK  D            +     +  S  + DM  LS  P G Y QN       D    P   P +L + +L+  T  + +P+LLP P HV LNH+YA SIKDG++ LSAT RY+ K++T +LYK I
Sbjct:   29 IMMDSSEDADLFQREDAKAPQEMQEFLAWQEDLDCDSKSPTHARPTVFRWAGAA-KEVFVSGSFNNWATKIPLNRS-QKNFVAIVDLPEGDHQYKFCVDGQWTLDPAGAVATSKTGSVNNVIQVKRTD-----------FEVFDALRIDSEDSADMSDLSSSPPGPYQQNAYVMKPEDKLKQPPILPPHLLQVLLNKDTGISCDPTLLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTTLLYKPI 265          
BLAST of 5'-AMP-activated protein kinase subunit beta-1 vs. Ensembl Medaka
Match: prkab1b (5'-AMP-activated protein kinase subunit beta-1 [Source:NCBI gene;Acc:101165238])

HSP 1 Score: 141.739 bits (356), Expect = 7.972e-40
Identity = 84/250 (33.60%), Postives = 128/250 (51.20%), Query Frame = 1
Query:  172 LFISMHRKAHIFERTNEK-PKEFYDEINF-------------SIPTFFRWTGKVNKSISISGSFNNWENNIPLSKCGEDSYFVIINCSAGSHMYKYFIDGNWYHDPSQEVVQNTFGTFDNIVHVKEADSTSIXXXXXXXXXXXXXYQAPSISNPDMKRLS--PTGDYSQNVPRRTITDYDIVPMQFPSYLNESILDAATQSNLEPSLLPHPQHVQLNHMYASSIKDGLICLSATIRYRSKFITIILYKTI 873
            + +     A +F+R + K P+E  + + +             + PT FRW G   K + +SGSFNNW   IPL++  + ++  I++   G H YK+ +DG W  DP+  V  +  G+ +N++ VK  D            +     +  S  + DM  LS  P G Y QN       D    P   P +L + +L+  T  + +P+LLP P HV LNH+YA SIKDG++ LSAT RY+ K++T +LYK I
Sbjct:   29 IMMDSSEDADLFQREDAKAPQEMQEFLAWQEDLDCDSKSPTHARPTVFRWAGAA-KEVFVSGSFNNWATKIPLNRS-QKNFVAIVDLPEGDHQYKFCVDGQWTLDPAGAVATSKTGSVNNVIQVKRTD-----------FEVFDALRIDSEDSADMSDLSSSPPGPYQQNAYVMKPEDKLKQPPILPPHLLQVLLNKDTGISCDPTLLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTTLLYKPI 265          
BLAST of 5'-AMP-activated protein kinase subunit beta-1 vs. Ensembl Medaka
Match: prkab1a (5'-AMP-activated protein kinase subunit beta-1 [Source:NCBI gene;Acc:101155912])

HSP 1 Score: 112.079 bits (279), Expect = 1.764e-29
Identity = 62/173 (35.84%), Postives = 99/173 (57.23%), Query Frame = 1
Query:  361 EDSYFVIINCSAGSHMYKYFIDGNWYHDPSQEVVQNTFGTFDNIVHVKEADSTSIXXXXXXXXXXXXXYQAPSISNPDMKRLSPTGDYSQN--VPRRTITDYDIVPMQFPSYLNESILDAATQSNLEPSLLPHPQHVQLNHMYASSIKDGLICLSATIRYRSKFITIILYKTI 873
            ++++  I++   G H YK+++DG W HDP++ V+ +  GT +NI+ VK+ D          +   +    +   S+      SP G Y Q+  VP++   +    P   P +L + IL+  T  + +P+LLP P HV LNH+YA SIKDG++ LSAT RY+ K++T +LYK I
Sbjct:   24 QNTFVAIVDLPEGEHQYKFYVDGQWTHDPTEPVITSQLGTVNNIIQVKKTD---------FEVFDALMVDSQKSSDMSDLSSSPPGPYHQDPYVPKQE--EKFKSPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTTLLYKPI 185          
BLAST of 5'-AMP-activated protein kinase subunit beta-1 vs. Planmine SMEST
Match: SMESG000037698.1 (SMESG000037698.1)

HSP 1 Score: 296.59 bits (758), Expect = 5.440e-102
Identity = 158/158 (100.00%), Postives = 158/158 (100.00%), Query Frame = 1
Query:  406 MYKYFIDGNWYHDPSQEVVQNTFGTFDNIVHVKEADSTSIXXXXXXXXXXXXXYQAPSISNPDMKRLSPTGDYSQNVPRRTITDYDIVPMQFPSYLNESILDAATQSNLEPSLLPHPQHVQLNHMYASSIKDGLICLSATIRYRSKFITIILYKTIPL 879
            MYKYFIDGNWYHDPSQEVVQNTFGTFDNIVHVKEADSTSIDEFFGDDSDSSSFYQAPSISNPDMKRLSPTGDYSQNVPRRTITDYDIVPMQFPSYLNESILDAATQSNLEPSLLPHPQHVQLNHMYASSIKDGLICLSATIRYRSKFITIILYKTIPL
Sbjct:    1 MYKYFIDGNWYHDPSQEVVQNTFGTFDNIVHVKEADSTSIDEFFGDDSDSSSFYQAPSISNPDMKRLSPTGDYSQNVPRRTITDYDIVPMQFPSYLNESILDAATQSNLEPSLLPHPQHVQLNHMYASSIKDGLICLSATIRYRSKFITIILYKTIPL 158          
BLAST of 5'-AMP-activated protein kinase subunit beta-1 vs. Planmine SMEST
Match: SMESG000018914.1 (SMESG000018914.1)

HSP 1 Score: 153.295 bits (386), Expect = 2.837e-44
Identity = 88/233 (37.77%), Postives = 123/233 (52.79%), Query Frame = 1
Query:  190 RKAHIFERTNEKPKEFYDEINFSIPTFFRWTGKVNKSISISGSFNNWENNIPLSKCGEDSYFVIINCSAGSHMYKYFIDGNWYHDPSQEVVQNTFGTFDNIVHVKEADSTSIXXXXXXXXXXXXXYQAPSISNPDMKRLSPTGDYSQNVPRR-----TITDYDIVPMQFPSYLNESILDAATQSNLEPSLLPHPQHVQLNHMYASSIKDGLICLSATIRYRSKFITIILYKTI 873
            ++ ++     +  + F D+    IPT FRW GK  K I ISGSFNNW+  IP+ K  +  Y+ IINC  G   YK+ +DG W HD +Q    N+FGT +N + V + D         D+  S     +  + NP+        +Y Q  P+R           + P   P YLNE++L+      ++P LL  P +VQ+NH+YASSI  G+  LS TIRYR+KFIT I YK I
Sbjct:   51 KQMNMINELKKNKESFEDDKTTGIPTVFRWHGKGEK-IYISGSFNNWKEKIPMKKS-DTVYYTIINCLPGHQSYKFHVDGEWVHDTAQPTEANSFGTMNNWLEVVQEDDNLELALSHDEKFSRKSSDSEFVENPN-------AEYGQIFPQRPNPLIGTKVTSVTPNFLPPYLNETVLNLEDSQKIDPILLRTPVYVQINHLYASSITSGIAALSVTIRYRTKFITTIFYKPI 274          
BLAST of 5'-AMP-activated protein kinase subunit beta-1 vs. Planmine SMEST
Match: SMESG000080480.1 (SMESG000080480.1)

HSP 1 Score: 130.183 bits (326), Expect = 4.677e-35
Identity = 82/258 (31.78%), Postives = 128/258 (49.61%), Query Frame = 1
Query:  190 RKAHIFERTNEKPKEFYDEINFSIPTFFRWTGKVNKSISISGSFNNWENNIPLSKCGEDSYFVIINCSAGSHMYKYFIDGNWYHDPSQEVVQNTFGTFDNIVHVKEAD-------------STSIXXXXXXXXXXXXXYQAPSISNPD-----------MKRLSPTGDYSQNVPRRTITDYDIVPMQFPSYLNES------ILDAATQSNLEPSLLPHPQHVQLNHMYASSIKDGLICLSATIRYRSKFITIILYKTI 873
            R+A + E       +  D  N +IPT F+W G   K + +SGSFN W+  IP+ K  + +++ I+    G H YK+ +DG W  D  Q +  N  G+ +N++ VK +D             S +          ++   ++P   N             ++  SP G YSQ +P++T+   +I   + P+           IL+  T  + +P+LLP P HV +NHMYA SIKDG+I LSA  RYR KF++ ++YK I
Sbjct:   73 REAKLLESHPSMCLDGIDSENKTIPTVFKWEGG-GKDVFLSGSFNLWKAKIPMVKS-KHNFYTIVELPKGEHQYKFIVDGVWKIDNKQHIANNDNGSQNNVISVKSSDFDVLEALKDDIANSKNSSNNVRQSIVTTVPLKSPGGLNESNKPKDGDNENHLQSSSPPGSYSQELPQKTLLS-EIGNEKSPTPPLLPPQLLQVILNKETGVHCDPNLLPQPNHVMINHMYALSIKDGVIVLSAIARYRQKFVSTVMYKPI 327          
BLAST of 5'-AMP-activated protein kinase subunit beta-1 vs. Planmine SMEST
Match: SMESG000052906.1 (SMESG000052906.1)

HSP 1 Score: 45.4394 bits (106), Expect = 2.723e-6
Identity = 30/95 (31.58%), Postives = 46/95 (48.42%), Query Frame = 1
Query:  589 PDMKRLSPTGDYSQNVPRRTITDYDIVPMQFPSYLNESILDAATQSNLEPSLLPHPQHVQLNHMYASSIKDGLICLSATIRYRSKFITIILYKTI 873
            P  K  +   DY  ++  R+    DI     P YL++ ++        +P+LLP  +HV  NH+   ++KD +I L    R+R K IT I  K I
Sbjct:    5 PSEKYTTDIPDYDNDIGLRSFITPDI-----PPYLDQKVIIENDLECDDPTLLPT-KHVIFNHILTHNLKDNIIRLGFVTRFREKIITTIFCKPI 93          
The following BLAST results are available for this feature:
BLAST of 5'-AMP-activated protein kinase subunit beta-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
PRKAB22.622e-4140.69protein kinase AMP-activated non-catalytic subunit... [more]
PRKAB11.928e-4040.20protein kinase AMP-activated non-catalytic subunit... [more]
PRKAB11.928e-4040.20protein kinase AMP-activated non-catalytic subunit... [more]
PRKAB14.756e-1644.94protein kinase AMP-activated non-catalytic subunit... [more]
back to top
BLAST of 5'-AMP-activated protein kinase subunit beta-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
aakb-25.629e-3428.85AMP-Activated Kinase Beta subunit [Source:UniProt... [more]
aakb-17.460e-3433.33AMP-Activated Kinase Beta subunit [Source:UniProt... [more]
aakb-17.460e-3433.33AMP-Activated Kinase Beta subunit [Source:UniProt... [more]
back to top
BLAST of 5'-AMP-activated protein kinase subunit beta-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
alc1.805e-3837.68gene:FBgn0260972 transcript:FBtr0088625[more]
alc3.836e-3737.68gene:FBgn0260972 transcript:FBtr0088624[more]
back to top
BLAST of 5'-AMP-activated protein kinase subunit beta-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prkab1a5.283e-4537.70protein kinase, AMP-activated, beta 1 non-catalyti... [more]
prkab1b2.098e-4039.32protein kinase, AMP-activated, beta 1 non-catalyti... [more]
prkab1b2.098e-4039.32protein kinase, AMP-activated, beta 1 non-catalyti... [more]
CABZ01083448.15.750e-2933.50pep chromosome:GRCz11:2:58739111:58742863:1 gene:E... [more]
prkab1a2.070e-2339.34protein kinase, AMP-activated, beta 1 non-catalyti... [more]
back to top
BLAST of 5'-AMP-activated protein kinase subunit beta-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
prkab21.136e-4241.67protein kinase, AMP-activated, beta 2 non-catalyti... [more]
PRKAB14.880e-2930.08protein kinase, AMP-activated, beta 1 non-catalyti... [more]
PRKAB12.985e-1744.94protein kinase, AMP-activated, beta 1 non-catalyti... [more]
back to top
BLAST of 5'-AMP-activated protein kinase subunit beta-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Prkab11.130e-4140.20protein kinase, AMP-activated, beta 1 non-catalyti... [more]
Prkab11.130e-4140.20protein kinase, AMP-activated, beta 1 non-catalyti... [more]
Prkab23.246e-4140.69protein kinase, AMP-activated, beta 2 non-catalyti... [more]
Prkab25.753e-2147.62protein kinase, AMP-activated, beta 2 non-catalyti... [more]
Prkab14.430e-1446.88protein kinase, AMP-activated, beta 1 non-catalyti... [more]
back to top
BLAST of 5'-AMP-activated protein kinase subunit beta-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9R078|AAKB1_MOUSE7.908e-4140.205'-AMP-activated protein kinase subunit beta-1 OS=... [more]
sp|O43741|AAKB2_HUMAN1.259e-4040.695'-AMP-activated protein kinase subunit beta-2 OS=... [more]
sp|P80386|AAKB1_RAT1.510e-4040.205'-AMP-activated protein kinase subunit beta-1 OS=... [more]
sp|Q6PAM0|AAKB2_MOUSE2.271e-4040.695'-AMP-activated protein kinase subunit beta-2 OS=... [more]
sp|Q5BIS9|AAKB1_BOVIN3.882e-4040.205'-AMP-activated protein kinase subunit beta-1 OS=... [more]
back to top
BLAST of 5'-AMP-activated protein kinase subunit beta-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0L8H7W32.109e-4441.98AMPKBI domain-containing protein OS=Octopus bimacu... [more]
W4YLN61.024e-4339.52AMPKBI domain-containing protein OS=Strongylocentr... [more]
A0A4S2LKB11.424e-4335.28AMPKBI domain-containing protein OS=Opisthorchis f... [more]
H2KT286.090e-4335.605'-AMP-activated protein kinase subunit beta-2 OS=... [more]
A0A4V3SED28.674e-4335.28AMPKBI domain-containing protein OS=Opisthorchis f... [more]
back to top
BLAST of 5'-AMP-activated protein kinase subunit beta-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prkab1a1.028e-4539.815'-AMP-activated protein kinase subunit beta-1-lik... [more]
prkab1b1.253e-4340.785'-AMP-activated protein kinase subunit beta-1 [So... [more]
PRKAB21.344e-4340.785'-AMP-activated protein kinase subunit beta-2-lik... [more]
prkab1b7.286e-3840.215'-AMP-activated protein kinase subunit beta-1 [So... [more]
prkab1a2.634e-3437.825'-AMP-activated protein kinase subunit beta-1-lik... [more]
back to top
BLAST of 5'-AMP-activated protein kinase subunit beta-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 5'-AMP-activated protein kinase subunit beta-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
SIP26.029e-1123.35One of three beta subunits of the Snf1 kinase comp... [more]
GAL831.729e-937.50One of three possible beta-subunits of the Snf1 ki... [more]
back to top
BLAST of 5'-AMP-activated protein kinase subunit beta-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO335401.986e-3736.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of 5'-AMP-activated protein kinase subunit beta-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prkab1a5.097e-4340.485'-AMP-activated protein kinase subunit beta-1 [So... [more]
PRKAB22.221e-4240.295'-AMP-activated protein kinase subunit beta-2 [So... [more]
prkab1b7.972e-4033.605'-AMP-activated protein kinase subunit beta-1 [So... [more]
prkab1b7.972e-4033.605'-AMP-activated protein kinase subunit beta-1 [So... [more]
prkab1a1.764e-2935.845'-AMP-activated protein kinase subunit beta-1 [So... [more]
back to top
BLAST of 5'-AMP-activated protein kinase subunit beta-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000037698.15.440e-102100.00SMESG000037698.1[more]
SMESG000018914.12.837e-4437.77SMESG000018914.1[more]
SMESG000080480.14.677e-3531.78SMESG000080480.1[more]
SMESG000052906.12.723e-631.58SMESG000052906.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012046 ID=SMED30012046|Name=5'-AMP-activated protein kinase subunit beta-1|organism=Schmidtea mediterranea sexual|type=transcript|length=981bp
AAAACTATATAAATCTTATATGTTATGGGAAATCAGTCAGCTGTATTAAA
ATATAAAAATGAAATCGAAAAAGATTTAAGCTTTGATAGATCCAGATTAA
GCCCATATAAATGTGAAGTATCTTCTGAGGTATTTCCCAATTCAAAGGCA
TCCAAGTATCACCATTCGCCTTTATTTATCAGTATGCACAGGAAAGCTCA
CATTTTTGAAAGGACAAATGAAAAACCGAAAGAATTTTATGACGAAATTA
ATTTTTCCATTCCAACATTTTTTAGATGGACTGGCAAAGTGAATAAGTCA
ATTTCAATTTCCGGATCTTTTAATAATTGGGAAAATAATATTCCTCTATC
AAAATGTGGCGAAGATTCTTATTTCGTAATAATCAACTGCAGTGCGGGAT
CTCACATGTACAAATATTTCATAGATGGCAACTGGTATCATGATCCGTCG
CAGGAAGTTGTCCAAAACACATTTGGAACATTTGACAACATTGTCCATGT
CAAAGAAGCTGATTCAACATCAATTGATGAATTTTTCGGCGACGACAGCG
ATTCCTCGTCTTTTTATCAAGCACCCAGCATAAGTAATCCAGATATGAAG
CGCCTGTCTCCTACGGGAGATTATTCGCAGAATGTACCTAGGCGCACAAT
TACTGACTACGACATCGTTCCTATGCAATTTCCTTCATATCTAAATGAGT
CTATTCTTGATGCAGCTACTCAATCAAATTTAGAGCCTTCTCTACTACCT
CATCCTCAACACGTTCAACTAAATCATATGTATGCTTCCTCAATCAAAGA
CGGACTTATTTGTCTCAGTGCAACAATCAGATATCGTTCGAAATTTATAA
CAATAATTCTTTATAAAACAATACCTTTATAAAACAATTGTGATATTTAA
TTAATACTCCAGATATTAGCAATTTCTATTATATTTAGAATATAATTACC
TTTTTAGAGGTCATCACTATTTATATTTGTG
back to top

protein sequence of SMED30012046-orf-1

>SMED30012046-orf-1 ID=SMED30012046-orf-1|Name=SMED30012046-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=286bp
MGNQSAVLKYKNEIEKDLSFDRSRLSPYKCEVSSEVFPNSKASKYHHSPL
FISMHRKAHIFERTNEKPKEFYDEINFSIPTFFRWTGKVNKSISISGSFN
NWENNIPLSKCGEDSYFVIINCSAGSHMYKYFIDGNWYHDPSQEVVQNTF
GTFDNIVHVKEADSTSIDEFFGDDSDSSSFYQAPSISNPDMKRLSPTGDY
SQNVPRRTITDYDIVPMQFPSYLNESILDAATQSNLEPSLLPHPQHVQLN
HMYASSIKDGLICLSATIRYRSKFITIILYKTIPL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0050790regulation of catalytic activity
GO:0007165signal transduction
GO:0016310phosphorylation
GO:0045859regulation of protein kinase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR013783Ig-like_fold
IPR039160AMPKB
IPR037256ASC_dom_sf
IPR006828ASC_dom
IPR032640AMPK1_CBM
IPR014756Ig_E-set
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0016301kinase activity
Vocabulary: cellular component
TermDefinition
GO:0031588nucleotide-activated protein kinase complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006828Association with the SNF1 complex (ASC) domainSMARTSM01010AMPKBI_2coord: 194..284
e-value: 1.4E-22
score: 91.1
IPR006828Association with the SNF1 complex (ASC) domainPFAMPF04739AMPKBIcoord: 217..282
e-value: 4.1E-20
score: 71.8
NoneNo IPR availableGENE3DG3DSA:3.30.160.760coord: 198..284
e-value: 2.5E-23
score: 83.7
NoneNo IPR availablePANTHERPTHR103435'-AMP-ACTIVATED PROTEIN KINASE , BETA SUBUNITcoord: 68..284
NoneNo IPR availableCDDcd02859E_set_AMPKbeta_like_Ncoord: 81..160
e-value: 2.25719E-26
score: 96.8992
IPR032640AMP-activated protein kinase, glycogen-binding domainPFAMPF16561AMPK1_CBMcoord: 80..164
e-value: 2.0E-22
score: 79.2
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 80..178
e-value: 3.2E-21
score: 77.1
IPR0391605'-AMP-activated protein kinase subunit betaPANTHERPTHR10343:SF835'-AMP-ACTIVATED PROTEIN KINASE SUBUNIT BETA-2coord: 68..284
IPR014756Immunoglobulin E-setSUPERFAMILYSSF81296E set domainscoord: 80..163
IPR037256ASC domain superfamilySUPERFAMILYSSF160219AMPKBI-likecoord: 195..282