Calcium-transporting ATPase

Overview
NameCalcium-transporting ATPase
Smed IDSMED30012043
Length (bp)5094
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Calcium-transporting ATPase (SMED30012043) t-SNE clustered cells

Violin plots show distribution of expression levels for Calcium-transporting ATPase (SMED30012043) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Calcium-transporting ATPase (SMED30012043) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Calcium-transporting ATPase (SMED30012043) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012043

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 17

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30012043SMESG000063816.1 SMESG000010536.1 SMESG000045280.1 SMESG000029730.1 dd_Smed_v4_4145_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30012043SMESG000063816.1 SMESG000010536.1 SMESG000045280.1 SMESG000029730.1 dd_Smed_v4_4145_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30012043SMESG000063816.1 SMESG000010536.1 SMESG000045280.1 SMESG000029730.1 dd_Smed_v4_4145_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30012043SMESG000063816.1 SMESG000010536.1 SMESG000045280.1 SMESG000029730.1 dd_Smed_v4_4145_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30012043SMESG000063816.1 SMESG000010536.1 SMESG000045280.1 SMESG000029730.1 dd_Smed_v4_4145_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymal cellSMED30012043SMESG000063816.1 SMESG000010536.1 SMESG000045280.1 SMESG000029730.1 dd_Smed_v4_4145_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30012043SMESG000063816.1 SMESG000010536.1 SMESG000045280.1 SMESG000029730.1 dd_Smed_v4_4145_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30012043SMESG000063816.1 SMESG000010536.1 SMESG000045280.1 SMESG000029730.1 dd_Smed_v4_4145_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30012043SMESG000063816.1 SMESG000010536.1 SMESG000045280.1 SMESG000029730.1 dd_Smed_v4_4145_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012043SMESG000067500.1 SMESG000063816.1 Contig42224uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012043SMESG000067500.1 SMESG000063816.1 Contig42224newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012043SMESG000063816.1 SMESG000063452.1 SMESG000057448.1 SMESG000042736.1 SMESG000032757.1 SMESG000027399.1 SMESG000017350.1 SMESG000011514.1 SMESG000010536.1 SMESG000012070.1 Contig36651uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012043SMESG000063816.1 SMESG000063452.1 SMESG000057448.1 SMESG000042736.1 SMESG000032757.1 SMESG000027399.1 SMESG000017350.1 SMESG000011514.1 SMESG000010536.1 SMESG000012070.1 Contig36651newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30012043 dd_Smed_v4_13142_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30012043 dd_Smed_v4_13142_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30012043 dd_Smed_v6_13142_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30012043SMESG000063816.1 OX_Smed_1.0.18412ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Calcium-transporting ATPase vs. Ensembl Human
Match: ATP2B3 (ATPase plasma membrane Ca2+ transporting 3 [Source:HGNC Symbol;Acc:HGNC:816])

HSP 1 Score: 1219.14 bits (3153), Expect = 0.000e+0
Identity = 671/1198 (56.01%), Postives = 830/1198 (69.28%), Query Frame = 3
Query:  591 ELTDLMMLRQQEAILEIKEKYGDVYEICRRLKTSPQSGLIDDEESIGNRRREFGSNIIPPKPPKTFFRLMWEALQDLTLIVLMGAAVISLALALY------SKFSGSSHG---DETEGDAGWIEXXXXXXXXXXXXXXTAFNDWQKERQFRGLQDQIEGNHKIAVIRGGVAKEXXXXXXXXXXXCQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDIDPMMLSGTHVMEGSAKMLVTAVGLNSQAGIIFALLGAANTEEKDKAETEKPNNQVHKTNSNSKNKGCKNVDEEVELMKLTETHPEDADRCSNHKPNNYASGDANKSEIKNGKVKQEKKVRAPKKKGSVLQLKLNKLASSIGQIGTIVASLTVTILIIKFCINTYVFEKEGWSMD----HLKKMINFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYINGQHNRTHLPSFEELSFNAADMLLKNISINSSYTSRLMATRHVNELPSQIGNKTECALLGFVNGSLKRDYADLRTQWPEEKLIKVYTFNSERKSMSTIIE-DEGKLLLLTKGASEMILNKCSFILGKNGKIQPFTTEDVEALVKNVIEPMASDGLRTIGLAYKEFVKKPDHDYQGLYNEKLDLENEHTLIKDLTLIGIVGIEDPVRPEVPPAIKKCQKAGITVRMVTGDNINTARSIAIKCGILKPGEDFLVMEGKEFNNRVRDPISGKIKQELIDQVWPKLRVLARSSPQDKYTLVTGIIDSHLTRSREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFLGACFITDSPLKAVQMLWVNLIMDTLASLALATEMPTEELLDRAPYGRTKPIISRRMIKNIMGQSIYQLAVTFYLLLHGNVLLDVENGRGLTERGINKPTQHFTAIFNTFVMMTLFNEFNSRKIHGQKNVFDGLQRNVLFIIIWVTTFVGQIVIVQYGGYALHTEALELDHWLWCMLFGIGVLLWAQLINCIPTTVIPKHMPWSKKKLPTAENQALNQYKSVDSGNESEDEDYDDIGDLARQNNDEDDDDIKNSGQILWIRGLSRLQTQQNTCNPNLDNRNDVVYGGVRRFT--LSQVGGV-------QPLLAARRQSSYSNN 4115
            EL  LM LR  EA+ +I+E YGDV  +CRRLKTSP  GL D+   +  RR+ +G N IPPK PKTF +L+WEALQD+TLI+L  AA++SL L+ Y      S+  G+  G   DE E +AGWIEG AIL +VI VVLVTAFNDW KE+QFRGLQ +IE   K  VIR G   ++ V  +VVGDI QVKYGDLLPADG++IQ+ND+K+DESSLTGE DHV+K  D DPM+LSGTHVMEGS +M+VTAVG+NSQ GIIF LLGA   EE+ K +  K  +   +++     K    V  E++ +K  E                   G+  + E        +KK  APKK+ SVLQ KL KLA  IG+ G +++++TV IL++ F I T+V E   W  +    +++  + F IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSY+   H +  +P+   L+    D+L+  ISINS+YT++++       LP Q+GNKTECALLGFV   LKRD+  +R Q PE+KL KVYTFNS RKSMST+I   +G   L +KGASE++L KC+ IL  NG+++ F   D + +V+ +IEPMA DGLRTI +AY++F    + D+          +NE+ ++ DLT I +VGIEDPVRPEVP AI+KCQ+AGITVRMVTGDNINTAR+IA KCGI++PGEDFL +EGKEFN R+R+   G+I+QE +D+VWPKLRVLARSSP DK+TLV GIIDS     R+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSI+KFLQFQLTVNVVAVIVAF GAC   DSPLKAVQMLWVNLIMDT ASLALATE PTE LL R PYGR KP+ISR M+KNI+G ++YQLA+ F LL  G +  D+++GR       + P++H+T IFNTFVMM LFNE N+RKIHG++NVFDG+  N +F  I + TF  QIVIVQ+GG       L  + WLWC+  G+G L+W Q+I  IPT+                    L   K    G   +DE  D+      +  D  + +++  GQILW RGL+R+QTQ    +     R+  V G VRR +  LSQ+  V         +L+A   +S + N
Sbjct:   33 ELRTLMELRGAEALQKIEEAYGDVSGLCRRLKTSPTEGLADNTNDLEKRRQIYGQNFIPPKQPKTFLQLVWEALQDVTLIILEVAAIVSLGLSFYAPPGEESEACGNVSGGAEDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEKQFRGLQSRIEQEQKFTVIRNGQLLQVPVAALVVGDIAQVKYGDLLPADGVLIQANDLKIDESSLTGESDHVRKSADKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGGEEEEKKDKKGKQQDGAMESSQTKAKKQDGAVAMEMQPLKSAE------------------GGEMEERE--------KKKANAPKKEKSVLQGKLTKLAVQIGKAGLVMSAITVIILVLYFVIETFVVEGRTWLAECTPVYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYLGDTHYK-EIPAPSALTPKILDLLVHAISINSAYTTKILPPEKEGALPRQVGNKTECALLGFVL-DLKRDFQPVREQIPEDKLYKVYTFNSVRKSMSTVIRMPDGGFRLFSKGASEILLKKCTNILNSNGELRGFRPRDRDDMVRKIIEPMACDGLRTICIAYRDFSAGQEPDW----------DNENEVVGDLTCIAVVGIEDPVRPEVPEAIRKCQRAGITVRMVTGDNINTARAIAAKCGIIQPGEDFLCLEGKEFNRRIRNE-KGEIEQERLDKVWPKLRVLARSSPTDKHTLVKGIIDSTTGEQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTESLLLRKPYGRDKPLISRTMMKNILGHAVYQLAIIFTLLFVGELFFDIDSGRNAPLH--SPPSEHYTIIFNTFVMMQLFNEINARKIHGERNVFDGIFSNPIFCTIVLGTFGIQIVIVQFGGKPFSCSPLSTEQWLWCLFVGVGELVWGQVIATIPTS-------------------QLKCLKEAGHG-PGKDEMTDEELAEGEEEIDHAERELRR-GQILWFRGLNRIQTQMEVVSTF--KRSGSVQGAVRRRSSVLSQLHDVTNLSTPTHAILSAANPTSAAGN 1166          
BLAST of Calcium-transporting ATPase vs. Ensembl Human
Match: ATP2B3 (ATPase plasma membrane Ca2+ transporting 3 [Source:HGNC Symbol;Acc:HGNC:816])

HSP 1 Score: 1214.52 bits (3141), Expect = 0.000e+0
Identity = 657/1144 (57.43%), Postives = 808/1144 (70.63%), Query Frame = 3
Query:  591 ELTDLMMLRQQEAILEIKEKYGDVYEICRRLKTSPQSGLIDDEESIGNRRREFGSNIIPPKPPKTFFRLMWEALQDLTLIVLMGAAVISLALALY------SKFSGSSHG---DETEGDAGWIEXXXXXXXXXXXXXXTAFNDWQKERQFRGLQDQIEGNHKIAVIRGGVAKEXXXXXXXXXXXCQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDIDPMMLSGTHVMEGSAKMLVTAVGLNSQAGIIFALLGAANTEEKDKAETEKPNNQVHKTNSNSKNKGCKNVDEEVELMKLTETHPEDADRCSNHKPNNYASGDANKSEIKNGKVKQEKKVRAPKKKGSVLQLKLNKLASSIGQIGTIVASLTVTILIIKFCINTYVFEKEGWSMD----HLKKMINFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYINGQHNRTHLPSFEELSFNAADMLLKNISINSSYTSRLMATRHVNELPSQIGNKTECALLGFVNGSLKRDYADLRTQWPEEKLIKVYTFNSERKSMSTIIE-DEGKLLLLTKGASEMILNKCSFILGKNGKIQPFTTEDVEALVKNVIEPMASDGLRTIGLAYKEFVKKPDHDYQGLYNEKLDLENEHTLIKDLTLIGIVGIEDPVRPEVPPAIKKCQKAGITVRMVTGDNINTARSIAIKCGILKPGEDFLVMEGKEFNNRVRDPISGKIKQELIDQVWPKLRVLARSSPQDKYTLVTGIIDSHLTRSREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFLGACFITDSPLKAVQMLWVNLIMDTLASLALATEMPTEELLDRAPYGRTKPIISRRMIKNIMGQSIYQLAVTFYLLLHGNVLLDVENGRGLTERGINKPTQHFTAIFNTFVMMTLFNEFNSRKIHGQKNVFDGLQRNVLFIIIWVTTFVGQIVIVQYGGYALHTEALELDHWLWCMLFGIGVLLWAQLINCIPTTVIPKHMPWSKKKLPTAENQALNQYKSVDSGNESEDEDYDDIGDLARQNNDEDDDDIKNSGQILWIRGLSRLQTQ 3980
            EL  LM LR  EA+ +I+E YGDV  +CRRLKTSP  GL D+   +  RR+ +G N IPPK PKTF +L+WEALQD+TLI+L  AA++SL L+ Y      S+  G+  G   DE E +AGWIEG AIL +VI VVLVTAFNDW KE+QFRGLQ +IE   K  VIR G   ++ V  +VVGDI QVKYGDLLPADG++IQ+ND+K+DESSLTGE DHV+K  D DPM+LSGTHVMEGS +M+VTAVG+NSQ GIIF LLGA   EE+ K +  K  +   +++     K    V  E++ +K  E                   G+  + E        +KK  APKK+ SVLQ KL KLA  IG+ G +++++TV IL++ F I T+V E   W  +    +++  + F IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSY+   H +  +P+   L+    D+L+  ISINS+YT++++       LP Q+GNKTECALLGFV   LKRD+  +R Q PE+KL KVYTFNS RKSMST+I   +G   L +KGASE++L KC+ IL  NG+++ F   D + +V+ +IEPMA DGLRTI +AY++F    + D+          +NE+ ++ DLT I +VGIEDPVRPEVP AI+KCQ+AGITVRMVTGDNINTAR+IA KCGI++PGEDFL +EGKEFN R+R+   G+I+QE +D+VWPKLRVLARSSP DK+TLV GIIDS     R+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSI+KFLQFQLTVNVVAVIVAF GAC   DSPLKAVQMLWVNLIMDT ASLALATE PTE LL R PYGR KP+ISR M+KNI+G ++YQLA+ F LL  G +  D+++GR       + P++H+T IFNTFVMM LFNE N+RKIHG++NVFDG+  N +F  I + TF  QIVIVQ+GG       L  + WLWC+  G+G L+W Q+I  IPT+                    L   K    G   +DE  D+      +  D  + +++  GQILW RGL+R+QTQ
Sbjct:   33 ELRTLMELRGAEALQKIEEAYGDVSGLCRRLKTSPTEGLADNTNDLEKRRQIYGQNFIPPKQPKTFLQLVWEALQDVTLIILEVAAIVSLGLSFYAPPGEESEACGNVSGGAEDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEKQFRGLQSRIEQEQKFTVIRNGQLLQVPVAALVVGDIAQVKYGDLLPADGVLIQANDLKIDESSLTGESDHVRKSADKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGGEEEEKKDKKGKQQDGAMESSQTKAKKQDGAVAMEMQPLKSAE------------------GGEMEERE--------KKKANAPKKEKSVLQGKLTKLAVQIGKAGLVMSAITVIILVLYFVIETFVVEGRTWLAECTPVYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYLGDTHYK-EIPAPSALTPKILDLLVHAISINSAYTTKILPPEKEGALPRQVGNKTECALLGFVL-DLKRDFQPVREQIPEDKLYKVYTFNSVRKSMSTVIRMPDGGFRLFSKGASEILLKKCTNILNSNGELRGFRPRDRDDMVRKIIEPMACDGLRTICIAYRDFSAGQEPDW----------DNENEVVGDLTCIAVVGIEDPVRPEVPEAIRKCQRAGITVRMVTGDNINTARAIAAKCGIIQPGEDFLCLEGKEFNRRIRNE-KGEIEQERLDKVWPKLRVLARSSPTDKHTLVKGIIDSTTGEQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTESLLLRKPYGRDKPLISRTMMKNILGHAVYQLAIIFTLLFVGELFFDIDSGRNAPLH--SPPSEHYTIIFNTFVMMQLFNEINARKIHGERNVFDGIFSNPIFCTIVLGTFGIQIVIVQFGGKPFSCSPLSTEQWLWCLFVGVGELVWGQVIATIPTS-------------------QLKCLKEAGHG-PGKDEMTDEELAEGEEEIDHAERELRR-GQILWFRGLNRIQTQ 1114          
BLAST of Calcium-transporting ATPase vs. Ensembl Human
Match: ATP2B3 (ATPase plasma membrane Ca2+ transporting 3 [Source:HGNC Symbol;Acc:HGNC:816])

HSP 1 Score: 1214.52 bits (3141), Expect = 0.000e+0
Identity = 657/1144 (57.43%), Postives = 808/1144 (70.63%), Query Frame = 3
Query:  591 ELTDLMMLRQQEAILEIKEKYGDVYEICRRLKTSPQSGLIDDEESIGNRRREFGSNIIPPKPPKTFFRLMWEALQDLTLIVLMGAAVISLALALY------SKFSGSSHG---DETEGDAGWIEXXXXXXXXXXXXXXTAFNDWQKERQFRGLQDQIEGNHKIAVIRGGVAKEXXXXXXXXXXXCQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDIDPMMLSGTHVMEGSAKMLVTAVGLNSQAGIIFALLGAANTEEKDKAETEKPNNQVHKTNSNSKNKGCKNVDEEVELMKLTETHPEDADRCSNHKPNNYASGDANKSEIKNGKVKQEKKVRAPKKKGSVLQLKLNKLASSIGQIGTIVASLTVTILIIKFCINTYVFEKEGWSMD----HLKKMINFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYINGQHNRTHLPSFEELSFNAADMLLKNISINSSYTSRLMATRHVNELPSQIGNKTECALLGFVNGSLKRDYADLRTQWPEEKLIKVYTFNSERKSMSTIIE-DEGKLLLLTKGASEMILNKCSFILGKNGKIQPFTTEDVEALVKNVIEPMASDGLRTIGLAYKEFVKKPDHDYQGLYNEKLDLENEHTLIKDLTLIGIVGIEDPVRPEVPPAIKKCQKAGITVRMVTGDNINTARSIAIKCGILKPGEDFLVMEGKEFNNRVRDPISGKIKQELIDQVWPKLRVLARSSPQDKYTLVTGIIDSHLTRSREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFLGACFITDSPLKAVQMLWVNLIMDTLASLALATEMPTEELLDRAPYGRTKPIISRRMIKNIMGQSIYQLAVTFYLLLHGNVLLDVENGRGLTERGINKPTQHFTAIFNTFVMMTLFNEFNSRKIHGQKNVFDGLQRNVLFIIIWVTTFVGQIVIVQYGGYALHTEALELDHWLWCMLFGIGVLLWAQLINCIPTTVIPKHMPWSKKKLPTAENQALNQYKSVDSGNESEDEDYDDIGDLARQNNDEDDDDIKNSGQILWIRGLSRLQTQ 3980
            EL  LM LR  EA+ +I+E YGDV  +CRRLKTSP  GL D+   +  RR+ +G N IPPK PKTF +L+WEALQD+TLI+L  AA++SL L+ Y      S+  G+  G   DE E +AGWIEG AIL +VI VVLVTAFNDW KE+QFRGLQ +IE   K  VIR G   ++ V  +VVGDI QVKYGDLLPADG++IQ+ND+K+DESSLTGE DHV+K  D DPM+LSGTHVMEGS +M+VTAVG+NSQ GIIF LLGA   EE+ K +  K  +   +++     K    V  E++ +K  E                   G+  + E        +KK  APKK+ SVLQ KL KLA  IG+ G +++++TV IL++ F I T+V E   W  +    +++  + F IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSY+   H +  +P+   L+    D+L+  ISINS+YT++++       LP Q+GNKTECALLGFV   LKRD+  +R Q PE+KL KVYTFNS RKSMST+I   +G   L +KGASE++L KC+ IL  NG+++ F   D + +V+ +IEPMA DGLRTI +AY++F    + D+          +NE+ ++ DLT I +VGIEDPVRPEVP AI+KCQ+AGITVRMVTGDNINTAR+IA KCGI++PGEDFL +EGKEFN R+R+   G+I+QE +D+VWPKLRVLARSSP DK+TLV GIIDS     R+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSI+KFLQFQLTVNVVAVIVAF GAC   DSPLKAVQMLWVNLIMDT ASLALATE PTE LL R PYGR KP+ISR M+KNI+G ++YQLA+ F LL  G +  D+++GR       + P++H+T IFNTFVMM LFNE N+RKIHG++NVFDG+  N +F  I + TF  QIVIVQ+GG       L  + WLWC+  G+G L+W Q+I  IPT+                    L   K    G   +DE  D+      +  D  + +++  GQILW RGL+R+QTQ
Sbjct:   33 ELRTLMELRGAEALQKIEEAYGDVSGLCRRLKTSPTEGLADNTNDLEKRRQIYGQNFIPPKQPKTFLQLVWEALQDVTLIILEVAAIVSLGLSFYAPPGEESEACGNVSGGAEDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEKQFRGLQSRIEQEQKFTVIRNGQLLQVPVAALVVGDIAQVKYGDLLPADGVLIQANDLKIDESSLTGESDHVRKSADKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGGEEEEKKDKKGKQQDGAMESSQTKAKKQDGAVAMEMQPLKSAE------------------GGEMEERE--------KKKANAPKKEKSVLQGKLTKLAVQIGKAGLVMSAITVIILVLYFVIETFVVEGRTWLAECTPVYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYLGDTHYK-EIPAPSALTPKILDLLVHAISINSAYTTKILPPEKEGALPRQVGNKTECALLGFVL-DLKRDFQPVREQIPEDKLYKVYTFNSVRKSMSTVIRMPDGGFRLFSKGASEILLKKCTNILNSNGELRGFRPRDRDDMVRKIIEPMACDGLRTICIAYRDFSAGQEPDW----------DNENEVVGDLTCIAVVGIEDPVRPEVPEAIRKCQRAGITVRMVTGDNINTARAIAAKCGIIQPGEDFLCLEGKEFNRRIRNE-KGEIEQERLDKVWPKLRVLARSSPTDKHTLVKGIIDSTTGEQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTESLLLRKPYGRDKPLISRTMMKNILGHAVYQLAIIFTLLFVGELFFDIDSGRNAPLH--SPPSEHYTIIFNTFVMMQLFNEINARKIHGERNVFDGIFSNPIFCTIVLGTFGIQIVIVQFGGKPFSCSPLSTEQWLWCLFVGVGELVWGQVIATIPTS-------------------QLKCLKEAGHG-PGKDEMTDEELAEGEEEIDHAERELRR-GQILWFRGLNRIQTQ 1114          
BLAST of Calcium-transporting ATPase vs. Ensembl Human
Match: ATP2B3 (ATPase plasma membrane Ca2+ transporting 3 [Source:HGNC Symbol;Acc:HGNC:816])

HSP 1 Score: 1214.13 bits (3140), Expect = 0.000e+0
Identity = 667/1199 (55.63%), Postives = 823/1199 (68.64%), Query Frame = 3
Query:  591 ELTDLMMLRQQEAILEIKEKYGDVYEICRRLKTSPQSGLIDDEESIGNRRREFGSNIIPPKPPKTFFRLMWEALQDLTLIVLMGAAVISLALALY------SKFSGSSHG---DETEGDAGWIEXXXXXXXXXXXXXXTAFNDWQKERQFRGLQDQIEGNHKIAVIRGGVAKEXXXXXXXXXXXCQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDIDPMMLSGTHVMEGSAKMLVTAVGLNSQAGIIFALLGAANTEEKDKAETEKPNNQVHKTNSNSKNKGCKNVDEEVELMKLTETHPEDADRCSNHKPNNYASGDANKSEIKNGKVKQEKKVRAPKKKGSVLQLKLNKLASSIGQIGTIVASLTVTILIIKFCINTYVFEKEGWSMD----HLKKMINFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYINGQHNRTHLPSFEELSFNAADMLLKNISINSSYTSRLMATRHVNELPSQIGNKTECALLGFVNGSLKRDYADLRTQWPEEKLIKVYTFNSERKSMSTIIE-DEGKLLLLTKGASEMILNKCSFILGKNGKIQPFTTEDVEALVKNVIEPMASDGLRTIGLAYKEFVKKPDHDYQGLYNEKLDLENEHTLIKDLTLIGIVGIEDPVRPEVPPAIKKCQKAGITVRMVTGDNINTARSIAIKCGILKPGEDFLVMEGKEFNNRVRDPISGKIKQELIDQVWPKLRVLARSSPQDKYTLVTGIIDSHLTRSREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFLGACFITDSPLKAVQMLWVNLIMDTLASLALATEMPTEELLDRAPYGRTKPIISRRMIKNIMGQSIYQLAVTFYLLLHGNVLLDVENGRGLTERGINKPTQHFTAIFNTFVMMTLFNEFNSRKIHGQKNVFDGLQRNVLFIIIWVTTFVGQIVIVQYGGYALHTEALELDHWLWCMLFGIGVLLWAQLINCIPTTVIPKHMPWSKKKLPTAENQALNQYKSVDSGNESEDEDYDDIGDLARQNNDEDDDDIKNSGQILWIRGLSRLQTQQNTCNPNLDNRNDVVYGGVRRFT--LSQVGGV-------QPLLAARRQSSYSNNE 4118
            EL  LM LR  EA+ +I+E YGDV  +CRRLKTSP  GL D+   +  RR+ +G N IPPK PKTF +L+WEALQD+TLI+L  AA++SL L+ Y      S+  G+  G   DE E +AGWIEG AIL +VI VVLVTAFNDW KE+QFRGLQ +IE   K  VIR G   ++ V  +VVGDI QVKYGDLLPADG++IQ+ND+K+DESSLTGE DHV+K  D DPM+LSGTHVMEGS +M+VTAVG+NSQ GIIF LLGA   EE+ K +                                     +D       +P   A G   +        +++KK  APKK+ SVLQ KL KLA  IG+ G +++++TV IL++ F I T+V E   W  +    +++  + F IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSY+   H +  +P+   L+    D+L+  ISINS+YT++++       LP Q+GNKTECALLGFV   LKRD+  +R Q PE+KL KVYTFNS RKSMST+I   +G   L +KGASE++L KC+ IL  NG+++ F   D + +V+ +IEPMA DGLRTI +AY++F    + D+          +NE+ ++ DLT I +VGIEDPVRPEVP AI+KCQ+AGITVRMVTGDNINTAR+IA KCGI++PGEDFL +EGKEFN R+R+   G+I+QE +D+VWPKLRVLARSSP DK+TLV GIIDS     R+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSI+KFLQFQLTVNVVAVIVAF GAC   DSPLKAVQMLWVNLIMDT ASLALATE PTE LL R PYGR KP+ISR M+KNI+G ++YQLA+ F LL  G +  D+++GR       + P++H+T IFNTFVMM LFNE N+RKIHG++NVFDG+  N +F  I + TF  QIVIVQ+GG       L  + WLWC+  G+G L+W Q+I  IPT+                    L   K    G   +DE  D+      +  D  + +++  GQILW RGL+R+QTQ    +     R+  V G VRR +  LSQ+  V         +L+A   +S + +E
Sbjct:   33 ELRTLMELRGAEALQKIEEAYGDVSGLCRRLKTSPTEGLADNTNDLEKRRQIYGQNFIPPKQPKTFLQLVWEALQDVTLIILEVAAIVSLGLSFYAPPGEESEACGNVSGGAEDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEKQFRGLQSRIEQEQKFTVIRNGQLLQVPVAALVVGDIAQVKYGDLLPADGVLIQANDLKIDESSLTGESDHVRKSADKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGGEEEEKKDKK---------------------------------AKKQDGAVAMEMQPLKSAEGGEMEE-------REKKKANAPKKEKSVLQGKLTKLAVQIGKAGLVMSAITVIILVLYFVIETFVVEGRTWLAECTPVYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYLGDTHYK-EIPAPSALTPKILDLLVHAISINSAYTTKILPPEKEGALPRQVGNKTECALLGFVL-DLKRDFQPVREQIPEDKLYKVYTFNSVRKSMSTVIRMPDGGFRLFSKGASEILLKKCTNILNSNGELRGFRPRDRDDMVRKIIEPMACDGLRTICIAYRDFSAGQEPDW----------DNENEVVGDLTCIAVVGIEDPVRPEVPEAIRKCQRAGITVRMVTGDNINTARAIAAKCGIIQPGEDFLCLEGKEFNRRIRNE-KGEIEQERLDKVWPKLRVLARSSPTDKHTLVKGIIDSTTGEQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTESLLLRKPYGRDKPLISRTMMKNILGHAVYQLAIIFTLLFVGELFFDIDSGRNAPLH--SPPSEHYTIIFNTFVMMQLFNEINARKIHGERNVFDGIFSNPIFCTIVLGTFGIQIVIVQFGGKPFSCSPLSTEQWLWCLFVGVGELVWGQVIATIPTS-------------------QLKCLKEAGHG-PGKDEMTDEELAEGEEEIDHAERELRR-GQILWFRGLNRIQTQMEVVSTF--KRSGSVQGAVRRRSSVLSQLHDVTNLSTPTHAILSAANPTSAAGSE 1153          
BLAST of Calcium-transporting ATPase vs. Ensembl Human
Match: ATP2B3 (ATPase plasma membrane Ca2+ transporting 3 [Source:HGNC Symbol;Acc:HGNC:816])

HSP 1 Score: 1213.75 bits (3139), Expect = 0.000e+0
Identity = 667/1198 (55.68%), Postives = 822/1198 (68.61%), Query Frame = 3
Query:  591 ELTDLMMLRQQEAILEIKEKYGDVYEICRRLKTSPQSGLIDDEESIGNRRREFGSNIIPPKPPKTFFRLMWEALQDLTLIVLMGAAVISLALALY------SKFSGSSHG---DETEGDAGWIEXXXXXXXXXXXXXXTAFNDWQKERQFRGLQDQIEGNHKIAVIRGGVAKEXXXXXXXXXXXCQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDIDPMMLSGTHVMEGSAKMLVTAVGLNSQAGIIFALLGAANTEEKDKAETEKPNNQVHKTNSNSKNKGCKNVDEEVELMKLTETHPEDADRCSNHKPNNYASGDANKSEIKNGKVKQEKKVRAPKKKGSVLQLKLNKLASSIGQIGTIVASLTVTILIIKFCINTYVFEKEGWSMD----HLKKMINFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYINGQHNRTHLPSFEELSFNAADMLLKNISINSSYTSRLMATRHVNELPSQIGNKTECALLGFVNGSLKRDYADLRTQWPEEKLIKVYTFNSERKSMSTIIE-DEGKLLLLTKGASEMILNKCSFILGKNGKIQPFTTEDVEALVKNVIEPMASDGLRTIGLAYKEFVKKPDHDYQGLYNEKLDLENEHTLIKDLTLIGIVGIEDPVRPEVPPAIKKCQKAGITVRMVTGDNINTARSIAIKCGILKPGEDFLVMEGKEFNNRVRDPISGKIKQELIDQVWPKLRVLARSSPQDKYTLVTGIIDSHLTRSREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFLGACFITDSPLKAVQMLWVNLIMDTLASLALATEMPTEELLDRAPYGRTKPIISRRMIKNIMGQSIYQLAVTFYLLLHGNVLLDVENGRGLTERGINKPTQHFTAIFNTFVMMTLFNEFNSRKIHGQKNVFDGLQRNVLFIIIWVTTFVGQIVIVQYGGYALHTEALELDHWLWCMLFGIGVLLWAQLINCIPTTVIPKHMPWSKKKLPTAENQALNQYKSVDSGNESEDEDYDDIGDLARQNNDEDDDDIKNSGQILWIRGLSRLQTQQNTCNPNLDNRNDVVYGGVRRFT--LSQVGGV-------QPLLAARRQSSYSNN 4115
            EL  LM LR  EA+ +I+E YGDV  +CRRLKTSP  GL D+   +  RR+ +G N IPPK PKTF +L+WEALQD+TLI+L  AA++SL L+ Y      S+  G+  G   DE E +AGWIEG AIL +VI VVLVTAFNDW KE+QFRGLQ +IE   K  VIR G   ++ V  +VVGDI QVKYGDLLPADG++IQ+ND+K+DESSLTGE DHV+K  D DPM+LSGTHVMEGS +M+VTAVG+NSQ GIIF LLGA   EE+ K +                                     +D       +P   A G   +        +++KK  APKK+ SVLQ KL KLA  IG+ G +++++TV IL++ F I T+V E   W  +    +++  + F IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSY+   H +  +P+   L+    D+L+  ISINS+YT++++       LP Q+GNKTECALLGFV   LKRD+  +R Q PE+KL KVYTFNS RKSMST+I   +G   L +KGASE++L KC+ IL  NG+++ F   D + +V+ +IEPMA DGLRTI +AY++F    + D+          +NE+ ++ DLT I +VGIEDPVRPEVP AI+KCQ+AGITVRMVTGDNINTAR+IA KCGI++PGEDFL +EGKEFN R+R+   G+I+QE +D+VWPKLRVLARSSP DK+TLV GIIDS     R+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSI+KFLQFQLTVNVVAVIVAF GAC   DSPLKAVQMLWVNLIMDT ASLALATE PTE LL R PYGR KP+ISR M+KNI+G ++YQLA+ F LL  G +  D+++GR       + P++H+T IFNTFVMM LFNE N+RKIHG++NVFDG+  N +F  I + TF  QIVIVQ+GG       L  + WLWC+  G+G L+W Q+I  IPT+                    L   K    G   +DE  D+      +  D  + +++  GQILW RGL+R+QTQ    +     R+  V G VRR +  LSQ+  V         +L+A   +S + N
Sbjct:   33 ELRTLMELRGAEALQKIEEAYGDVSGLCRRLKTSPTEGLADNTNDLEKRRQIYGQNFIPPKQPKTFLQLVWEALQDVTLIILEVAAIVSLGLSFYAPPGEESEACGNVSGGAEDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEKQFRGLQSRIEQEQKFTVIRNGQLLQVPVAALVVGDIAQVKYGDLLPADGVLIQANDLKIDESSLTGESDHVRKSADKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGGEEEEKKDKK---------------------------------AKKQDGAVAMEMQPLKSAEGGEMEE-------REKKKANAPKKEKSVLQGKLTKLAVQIGKAGLVMSAITVIILVLYFVIETFVVEGRTWLAECTPVYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYLGDTHYK-EIPAPSALTPKILDLLVHAISINSAYTTKILPPEKEGALPRQVGNKTECALLGFVL-DLKRDFQPVREQIPEDKLYKVYTFNSVRKSMSTVIRMPDGGFRLFSKGASEILLKKCTNILNSNGELRGFRPRDRDDMVRKIIEPMACDGLRTICIAYRDFSAGQEPDW----------DNENEVVGDLTCIAVVGIEDPVRPEVPEAIRKCQRAGITVRMVTGDNINTARAIAAKCGIIQPGEDFLCLEGKEFNRRIRNE-KGEIEQERLDKVWPKLRVLARSSPTDKHTLVKGIIDSTTGEQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTESLLLRKPYGRDKPLISRTMMKNILGHAVYQLAIIFTLLFVGELFFDIDSGRNAPLH--SPPSEHYTIIFNTFVMMQLFNEINARKIHGERNVFDGIFSNPIFCTIVLGTFGIQIVIVQFGGKPFSCSPLSTEQWLWCLFVGVGELVWGQVIATIPTS-------------------QLKCLKEAGHG-PGKDEMTDEELAEGEEEIDHAERELRR-GQILWFRGLNRIQTQMEVVSTF--KRSGSVQGAVRRRSSVLSQLHDVTNLSTPTHAILSAANPTSAAGN 1152          
BLAST of Calcium-transporting ATPase vs. Ensembl Celegans
Match: mca-3 (Calcium-transporting ATPase [Source:UniProtKB/TrEMBL;Acc:B7CED8])

HSP 1 Score: 1217.6 bits (3149), Expect = 0.000e+0
Identity = 658/1140 (57.72%), Postives = 820/1140 (71.93%), Query Frame = 3
Query:  573 YEMNTKELTDLMMLRQQEAILEIKEKYGDVYEICRRLKTSPQSGLIDDEESIGNRRREFGSNIIPPKPPKTFFRLMWEALQDLTLIVLMGAAVISLALALYSKFSGSSHG-DETEGDAGWIEXXXXXXXXXXXXXXTAFNDWQKERQFRGLQDQIEGNHKIAVIRGGVAKEXXXXXXXXXXXCQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDIDPMMLSGTHVMEGSAKMLVTAVGLNSQAGIIFALLGAANTEEKDKAETEKPNNQVHKTNSNSKNKGCKNVDEEVELMKLTETHPEDADRCSNHKPNNYASGDANKSEIKNGKVKQEKKVRAPKKKGSVLQLKLNKLASSIGQIGTIVASLTVTILIIKFCINTYVFEKEGWSMDHLKKMINFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYINGQHNRTHLPSFEELSFNAADMLLKNISINSSYTSRLMATRHVNELPSQIGNKTECALLGFVNGSLKRDYADLRTQWPEEKLIKVYTFNSERKSMSTIIE-DEGKLLLLTKGASEMILNKCSFILGKNGKIQPFTTEDVEALVKNVIEPMASDGLRTIGLAYKEFV--KKPDHDYQGLYNEKLDLENEHTLIKDLTLIGIVGIEDPVRPEVPPAIKKCQKAGITVRMVTGDNINTARSIAIKCGILKPGEDFLVMEGKEFNNRVRDPISGKIKQELIDQVWPKLRVLARSSPQDKYTLVTGIIDSHLTRSREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFLGACFITDSPLKAVQMLWVNLIMDTLASLALATEMPTEELLDRAPYGRTKPIISRRMIKNIMGQSIYQLAVTFYLLLHGNVLLDVENGRGLTERGINKPTQHFTAIFNTFVMMTLFNEFNSRKIHGQKNVFDGLQRNVLFIIIWVTTFVGQIVIVQYGGYALHTEALELDHWLWCMLFGIGVLLWAQLINCIPTTVIPKHMPWSKKKLPTAENQALNQYKSVDSGNESEDEDYDDIGDLARQNNDEDDDDIKNSGQILWIRGLSRLQTQ 3980
            Y  + +EL  LM  R  EA  +I+  YG    +C RLKT P +GL ++EE +  RR  FG+N IPP PPK F +L+WEALQD+TL++L+ +A++SLAL+ Y      + G D++E DAGWIEGVAIL +VIVVVLVTA ND+ KERQFRGLQ +IE  H+  V+RGG + +++V ++VVGDI Q+KYGDL+P+DGIIIQSND+K+DESSLTGE D ++K  + DP++LSGTHVMEGS KMLVTAVG+NSQ GII  LLGAA T     AE E+      KT       G     EE     L ++  ++A           A+G A  +   +GK           K+ SVLQ KL +LA  IG  G+ VA  TV ILII+FCI+ Y  + + +S+   +  INFLIIGVTVLVVAVPEGLPLAVT+SLAYSVKKMM DNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQS++N  H +   P  E L  N A +++  ISINSSY+S+++  + + E  +Q+GNKTEC +LGFV  +L + Y ++R + PEE + KVYTFNS RKSMST+I   +G   + +KGASE++  +C + LGKNG +  F+++D E LV++VIEPMASDGLRTI +AYK++V   K   D Q  Y+ + D ENE  ++ D+T I ++GI+DPVRPEVP AI +CQ+AGITVRMVTGDNINTARSIA  CGILKPGEDF+ +EGKEFN R+RD  +G++ QE +D +WPKLRVLAR+ P DKY LV GIIDS +T SREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAV+VAF+GAC I D+PLKAVQMLWVNLIMDTLASLALATEMPTEELL R PYGRT P+ISR M KNI+G ++YQL + F L+ +G V  ++ +GR       + P++HFT +FNTFVMMTLFNE N+RKIHG++N+F GL  N ++ +IW+ T + Q+VI+Q+GG    T AL    WLWC+ FG+G LLW Q++  IPT  +P +M     + PT               N+    DY+D            D   K SGQILW+RGL+RLQTQ
Sbjct:    4 YGASLEELRALMEYRSAEAKEKIETDYGGTTGLCERLKTDPNNGLPNNEEELERRRNVFGANEIPPHPPKCFLQLVWEALQDVTLVILLVSAIVSLALSFYRPPGEDTAGSDDSEHDAGWIEGVAILISVIVVVLVTALNDYTKERQFRGLQAKIETEHRFFVLRGGQSVQVVVNELVVGDIAQIKYGDLIPSDGIIIQSNDLKMDESSLTGESDQIRKSPEHDPIILSGTHVMEGSGKMLVTAVGVNSQTGIIMTLLGAAKT----VAEEER------KTAKREGGDGASGA-EEGTAQALLDSKGDEA----------MANGKAVAAAESDGK-----------KERSVLQAKLTRLAIQIGYAGSFVAGCTVLILIIRFCISRYAIDGKSFSLADFQHFINFLIIGVTVLVVAVPEGLPLAVTLSLAYSVKKMMLDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSFVNDVHYK-DTPKIESLDQNTAKLMMDCISINSSYSSQVIPPKQLGEQATQLGNKTECGMLGFVL-ALGKSYQEIRDRHPEETIPKVYTFNSVRKSMSTVINLPDGGYRVFSKGASEIVTKRCKYFLGKNGTLTKFSSKDAENLVRDVIEPMASDGLRTICVAYKDYVPSSKKTADNQIAYSSEPDWENEEMIVGDMTAIAVLGIQDPVRPEVPAAITRCQEAGITVRMVTGDNINTARSIATACGILKPGEDFIALEGKEFNARIRDE-NGEVSQEKLDLIWPKLRVLARAQPSDKYVLVKGIIDSRVTDSREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVVVAFVGACAIQDTPLKAVQMLWVNLIMDTLASLALATEMPTEELLKRKPYGRTSPLISRTMCKNILGHAVYQLVILFTLIFYGEVCFNIPSGRWAPLH--SPPSKHFTIVFNTFVMMTLFNEINARKIHGERNIFKGLFSNPIYYVIWIATMISQVVIIQFGGRWFSTSALNTTEWLWCLAFGVGTLLWGQIVTSIPTGSLPANMTIGSGEAPT---------------NDPLMPDYED-----------SDTHEKRSGQILWVRGLTRLQTQ 1080          
BLAST of Calcium-transporting ATPase vs. Ensembl Celegans
Match: mca-3 (Calcium-transporting ATPase [Source:UniProtKB/TrEMBL;Acc:B7CED8])

HSP 1 Score: 1217.6 bits (3149), Expect = 0.000e+0
Identity = 658/1140 (57.72%), Postives = 820/1140 (71.93%), Query Frame = 3
Query:  573 YEMNTKELTDLMMLRQQEAILEIKEKYGDVYEICRRLKTSPQSGLIDDEESIGNRRREFGSNIIPPKPPKTFFRLMWEALQDLTLIVLMGAAVISLALALYSKFSGSSHG-DETEGDAGWIEXXXXXXXXXXXXXXTAFNDWQKERQFRGLQDQIEGNHKIAVIRGGVAKEXXXXXXXXXXXCQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDIDPMMLSGTHVMEGSAKMLVTAVGLNSQAGIIFALLGAANTEEKDKAETEKPNNQVHKTNSNSKNKGCKNVDEEVELMKLTETHPEDADRCSNHKPNNYASGDANKSEIKNGKVKQEKKVRAPKKKGSVLQLKLNKLASSIGQIGTIVASLTVTILIIKFCINTYVFEKEGWSMDHLKKMINFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYINGQHNRTHLPSFEELSFNAADMLLKNISINSSYTSRLMATRHVNELPSQIGNKTECALLGFVNGSLKRDYADLRTQWPEEKLIKVYTFNSERKSMSTIIE-DEGKLLLLTKGASEMILNKCSFILGKNGKIQPFTTEDVEALVKNVIEPMASDGLRTIGLAYKEFV--KKPDHDYQGLYNEKLDLENEHTLIKDLTLIGIVGIEDPVRPEVPPAIKKCQKAGITVRMVTGDNINTARSIAIKCGILKPGEDFLVMEGKEFNNRVRDPISGKIKQELIDQVWPKLRVLARSSPQDKYTLVTGIIDSHLTRSREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFLGACFITDSPLKAVQMLWVNLIMDTLASLALATEMPTEELLDRAPYGRTKPIISRRMIKNIMGQSIYQLAVTFYLLLHGNVLLDVENGRGLTERGINKPTQHFTAIFNTFVMMTLFNEFNSRKIHGQKNVFDGLQRNVLFIIIWVTTFVGQIVIVQYGGYALHTEALELDHWLWCMLFGIGVLLWAQLINCIPTTVIPKHMPWSKKKLPTAENQALNQYKSVDSGNESEDEDYDDIGDLARQNNDEDDDDIKNSGQILWIRGLSRLQTQ 3980
            Y  + +EL  LM  R  EA  +I+  YG    +C RLKT P +GL ++EE +  RR  FG+N IPP PPK F +L+WEALQD+TL++L+ +A++SLAL+ Y      + G D++E DAGWIEGVAIL +VIVVVLVTA ND+ KERQFRGLQ +IE  H+  V+RGG + +++V ++VVGDI Q+KYGDL+P+DGIIIQSND+K+DESSLTGE D ++K  + DP++LSGTHVMEGS KMLVTAVG+NSQ GII  LLGAA T     AE E+      KT       G     EE     L ++  ++A           A+G A  +   +GK           K+ SVLQ KL +LA  IG  G+ VA  TV ILII+FCI+ Y  + + +S+   +  INFLIIGVTVLVVAVPEGLPLAVT+SLAYSVKKMM DNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQS++N  H +   P  E L  N A +++  ISINSSY+S+++  + + E  +Q+GNKTEC +LGFV  +L + Y ++R + PEE + KVYTFNS RKSMST+I   +G   + +KGASE++  +C + LGKNG +  F+++D E LV++VIEPMASDGLRTI +AYK++V   K   D Q  Y+ + D ENE  ++ D+T I ++GI+DPVRPEVP AI +CQ+AGITVRMVTGDNINTARSIA  CGILKPGEDF+ +EGKEFN R+RD  +G++ QE +D +WPKLRVLAR+ P DKY LV GIIDS +T SREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAV+VAF+GAC I D+PLKAVQMLWVNLIMDTLASLALATEMPTEELL R PYGRT P+ISR M KNI+G ++YQL + F L+ +G V  ++ +GR       + P++HFT +FNTFVMMTLFNE N+RKIHG++N+F GL  N ++ +IW+ T + Q+VI+Q+GG    T AL    WLWC+ FG+G LLW Q++  IPT  +P +M     + PT               N+    DY+D            D   K SGQILW+RGL+RLQTQ
Sbjct:    4 YGASLEELRALMEYRSAEAKEKIETDYGGTTGLCERLKTDPNNGLPNNEEELERRRNVFGANEIPPHPPKCFLQLVWEALQDVTLVILLVSAIVSLALSFYRPPGEDTAGSDDSEHDAGWIEGVAILISVIVVVLVTALNDYTKERQFRGLQAKIETEHRFFVLRGGQSVQVVVNELVVGDIAQIKYGDLIPSDGIIIQSNDLKMDESSLTGESDQIRKSPEHDPIILSGTHVMEGSGKMLVTAVGVNSQTGIIMTLLGAAKT----VAEEER------KTAKREGGDGASGA-EEGTAQALLDSKGDEA----------MANGKAVAAAESDGK-----------KERSVLQAKLTRLAIQIGYAGSFVAGCTVLILIIRFCISRYAIDGKSFSLADFQHFINFLIIGVTVLVVAVPEGLPLAVTLSLAYSVKKMMLDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSFVNDVHYK-DTPKIESLDQNTAKLMMDCISINSSYSSQVIPPKQLGEQATQLGNKTECGMLGFVL-ALGKSYQEIRDRHPEETIPKVYTFNSVRKSMSTVINLPDGGYRVFSKGASEIVTKRCKYFLGKNGTLTKFSSKDAENLVRDVIEPMASDGLRTICVAYKDYVPSSKKTADNQIAYSSEPDWENEEMIVGDMTAIAVLGIQDPVRPEVPAAITRCQEAGITVRMVTGDNINTARSIATACGILKPGEDFIALEGKEFNARIRDE-NGEVSQEKLDLIWPKLRVLARAQPSDKYVLVKGIIDSRVTDSREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVVVAFVGACAIQDTPLKAVQMLWVNLIMDTLASLALATEMPTEELLKRKPYGRTSPLISRTMCKNILGHAVYQLVILFTLIFYGEVCFNIPSGRWAPLH--SPPSKHFTIVFNTFVMMTLFNEINARKIHGERNIFKGLFSNPIYYVIWIATMISQVVIIQFGGRWFSTSALNTTEWLWCLAFGVGTLLWGQIVTSIPTGSLPANMTIGSGEAPT---------------NDPLMPDYED-----------SDTHEKRSGQILWVRGLTRLQTQ 1080          
BLAST of Calcium-transporting ATPase vs. Ensembl Celegans
Match: mca-3 (Calcium-transporting ATPase [Source:UniProtKB/TrEMBL;Acc:B7CED8])

HSP 1 Score: 1217.6 bits (3149), Expect = 0.000e+0
Identity = 658/1140 (57.72%), Postives = 820/1140 (71.93%), Query Frame = 3
Query:  573 YEMNTKELTDLMMLRQQEAILEIKEKYGDVYEICRRLKTSPQSGLIDDEESIGNRRREFGSNIIPPKPPKTFFRLMWEALQDLTLIVLMGAAVISLALALYSKFSGSSHG-DETEGDAGWIEXXXXXXXXXXXXXXTAFNDWQKERQFRGLQDQIEGNHKIAVIRGGVAKEXXXXXXXXXXXCQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDIDPMMLSGTHVMEGSAKMLVTAVGLNSQAGIIFALLGAANTEEKDKAETEKPNNQVHKTNSNSKNKGCKNVDEEVELMKLTETHPEDADRCSNHKPNNYASGDANKSEIKNGKVKQEKKVRAPKKKGSVLQLKLNKLASSIGQIGTIVASLTVTILIIKFCINTYVFEKEGWSMDHLKKMINFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYINGQHNRTHLPSFEELSFNAADMLLKNISINSSYTSRLMATRHVNELPSQIGNKTECALLGFVNGSLKRDYADLRTQWPEEKLIKVYTFNSERKSMSTIIE-DEGKLLLLTKGASEMILNKCSFILGKNGKIQPFTTEDVEALVKNVIEPMASDGLRTIGLAYKEFV--KKPDHDYQGLYNEKLDLENEHTLIKDLTLIGIVGIEDPVRPEVPPAIKKCQKAGITVRMVTGDNINTARSIAIKCGILKPGEDFLVMEGKEFNNRVRDPISGKIKQELIDQVWPKLRVLARSSPQDKYTLVTGIIDSHLTRSREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFLGACFITDSPLKAVQMLWVNLIMDTLASLALATEMPTEELLDRAPYGRTKPIISRRMIKNIMGQSIYQLAVTFYLLLHGNVLLDVENGRGLTERGINKPTQHFTAIFNTFVMMTLFNEFNSRKIHGQKNVFDGLQRNVLFIIIWVTTFVGQIVIVQYGGYALHTEALELDHWLWCMLFGIGVLLWAQLINCIPTTVIPKHMPWSKKKLPTAENQALNQYKSVDSGNESEDEDYDDIGDLARQNNDEDDDDIKNSGQILWIRGLSRLQTQ 3980
            Y  + +EL  LM  R  EA  +I+  YG    +C RLKT P +GL ++EE +  RR  FG+N IPP PPK F +L+WEALQD+TL++L+ +A++SLAL+ Y      + G D++E DAGWIEGVAIL +VIVVVLVTA ND+ KERQFRGLQ +IE  H+  V+RGG + +++V ++VVGDI Q+KYGDL+P+DGIIIQSND+K+DESSLTGE D ++K  + DP++LSGTHVMEGS KMLVTAVG+NSQ GII  LLGAA T     AE E+      KT       G     EE     L ++  ++A           A+G A  +   +GK           K+ SVLQ KL +LA  IG  G+ VA  TV ILII+FCI+ Y  + + +S+   +  INFLIIGVTVLVVAVPEGLPLAVT+SLAYSVKKMM DNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQS++N  H +   P  E L  N A +++  ISINSSY+S+++  + + E  +Q+GNKTEC +LGFV  +L + Y ++R + PEE + KVYTFNS RKSMST+I   +G   + +KGASE++  +C + LGKNG +  F+++D E LV++VIEPMASDGLRTI +AYK++V   K   D Q  Y+ + D ENE  ++ D+T I ++GI+DPVRPEVP AI +CQ+AGITVRMVTGDNINTARSIA  CGILKPGEDF+ +EGKEFN R+RD  +G++ QE +D +WPKLRVLAR+ P DKY LV GIIDS +T SREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAV+VAF+GAC I D+PLKAVQMLWVNLIMDTLASLALATEMPTEELL R PYGRT P+ISR M KNI+G ++YQL + F L+ +G V  ++ +GR       + P++HFT +FNTFVMMTLFNE N+RKIHG++N+F GL  N ++ +IW+ T + Q+VI+Q+GG    T AL    WLWC+ FG+G LLW Q++  IPT  +P +M     + PT               N+    DY+D            D   K SGQILW+RGL+RLQTQ
Sbjct:    4 YGASLEELRALMEYRSAEAKEKIETDYGGTTGLCERLKTDPNNGLPNNEEELERRRNVFGANEIPPHPPKCFLQLVWEALQDVTLVILLVSAIVSLALSFYRPPGEDTAGSDDSEHDAGWIEGVAILISVIVVVLVTALNDYTKERQFRGLQAKIETEHRFFVLRGGQSVQVVVNELVVGDIAQIKYGDLIPSDGIIIQSNDLKMDESSLTGESDQIRKSPEHDPIILSGTHVMEGSGKMLVTAVGVNSQTGIIMTLLGAAKT----VAEEER------KTAKREGGDGASGA-EEGTAQALLDSKGDEA----------MANGKAVAAAESDGK-----------KERSVLQAKLTRLAIQIGYAGSFVAGCTVLILIIRFCISRYAIDGKSFSLADFQHFINFLIIGVTVLVVAVPEGLPLAVTLSLAYSVKKMMLDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSFVNDVHYK-DTPKIESLDQNTAKLMMDCISINSSYSSQVIPPKQLGEQATQLGNKTECGMLGFVL-ALGKSYQEIRDRHPEETIPKVYTFNSVRKSMSTVINLPDGGYRVFSKGASEIVTKRCKYFLGKNGTLTKFSSKDAENLVRDVIEPMASDGLRTICVAYKDYVPSSKKTADNQIAYSSEPDWENEEMIVGDMTAIAVLGIQDPVRPEVPAAITRCQEAGITVRMVTGDNINTARSIATACGILKPGEDFIALEGKEFNARIRDE-NGEVSQEKLDLIWPKLRVLARAQPSDKYVLVKGIIDSRVTDSREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVVVAFVGACAIQDTPLKAVQMLWVNLIMDTLASLALATEMPTEELLKRKPYGRTSPLISRTMCKNILGHAVYQLVILFTLIFYGEVCFNIPSGRWAPLH--SPPSKHFTIVFNTFVMMTLFNEINARKIHGERNIFKGLFSNPIYYVIWIATMISQVVIIQFGGRWFSTSALNTTEWLWCLAFGVGTLLWGQIVTSIPTGSLPANMTIGSGEAPT---------------NDPLMPDYED-----------SDTHEKRSGQILWVRGLTRLQTQ 1080          
BLAST of Calcium-transporting ATPase vs. Ensembl Celegans
Match: mca-3 (Calcium-transporting ATPase [Source:UniProtKB/TrEMBL;Acc:B7CED8])

HSP 1 Score: 1217.6 bits (3149), Expect = 0.000e+0
Identity = 658/1140 (57.72%), Postives = 820/1140 (71.93%), Query Frame = 3
Query:  573 YEMNTKELTDLMMLRQQEAILEIKEKYGDVYEICRRLKTSPQSGLIDDEESIGNRRREFGSNIIPPKPPKTFFRLMWEALQDLTLIVLMGAAVISLALALYSKFSGSSHG-DETEGDAGWIEXXXXXXXXXXXXXXTAFNDWQKERQFRGLQDQIEGNHKIAVIRGGVAKEXXXXXXXXXXXCQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDIDPMMLSGTHVMEGSAKMLVTAVGLNSQAGIIFALLGAANTEEKDKAETEKPNNQVHKTNSNSKNKGCKNVDEEVELMKLTETHPEDADRCSNHKPNNYASGDANKSEIKNGKVKQEKKVRAPKKKGSVLQLKLNKLASSIGQIGTIVASLTVTILIIKFCINTYVFEKEGWSMDHLKKMINFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYINGQHNRTHLPSFEELSFNAADMLLKNISINSSYTSRLMATRHVNELPSQIGNKTECALLGFVNGSLKRDYADLRTQWPEEKLIKVYTFNSERKSMSTIIE-DEGKLLLLTKGASEMILNKCSFILGKNGKIQPFTTEDVEALVKNVIEPMASDGLRTIGLAYKEFV--KKPDHDYQGLYNEKLDLENEHTLIKDLTLIGIVGIEDPVRPEVPPAIKKCQKAGITVRMVTGDNINTARSIAIKCGILKPGEDFLVMEGKEFNNRVRDPISGKIKQELIDQVWPKLRVLARSSPQDKYTLVTGIIDSHLTRSREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFLGACFITDSPLKAVQMLWVNLIMDTLASLALATEMPTEELLDRAPYGRTKPIISRRMIKNIMGQSIYQLAVTFYLLLHGNVLLDVENGRGLTERGINKPTQHFTAIFNTFVMMTLFNEFNSRKIHGQKNVFDGLQRNVLFIIIWVTTFVGQIVIVQYGGYALHTEALELDHWLWCMLFGIGVLLWAQLINCIPTTVIPKHMPWSKKKLPTAENQALNQYKSVDSGNESEDEDYDDIGDLARQNNDEDDDDIKNSGQILWIRGLSRLQTQ 3980
            Y  + +EL  LM  R  EA  +I+  YG    +C RLKT P +GL ++EE +  RR  FG+N IPP PPK F +L+WEALQD+TL++L+ +A++SLAL+ Y      + G D++E DAGWIEGVAIL +VIVVVLVTA ND+ KERQFRGLQ +IE  H+  V+RGG + +++V ++VVGDI Q+KYGDL+P+DGIIIQSND+K+DESSLTGE D ++K  + DP++LSGTHVMEGS KMLVTAVG+NSQ GII  LLGAA T     AE E+      KT       G     EE     L ++  ++A           A+G A  +   +GK           K+ SVLQ KL +LA  IG  G+ VA  TV ILII+FCI+ Y  + + +S+   +  INFLIIGVTVLVVAVPEGLPLAVT+SLAYSVKKMM DNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQS++N  H +   P  E L  N A +++  ISINSSY+S+++  + + E  +Q+GNKTEC +LGFV  +L + Y ++R + PEE + KVYTFNS RKSMST+I   +G   + +KGASE++  +C + LGKNG +  F+++D E LV++VIEPMASDGLRTI +AYK++V   K   D Q  Y+ + D ENE  ++ D+T I ++GI+DPVRPEVP AI +CQ+AGITVRMVTGDNINTARSIA  CGILKPGEDF+ +EGKEFN R+RD  +G++ QE +D +WPKLRVLAR+ P DKY LV GIIDS +T SREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAV+VAF+GAC I D+PLKAVQMLWVNLIMDTLASLALATEMPTEELL R PYGRT P+ISR M KNI+G ++YQL + F L+ +G V  ++ +GR       + P++HFT +FNTFVMMTLFNE N+RKIHG++N+F GL  N ++ +IW+ T + Q+VI+Q+GG    T AL    WLWC+ FG+G LLW Q++  IPT  +P +M     + PT               N+    DY+D            D   K SGQILW+RGL+RLQTQ
Sbjct:    4 YGASLEELRALMEYRSAEAKEKIETDYGGTTGLCERLKTDPNNGLPNNEEELERRRNVFGANEIPPHPPKCFLQLVWEALQDVTLVILLVSAIVSLALSFYRPPGEDTAGSDDSEHDAGWIEGVAILISVIVVVLVTALNDYTKERQFRGLQAKIETEHRFFVLRGGQSVQVVVNELVVGDIAQIKYGDLIPSDGIIIQSNDLKMDESSLTGESDQIRKSPEHDPIILSGTHVMEGSGKMLVTAVGVNSQTGIIMTLLGAAKT----VAEEER------KTAKREGGDGASGA-EEGTAQALLDSKGDEA----------MANGKAVAAAESDGK-----------KERSVLQAKLTRLAIQIGYAGSFVAGCTVLILIIRFCISRYAIDGKSFSLADFQHFINFLIIGVTVLVVAVPEGLPLAVTLSLAYSVKKMMLDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSFVNDVHYK-DTPKIESLDQNTAKLMMDCISINSSYSSQVIPPKQLGEQATQLGNKTECGMLGFVL-ALGKSYQEIRDRHPEETIPKVYTFNSVRKSMSTVINLPDGGYRVFSKGASEIVTKRCKYFLGKNGTLTKFSSKDAENLVRDVIEPMASDGLRTICVAYKDYVPSSKKTADNQIAYSSEPDWENEEMIVGDMTAIAVLGIQDPVRPEVPAAITRCQEAGITVRMVTGDNINTARSIATACGILKPGEDFIALEGKEFNARIRDE-NGEVSQEKLDLIWPKLRVLARAQPSDKYVLVKGIIDSRVTDSREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVVVAFVGACAIQDTPLKAVQMLWVNLIMDTLASLALATEMPTEELLKRKPYGRTSPLISRTMCKNILGHAVYQLVILFTLIFYGEVCFNIPSGRWAPLH--SPPSKHFTIVFNTFVMMTLFNEINARKIHGERNIFKGLFSNPIYYVIWIATMISQVVIIQFGGRWFSTSALNTTEWLWCLAFGVGTLLWGQIVTSIPTGSLPANMTIGSGEAPT---------------NDPLMPDYED-----------SDTHEKRSGQILWVRGLTRLQTQ 1080          
BLAST of Calcium-transporting ATPase vs. Ensembl Celegans
Match: mca-3 (Calcium-transporting ATPase [Source:UniProtKB/TrEMBL;Acc:B7CED8])

HSP 1 Score: 1216.83 bits (3147), Expect = 0.000e+0
Identity = 658/1140 (57.72%), Postives = 820/1140 (71.93%), Query Frame = 3
Query:  573 YEMNTKELTDLMMLRQQEAILEIKEKYGDVYEICRRLKTSPQSGLIDDEESIGNRRREFGSNIIPPKPPKTFFRLMWEALQDLTLIVLMGAAVISLALALYSKFSGSSHG-DETEGDAGWIEXXXXXXXXXXXXXXTAFNDWQKERQFRGLQDQIEGNHKIAVIRGGVAKEXXXXXXXXXXXCQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDIDPMMLSGTHVMEGSAKMLVTAVGLNSQAGIIFALLGAANTEEKDKAETEKPNNQVHKTNSNSKNKGCKNVDEEVELMKLTETHPEDADRCSNHKPNNYASGDANKSEIKNGKVKQEKKVRAPKKKGSVLQLKLNKLASSIGQIGTIVASLTVTILIIKFCINTYVFEKEGWSMDHLKKMINFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYINGQHNRTHLPSFEELSFNAADMLLKNISINSSYTSRLMATRHVNELPSQIGNKTECALLGFVNGSLKRDYADLRTQWPEEKLIKVYTFNSERKSMSTIIE-DEGKLLLLTKGASEMILNKCSFILGKNGKIQPFTTEDVEALVKNVIEPMASDGLRTIGLAYKEFV--KKPDHDYQGLYNEKLDLENEHTLIKDLTLIGIVGIEDPVRPEVPPAIKKCQKAGITVRMVTGDNINTARSIAIKCGILKPGEDFLVMEGKEFNNRVRDPISGKIKQELIDQVWPKLRVLARSSPQDKYTLVTGIIDSHLTRSREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFLGACFITDSPLKAVQMLWVNLIMDTLASLALATEMPTEELLDRAPYGRTKPIISRRMIKNIMGQSIYQLAVTFYLLLHGNVLLDVENGRGLTERGINKPTQHFTAIFNTFVMMTLFNEFNSRKIHGQKNVFDGLQRNVLFIIIWVTTFVGQIVIVQYGGYALHTEALELDHWLWCMLFGIGVLLWAQLINCIPTTVIPKHMPWSKKKLPTAENQALNQYKSVDSGNESEDEDYDDIGDLARQNNDEDDDDIKNSGQILWIRGLSRLQTQ 3980
            Y  + +EL  LM  R  EA  +I+  YG    +C RLKT P +GL ++EE +  RR  FG+N IPP PPK F +L+WEALQD+TL++L+ +A++SLAL+ Y      + G D++E DAGWIEGVAIL +VIVVVLVTA ND+ KERQFRGLQ +IE  H+  V+RGG + +++V ++VVGDI Q+KYGDL+P+DGIIIQSND+K+DESSLTGE D ++K  + DP++LSGTHVMEGS KMLVTAVG+NSQ GII  LLGAA T     AE E+      KT       G     EE     L ++  ++A           A+G A  +   +GK           K+ SVLQ KL +LA  IG  G+ VA  TV ILII+FCI+ Y  + + +S+   +  INFLIIGVTVLVVAVPEGLPLAVT+SLAYSVKKMM DNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQS++N  H +   P  E L  N A +++  ISINSSY+S+++  + + E  +Q+GNKTEC +LGFV  +L + Y ++R + PEE + KVYTFNS RKSMST+I   +G   + +KGASE++  +C + LGKNG +  F+++D E LV++VIEPMASDGLRTI +AYK++V   K   D Q  Y+ + D ENE  ++ D+T I ++GI+DPVRPEVP AI +CQ+AGITVRMVTGDNINTARSIA  CGILKPGEDF+ +EGKEFN R+RD  +G++ QE +D +WPKLRVLAR+ P DKY LV GIIDS +T SREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAV+VAF+GAC I D+PLKAVQMLWVNLIMDTLASLALATEMPTEELL R PYGRT P+ISR M KNI+G ++YQL + F L+ +G V  ++ +GR       + P++HFT +FNTFVMMTLFNE N+RKIHG++N+F GL  N ++ +IW+ T + Q+VI+Q+GG    T AL    WLWC+ FG+G LLW Q++  IPT  +P +M     + PT               N+    DY+D            D   K SGQILW+RGL+RLQTQ
Sbjct:    4 YGASLEELRALMEYRSAEAKEKIETDYGGTTGLCERLKTDPNNGLPNNEEELERRRNVFGANEIPPHPPKCFLQLVWEALQDVTLVILLVSAIVSLALSFYRPPGEDTAGSDDSEHDAGWIEGVAILISVIVVVLVTALNDYTKERQFRGLQAKIETEHRFFVLRGGQSVQVVVNELVVGDIAQIKYGDLIPSDGIIIQSNDLKMDESSLTGESDQIRKSPEHDPIILSGTHVMEGSGKMLVTAVGVNSQTGIIMTLLGAAKT----VAEEER------KTAKREGGDGASGA-EEGTAQALLDSKGDEA----------MANGKAVAAAESDGK-----------KERSVLQAKLTRLAIQIGYAGSFVAGCTVLILIIRFCISRYAIDGKSFSLADFQHFINFLIIGVTVLVVAVPEGLPLAVTLSLAYSVKKMMLDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSFVNDVHYK-DTPKIESLDQNTAKLMMDCISINSSYSSQVIPPKQLGEQATQLGNKTECGMLGFVL-ALGKSYQEIRDRHPEETIPKVYTFNSVRKSMSTVINLPDGGYRVFSKGASEIVTKRCKYFLGKNGTLTKFSSKDAENLVRDVIEPMASDGLRTICVAYKDYVPSSKKTADNQIAYSSEPDWENEEMIVGDMTAIAVLGIQDPVRPEVPAAITRCQEAGITVRMVTGDNINTARSIATACGILKPGEDFIALEGKEFNARIRDE-NGEVSQEKLDLIWPKLRVLARAQPSDKYVLVKGIIDSRVTDSREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVVVAFVGACAIQDTPLKAVQMLWVNLIMDTLASLALATEMPTEELLKRKPYGRTSPLISRTMCKNILGHAVYQLVILFTLIFYGEVCFNIPSGRWAPLH--SPPSKHFTIVFNTFVMMTLFNEINARKIHGERNIFKGLFSNPIYYVIWIATMISQVVIIQFGGRWFSTSALNTTEWLWCLAFGVGTLLWGQIVTSIPTGSLPANMTIGSGEAPT---------------NDPLMPDYED-----------SDTHEKRSGQILWVRGLTRLQTQ 1080          
BLAST of Calcium-transporting ATPase vs. Ensembl Fly
Match: PMCA (gene:FBgn0259214 transcript:FBtr0300556)

HSP 1 Score: 1284.63 bits (3323), Expect = 0.000e+0
Identity = 703/1217 (57.76%), Postives = 868/1217 (71.32%), Query Frame = 3
Query:  573 YEMNTKELTDLMMLRQQEAILEIKEKYGDVYEICRRLKTSPQSGLIDDEESIGNRRREFGSNIIPPKPPKTFFRLMWEALQDLTLIVLMGAAVISLALALYSKFSGSSHG-DETEGDAGWIEXXXXXXXXXXXXXXTAFNDWQKERQFRGLQDQIEGNHKIAVIRGGVAKEXXXXXXXXXXXCQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDIDPMMLSGTHVMEGSAKMLVTAVGLNSQAGIIFALLGAANTEE-----KDKAETEKPNNQVHKTNSN---SKNKGCKNVDE-EVELMKLTETHPEDADRCSNHKPNNYASGDANKSEIKNGKVKQEKKVRAPKKKGSVLQLKLNKLASSIGQIGTIVASLTVTILIIKFCINTYVFEKEGWSMDHLKKMINFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYINGQHNRTHLPSFEELSFNAADMLLKNISINSSYTSRLMATRHVNELPSQIGNKTECALLGFVNGSLKRDYADLRTQWPEEKLIKVYTFNSERKSMSTII-EDEGKLLLLTKGASEMILNKCSFILGKNGKIQPFTTEDVEALVKNVIEPMASDGLRTIGLAYKEFVKKPDHDYQGLYNEKLDLENEHTLIKDLTLIGIVGIEDPVRPEVPPAIKKCQKAGITVRMVTGDNINTARSIAIKCGILKPGEDFLVMEGKEFNNRVRDPISGKIKQELIDQVWPKLRVLARSSPQDKYTLVTGIIDSHLTRSREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFLGACFITDSPLKAVQMLWVNLIMDTLASLALATEMPTEELLDRAPYGRTKPIISRRMIKNIMGQSIYQLAVTFYLLLHGNVLLDVENGRGLTERGINK-PTQHFTAIFNTFVMMTLFNEFNSRKIHGQKNVFDGLQRNVLFIIIWVTTFVGQIVIVQYGGYALHTEALELDHWLWCMLFGIGVLLWAQLINCIPTTVIPKHMPWSKKKLPTAENQALNQYKSVDSGNESEDEDYDDIGDLARQNNDEDDDDIK-NSGQILWIRGLSRLQTQQNTCNP---NLDNRNDVVYGGVRRFTLSQVGGVQPLLAARRQSSYS---NNEQNINLSTNQTESIIIP 4166
            Y ++ K+L +LM  R +E +++I E  G ++E+C++L TSP  GL   +    +RR  FGSN+IPPKPPKTF  L+WEALQD+TLI+L  AA++SL L+ Y      +    E E   GWIEG+AIL +VIVVV+VTAFND+ KERQFRGLQ++IEG HK +VIRGG   +I VGDI+VGDI QVKYGDLLPADG +IQSND+KVDESSLTGE DHVKKG D+DPM+LSGTHVMEGS KM+VTAVG+NSQAGIIF LLGAA  E+     K K E ++ N Q + T  N   S+ KG +   + E    ++T++  E      NH P + +SG A                   KK+ SVLQ KL KLA  IG  G+ +A LTV ILII+FCI T+V +++ W   +   ++  LIIGVTVLVVAVPEGLPLAVT+SLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYI  +  +  LP+  ++  +  +++   IS+NS+YTS +MA  +  +LP Q+GNKTECALLGFV G L   Y  +R +  E+K  +VYTFNS RKSM T+I    G   L TKGASE+I+ KC+FI G  G ++ FT +  E L++ VIEPMA DGLRTI +AY++FV       +   + + + ++E  ++ +LT + +VGIEDPVRPEVP AI+KCQ+AGITVRMVTGDNINTARSIA KCGIL+P +DFL++EGKEFN R+RD  +G I+Q LID+VWPKLRVLARSSP DKYTLV GIIDS ++ +REVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNF+SIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAF+GAC + DSPLKAVQMLWVNLIMDTLASLALATE PT +LL R PYGRTKP+ISR M+KNI+GQ++YQL + F LL  G+V+LD+E+GRG   + +N  PTQHFT IFNTFVMMTLFNE N+RKIHGQ+NV +GL  N +F  IW+ T + Q++I+QYG  A  T+AL LD WLWC+ FGIG L+W QLI  +PT  +PK + W +                         E+Y D  +L  +  D  D D K  +GQILWIRGL+RLQTQ    N     LD R    YG     +L++V         R+Q+S S   +   +I  + N  + + IP
Sbjct:   11 YGISLKQLRELMEHRGREGVMKIAEN-GGIHELCKKLYTSPNEGLSGSKADEEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVLQEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKGPDVDPMVLSGTHVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKEAKRANKQKNLTGENDGRSQIKGSQAPSQRETVTSEITKSESE-----GNHLPQSSSSGAAETGH---------------KKEKSVLQAKLTKLAIQIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGLPLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEKLCKV-LPTLSDIPQHVGNLITMGISVNSAYTSNIMAGHNPGDLPIQVGNKTECALLGFVQG-LGVKYQSIRDEITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIYGHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHIDGEPNWDDEENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILRPNDDFLILEGKEFNRRIRDS-NGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVSENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEFPTPDLLLRKPYGRTKPLISRTMMKNILGQALYQLIIIFGLLFVGDVILDIESGRG---QELNAGPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQYGKMAFSTKALTLDQWLWCIFFGIGTLVWGQLITSVPTRKLPKILSWGR----------------------GHPEEYTDGMNLGEERFDSIDSDKKPRAGQILWIRGLTRLQTQIRVVNAFRQGLDAR----YGDHTNTSLAEV--------LRKQTSLSKRLSETSSIEYADNIPDELTIP 1166          
BLAST of Calcium-transporting ATPase vs. Ensembl Fly
Match: PMCA (gene:FBgn0259214 transcript:FBtr0304048)

HSP 1 Score: 1283.09 bits (3319), Expect = 0.000e+0
Identity = 703/1221 (57.58%), Postives = 868/1221 (71.09%), Query Frame = 3
Query:  573 YEMNTKELTDLMMLRQQEAILEIKEKYGDVYEICRRLKTSPQSGLIDDEESIGNRRREFGSNIIPPKPPKTFFRLMWEALQDLTLIVLMGAAVISLALALYSKFSGSSHG-DETEGDAGWIEXXXXXXXXXXXXXXTAFNDWQKERQFRGLQDQIEGNHKIAVIRGGVAKEXXXXXXXXXXXCQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDIDPMMLSGTHVMEGSAKMLVTAVGLNSQAGIIFALLGAANTEE-----KDKAETEKPNNQVHKTNSN---SKNKGCKNVDE-EVELMKLTETHPEDADRCSNHKPNNYASGDANKSEIKNGKVKQEKKVRAPKKKGSVLQLKLNKLASSIGQIGTIVASLTVTILIIKFCINTYVFEKEGWSMDHLKKMINFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYINGQHNRTHLPSFEELSFNAADMLLKNISINSSYTSRLMATRHVNELPSQIGNKTECALLGFVNGSLKRDYADLRTQWPEEKLIKVYTFNSERKSMSTII-EDEGKLLLLTKGASEMILNKCSFILGKNGKIQPFTTEDVEALVKNVIEPMASDGLRTIGLAYKEFVKKPDHDYQGLYNEKLDLENEHTLIKDLTLIGIVGIEDPVRPEVPPAIKKCQKAGITVRMVTGDNINTARSIAIKCGILKPGEDFLVMEGKEFNNRVRDPISGKIKQELIDQVWPKLRVLARSSPQDKYTLVTGIIDSHLTRSREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFLGACFITDSPLKAVQMLWVNLIMDTLASLALATEMPTEELLDRAPYGRTKPIISRRMIKNIMGQSIYQLAVTFYLLLHGNVLLDVENGRGLTERGINK-PTQHFTAIFNTFVMMTLFNEFNSRKIHGQKNVFDGLQRNVLFIIIWVTTFVGQIVIVQYGGYALHTEALELDHWLWCMLFGIGVLLWAQLINCIPTTVIPKHMPWSKKKLPTAENQALNQYKSVDSGNESEDEDYDDIGDLARQNNDEDDDDIK-NSGQILWIRGLSRLQTQ-------QNTCNPNLDNRNDVVYGGVRRFTLSQVGGVQPLLAARRQSSYS---NNEQNINLSTNQTESIIIP 4166
            Y ++ K+L +LM  R +E +++I E  G ++E+C++L TSP  GL   +    +RR  FGSN+IPPKPPKTF  L+WEALQD+TLI+L  AA++SL L+ Y      +    E E   GWIEG+AIL +VIVVV+VTAFND+ KERQFRGLQ++IEG HK +VIRGG   +I VGDI+VGDI QVKYGDLLPADG +IQSND+KVDESSLTGE DHVKKG D+DPM+LSGTHVMEGS KM+VTAVG+NSQAGIIF LLGAA  E+     K K E ++ N Q + T  N   S+ KG +   + E    ++T++  E      NH P + +SG A                   KK+ SVLQ KL KLA  IG  G+ +A LTV ILII+FCI T+V +++ W   +   ++  LIIGVTVLVVAVPEGLPLAVT+SLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYI  +  +  LP+  ++  +  +++   IS+NS+YTS +MA  +  +LP Q+GNKTECALLGFV G L   Y  +R +  E+K  +VYTFNS RKSM T+I    G   L TKGASE+I+ KC+FI G  G ++ FT +  E L++ VIEPMA DGLRTI +AY++FV       +   + + + ++E  ++ +LT + +VGIEDPVRPEVP AI+KCQ+AGITVRMVTGDNINTARSIA KCGIL+P +DFL++EGKEFN R+RD  +G I+Q LID+VWPKLRVLARSSP DKYTLV GIIDS ++ +REVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNF+SIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAF+GAC + DSPLKAVQMLWVNLIMDTLASLALATE PT +LL R PYGRTKP+ISR M+KNI+GQ++YQL + F LL  G+V+LD+E+GRG   + +N  PTQHFT IFNTFVMMTLFNE N+RKIHGQ+NV +GL  N +F  IW+ T + Q++I+QYG  A  T+AL LD WLWC+ FGIG L+W QLI  +PT  +PK + W +                         E+Y D  +L  +  D  D D K  +GQILWIRGL+RLQTQ        N     LD R    YG     +L++V         R+Q+S S   +   +I  + N  + + IP
Sbjct:   11 YGISLKQLRELMEHRGREGVMKIAEN-GGIHELCKKLYTSPNEGLSGSKADEEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVLQEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKGPDVDPMVLSGTHVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKEAKRANKQKNLTGENDGRSQIKGSQAPSQRETVTSEITKSESE-----GNHLPQSSSSGAAETGH---------------KKEKSVLQAKLTKLAIQIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGLPLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEKLCKV-LPTLSDIPQHVGNLITMGISVNSAYTSNIMAGHNPGDLPIQVGNKTECALLGFVQG-LGVKYQSIRDEITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIYGHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHIDGEPNWDDEENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILRPNDDFLILEGKEFNRRIRDS-NGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVSENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEFPTPDLLLRKPYGRTKPLISRTMMKNILGQALYQLIIIFGLLFVGDVILDIESGRG---QELNAGPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQYGKMAFSTKALTLDQWLWCIFFGIGTLVWGQLITSVPTRKLPKILSWGR----------------------GHPEEYTDGMNLGEERFDSIDSDKKPRAGQILWIRGLTRLQTQISVPIRVVNAFRQGLDAR----YGDHTNTSLAEV--------LRKQTSLSKRLSETSSIEYADNIPDELTIP 1170          
BLAST of Calcium-transporting ATPase vs. Ensembl Fly
Match: PMCA (gene:FBgn0259214 transcript:FBtr0300554)

HSP 1 Score: 1280.77 bits (3313), Expect = 0.000e+0
Identity = 687/1149 (59.79%), Postives = 842/1149 (73.28%), Query Frame = 3
Query:  573 YEMNTKELTDLMMLRQQEAILEIKEKYGDVYEICRRLKTSPQSGLIDDEESIGNRRREFGSNIIPPKPPKTFFRLMWEALQDLTLIVLMGAAVISLALALYSKFSGSSHG-DETEGDAGWIEXXXXXXXXXXXXXXTAFNDWQKERQFRGLQDQIEGNHKIAVIRGGVAKEXXXXXXXXXXXCQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDIDPMMLSGTHVMEGSAKMLVTAVGLNSQAGIIFALLGAANTEE-----KDKAETEKPNNQVHKTNSN---SKNKGCKNVDE-EVELMKLTETHPEDADRCSNHKPNNYASGDANKSEIKNGKVKQEKKVRAPKKKGSVLQLKLNKLASSIGQIGTIVASLTVTILIIKFCINTYVFEKEGWSMDHLKKMINFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYINGQHNRTHLPSFEELSFNAADMLLKNISINSSYTSRLMATRHVNELPSQIGNKTECALLGFVNGSLKRDYADLRTQWPEEKLIKVYTFNSERKSMSTII-EDEGKLLLLTKGASEMILNKCSFILGKNGKIQPFTTEDVEALVKNVIEPMASDGLRTIGLAYKEFVKKPDHDYQGLYNEKLDLENEHTLIKDLTLIGIVGIEDPVRPEVPPAIKKCQKAGITVRMVTGDNINTARSIAIKCGILKPGEDFLVMEGKEFNNRVRDPISGKIKQELIDQVWPKLRVLARSSPQDKYTLVTGIIDSHLTRSREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFLGACFITDSPLKAVQMLWVNLIMDTLASLALATEMPTEELLDRAPYGRTKPIISRRMIKNIMGQSIYQLAVTFYLLLHGNVLLDVENGRGLTERGINK-PTQHFTAIFNTFVMMTLFNEFNSRKIHGQKNVFDGLQRNVLFIIIWVTTFVGQIVIVQYGGYALHTEALELDHWLWCMLFGIGVLLWAQLINCIPTTVIPKHMPWSKKKLPTAENQALNQYKSVDSGNESEDEDYDDIGDLARQNNDEDDDDIK-NSGQILWIRGLSRLQTQ 3980
            Y ++ K+L +LM  R +E +++I E  G ++E+C++L TSP  GL   +    +RR  FGSN+IPPKPPKTF  L+WEALQD+TLI+L  AA++SL L+ Y      +    E E   GWIEG+AIL +VIVVV+VTAFND+ KERQFRGLQ++IEG HK +VIRGG   +I VGDI+VGDI QVKYGDLLPADG +IQSND+KVDESSLTGE DHVKKG D+DPM+LSGTHVMEGS KM+VTAVG+NSQAGIIF LLGAA  E+     K K E ++ N Q + T  N   S+ KG +   + E    ++T++  E      NH P + +SG A                   KK+ SVLQ KL KLA  IG  G+ +A LTV ILII+FCI T+V +++ W   +   ++  LIIGVTVLVVAVPEGLPLAVT+SLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYI  +  +  LP+  ++  +  +++   IS+NS+YTS +MA  +  +LP Q+GNKTECALLGFV G L   Y  +R +  E+K  +VYTFNS RKSM T+I    G   L TKGASE+I+ KC+FI G  G ++ FT +  E L++ VIEPMA DGLRTI +AY++FV       +   + + + ++E  ++ +LT + +VGIEDPVRPEVP AI+KCQ+AGITVRMVTGDNINTARSIA KCGIL+P +DFL++EGKEFN R+RD  +G I+Q LID+VWPKLRVLARSSP DKYTLV GIIDS ++ +REVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNF+SIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAF+GAC + DSPLKAVQMLWVNLIMDTLASLALATE PT +LL R PYGRTKP+ISR M+KNI+GQ++YQL + F LL  G+V+LD+E+GRG   + +N  PTQHFT IFNTFVMMTLFNE N+RKIHGQ+NV +GL  N +F  IW+ T + Q++I+QYG  A  T+AL LD WLWC+ FGIG L+W QLI  +PT  +PK + W +                         E+Y D  +L  +  D  D D K  +GQILWIRGL+RLQTQ
Sbjct:   11 YGISLKQLRELMEHRGREGVMKIAEN-GGIHELCKKLYTSPNEGLSGSKADEEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVLQEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKGPDVDPMVLSGTHVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKEAKRANKQKNLTGENDGRSQIKGSQAPSQRETVTSEITKSESE-----GNHLPQSSSSGAAETGH---------------KKEKSVLQAKLTKLAIQIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGLPLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEKLCKV-LPTLSDIPQHVGNLITMGISVNSAYTSNIMAGHNPGDLPIQVGNKTECALLGFVQG-LGVKYQSIRDEITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIYGHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHIDGEPNWDDEENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILRPNDDFLILEGKEFNRRIRDS-NGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVSENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEFPTPDLLLRKPYGRTKPLISRTMMKNILGQALYQLIIIFGLLFVGDVILDIESGRG---QELNAGPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQYGKMAFSTKALTLDQWLWCIFFGIGTLVWGQLITSVPTRKLPKILSWGR----------------------GHPEEYTDGMNLGEERFDSIDSDKKPRAGQILWIRGLTRLQTQ 1110          
BLAST of Calcium-transporting ATPase vs. Ensembl Fly
Match: PMCA (gene:FBgn0259214 transcript:FBtr0300557)

HSP 1 Score: 1280.77 bits (3313), Expect = 0.000e+0
Identity = 687/1149 (59.79%), Postives = 842/1149 (73.28%), Query Frame = 3
Query:  573 YEMNTKELTDLMMLRQQEAILEIKEKYGDVYEICRRLKTSPQSGLIDDEESIGNRRREFGSNIIPPKPPKTFFRLMWEALQDLTLIVLMGAAVISLALALYSKFSGSSHG-DETEGDAGWIEXXXXXXXXXXXXXXTAFNDWQKERQFRGLQDQIEGNHKIAVIRGGVAKEXXXXXXXXXXXCQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDIDPMMLSGTHVMEGSAKMLVTAVGLNSQAGIIFALLGAANTEE-----KDKAETEKPNNQVHKTNSN---SKNKGCKNVDE-EVELMKLTETHPEDADRCSNHKPNNYASGDANKSEIKNGKVKQEKKVRAPKKKGSVLQLKLNKLASSIGQIGTIVASLTVTILIIKFCINTYVFEKEGWSMDHLKKMINFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYINGQHNRTHLPSFEELSFNAADMLLKNISINSSYTSRLMATRHVNELPSQIGNKTECALLGFVNGSLKRDYADLRTQWPEEKLIKVYTFNSERKSMSTII-EDEGKLLLLTKGASEMILNKCSFILGKNGKIQPFTTEDVEALVKNVIEPMASDGLRTIGLAYKEFVKKPDHDYQGLYNEKLDLENEHTLIKDLTLIGIVGIEDPVRPEVPPAIKKCQKAGITVRMVTGDNINTARSIAIKCGILKPGEDFLVMEGKEFNNRVRDPISGKIKQELIDQVWPKLRVLARSSPQDKYTLVTGIIDSHLTRSREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFLGACFITDSPLKAVQMLWVNLIMDTLASLALATEMPTEELLDRAPYGRTKPIISRRMIKNIMGQSIYQLAVTFYLLLHGNVLLDVENGRGLTERGINK-PTQHFTAIFNTFVMMTLFNEFNSRKIHGQKNVFDGLQRNVLFIIIWVTTFVGQIVIVQYGGYALHTEALELDHWLWCMLFGIGVLLWAQLINCIPTTVIPKHMPWSKKKLPTAENQALNQYKSVDSGNESEDEDYDDIGDLARQNNDEDDDDIK-NSGQILWIRGLSRLQTQ 3980
            Y ++ K+L +LM  R +E +++I E  G ++E+C++L TSP  GL   +    +RR  FGSN+IPPKPPKTF  L+WEALQD+TLI+L  AA++SL L+ Y      +    E E   GWIEG+AIL +VIVVV+VTAFND+ KERQFRGLQ++IEG HK +VIRGG   +I VGDI+VGDI QVKYGDLLPADG +IQSND+KVDESSLTGE DHVKKG D+DPM+LSGTHVMEGS KM+VTAVG+NSQAGIIF LLGAA  E+     K K E ++ N Q + T  N   S+ KG +   + E    ++T++  E      NH P + +SG A                   KK+ SVLQ KL KLA  IG  G+ +A LTV ILII+FCI T+V +++ W   +   ++  LIIGVTVLVVAVPEGLPLAVT+SLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYI  +  +  LP+  ++  +  +++   IS+NS+YTS +MA  +  +LP Q+GNKTECALLGFV G L   Y  +R +  E+K  +VYTFNS RKSM T+I    G   L TKGASE+I+ KC+FI G  G ++ FT +  E L++ VIEPMA DGLRTI +AY++FV       +   + + + ++E  ++ +LT + +VGIEDPVRPEVP AI+KCQ+AGITVRMVTGDNINTARSIA KCGIL+P +DFL++EGKEFN R+RD  +G I+Q LID+VWPKLRVLARSSP DKYTLV GIIDS ++ +REVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNF+SIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAF+GAC + DSPLKAVQMLWVNLIMDTLASLALATE PT +LL R PYGRTKP+ISR M+KNI+GQ++YQL + F LL  G+V+LD+E+GRG   + +N  PTQHFT IFNTFVMMTLFNE N+RKIHGQ+NV +GL  N +F  IW+ T + Q++I+QYG  A  T+AL LD WLWC+ FGIG L+W QLI  +PT  +PK + W +                         E+Y D  +L  +  D  D D K  +GQILWIRGL+RLQTQ
Sbjct:   11 YGISLKQLRELMEHRGREGVMKIAEN-GGIHELCKKLYTSPNEGLSGSKADEEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVLQEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKGPDVDPMVLSGTHVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKEAKRANKQKNLTGENDGRSQIKGSQAPSQRETVTSEITKSESE-----GNHLPQSSSSGAAETGH---------------KKEKSVLQAKLTKLAIQIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGLPLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEKLCKV-LPTLSDIPQHVGNLITMGISVNSAYTSNIMAGHNPGDLPIQVGNKTECALLGFVQG-LGVKYQSIRDEITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIYGHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHIDGEPNWDDEENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILRPNDDFLILEGKEFNRRIRDS-NGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVSENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEFPTPDLLLRKPYGRTKPLISRTMMKNILGQALYQLIIIFGLLFVGDVILDIESGRG---QELNAGPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQYGKMAFSTKALTLDQWLWCIFFGIGTLVWGQLITSVPTRKLPKILSWGR----------------------GHPEEYTDGMNLGEERFDSIDSDKKPRAGQILWIRGLTRLQTQ 1110          
BLAST of Calcium-transporting ATPase vs. Ensembl Fly
Match: PMCA (gene:FBgn0259214 transcript:FBtr0304046)

HSP 1 Score: 1280.77 bits (3313), Expect = 0.000e+0
Identity = 687/1149 (59.79%), Postives = 842/1149 (73.28%), Query Frame = 3
Query:  573 YEMNTKELTDLMMLRQQEAILEIKEKYGDVYEICRRLKTSPQSGLIDDEESIGNRRREFGSNIIPPKPPKTFFRLMWEALQDLTLIVLMGAAVISLALALYSKFSGSSHG-DETEGDAGWIEXXXXXXXXXXXXXXTAFNDWQKERQFRGLQDQIEGNHKIAVIRGGVAKEXXXXXXXXXXXCQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDIDPMMLSGTHVMEGSAKMLVTAVGLNSQAGIIFALLGAANTEE-----KDKAETEKPNNQVHKTNSN---SKNKGCKNVDE-EVELMKLTETHPEDADRCSNHKPNNYASGDANKSEIKNGKVKQEKKVRAPKKKGSVLQLKLNKLASSIGQIGTIVASLTVTILIIKFCINTYVFEKEGWSMDHLKKMINFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYINGQHNRTHLPSFEELSFNAADMLLKNISINSSYTSRLMATRHVNELPSQIGNKTECALLGFVNGSLKRDYADLRTQWPEEKLIKVYTFNSERKSMSTII-EDEGKLLLLTKGASEMILNKCSFILGKNGKIQPFTTEDVEALVKNVIEPMASDGLRTIGLAYKEFVKKPDHDYQGLYNEKLDLENEHTLIKDLTLIGIVGIEDPVRPEVPPAIKKCQKAGITVRMVTGDNINTARSIAIKCGILKPGEDFLVMEGKEFNNRVRDPISGKIKQELIDQVWPKLRVLARSSPQDKYTLVTGIIDSHLTRSREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFLGACFITDSPLKAVQMLWVNLIMDTLASLALATEMPTEELLDRAPYGRTKPIISRRMIKNIMGQSIYQLAVTFYLLLHGNVLLDVENGRGLTERGINK-PTQHFTAIFNTFVMMTLFNEFNSRKIHGQKNVFDGLQRNVLFIIIWVTTFVGQIVIVQYGGYALHTEALELDHWLWCMLFGIGVLLWAQLINCIPTTVIPKHMPWSKKKLPTAENQALNQYKSVDSGNESEDEDYDDIGDLARQNNDEDDDDIK-NSGQILWIRGLSRLQTQ 3980
            Y ++ K+L +LM  R +E +++I E  G ++E+C++L TSP  GL   +    +RR  FGSN+IPPKPPKTF  L+WEALQD+TLI+L  AA++SL L+ Y      +    E E   GWIEG+AIL +VIVVV+VTAFND+ KERQFRGLQ++IEG HK +VIRGG   +I VGDI+VGDI QVKYGDLLPADG +IQSND+KVDESSLTGE DHVKKG D+DPM+LSGTHVMEGS KM+VTAVG+NSQAGIIF LLGAA  E+     K K E ++ N Q + T  N   S+ KG +   + E    ++T++  E      NH P + +SG A                   KK+ SVLQ KL KLA  IG  G+ +A LTV ILII+FCI T+V +++ W   +   ++  LIIGVTVLVVAVPEGLPLAVT+SLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYI  +  +  LP+  ++  +  +++   IS+NS+YTS +MA  +  +LP Q+GNKTECALLGFV G L   Y  +R +  E+K  +VYTFNS RKSM T+I    G   L TKGASE+I+ KC+FI G  G ++ FT +  E L++ VIEPMA DGLRTI +AY++FV       +   + + + ++E  ++ +LT + +VGIEDPVRPEVP AI+KCQ+AGITVRMVTGDNINTARSIA KCGIL+P +DFL++EGKEFN R+RD  +G I+Q LID+VWPKLRVLARSSP DKYTLV GIIDS ++ +REVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNF+SIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAF+GAC + DSPLKAVQMLWVNLIMDTLASLALATE PT +LL R PYGRTKP+ISR M+KNI+GQ++YQL + F LL  G+V+LD+E+GRG   + +N  PTQHFT IFNTFVMMTLFNE N+RKIHGQ+NV +GL  N +F  IW+ T + Q++I+QYG  A  T+AL LD WLWC+ FGIG L+W QLI  +PT  +PK + W +                         E+Y D  +L  +  D  D D K  +GQILWIRGL+RLQTQ
Sbjct:   11 YGISLKQLRELMEHRGREGVMKIAEN-GGIHELCKKLYTSPNEGLSGSKADEEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVLQEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKGPDVDPMVLSGTHVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKEAKRANKQKNLTGENDGRSQIKGSQAPSQRETVTSEITKSESE-----GNHLPQSSSSGAAETGH---------------KKEKSVLQAKLTKLAIQIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGLPLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEKLCKV-LPTLSDIPQHVGNLITMGISVNSAYTSNIMAGHNPGDLPIQVGNKTECALLGFVQG-LGVKYQSIRDEITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIYGHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHIDGEPNWDDEENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILRPNDDFLILEGKEFNRRIRDS-NGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVSENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEFPTPDLLLRKPYGRTKPLISRTMMKNILGQALYQLIIIFGLLFVGDVILDIESGRG---QELNAGPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQYGKMAFSTKALTLDQWLWCIFFGIGTLVWGQLITSVPTRKLPKILSWGR----------------------GHPEEYTDGMNLGEERFDSIDSDKKPRAGQILWIRGLTRLQTQ 1110          
BLAST of Calcium-transporting ATPase vs. Ensembl Zebrafish
Match: atp2b3b (ATPase plasma membrane Ca2+ transporting 3b [Source:ZFIN;Acc:ZDB-GENE-080409-2])

HSP 1 Score: 1205.28 bits (3117), Expect = 0.000e+0
Identity = 665/1225 (54.29%), Postives = 835/1225 (68.16%), Query Frame = 3
Query:  573 YEMNTKELTDLMMLRQQEAILEIKEKYGDVYEICRRLKTSPQSGLIDDEESIGNRRREFGSNIIPPKPPKTFFRLMWEALQDLTLIVLMGAAVISLALALY------SKFSGSSHG---DETEGDAGWIEXXXXXXXXXXXXXXTAFNDWQKERQFRGLQDQIEGNHKIAVIRGGVAKEXXXXXXXXXXXCQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDIDPMMLSGTHVMEGSAKMLVTAVGLNSQAGIIFALLGAANTEEKDKAETEKPNNQVHKTNSNSKNKGCKNVDEEVELMKLTETHPEDADRCSNHKPNNYASGDANKSEIKNGKVKQEKKVRAPKKKGSVLQLKLNKLASSIGQIGTIVASLTVTILIIKFCINTYVFEKEGWSMD----HLKKMINFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYINGQHNRTHLPSFEELSFNAADMLLKNISINSSYTSRLMATRHVNELPSQIGNKTECALLGFVNGSLKRDYADLRTQWPEEKLIKVYTFNSERKSMSTIIE-DEGKLLLLTKGASEMILNKCSFILGKNGKIQPFTTEDVEALVKNVIEPMASDGLRTIGLAYKEFVKKPDHDYQGLYNEKLDLENEHTLIKDLTLIGIVGIEDPVRPEVPPAIKKCQKAGITVRMVTGDNINTARSIAIKCGILKPGEDFLVMEGKEFNNRVRDPISGKIKQELIDQVWPKLRVLARSSPQDKYTLVTGIIDSHLTRSREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFLGACFITDSPLKAVQMLWVNLIMDTLASLALATEMPTEELLDRAPYGRTKPIISRRMIKNIMGQSIYQLAVTFYLLLHGNVLLDVENGRGLTERGINKPTQHFTAIFNTFVMMTLFNEFNSRKIHGQKNVFDGLQRNVLFIIIWVTTFVGQIVIVQYGGYALHTEALELDHWLWCMLFGIGVLLWAQLINCIPTTVIPKHMPWSKKKLPTAENQALNQYKSVDSGNESEDEDYDDIGDLARQNNDEDDDDIKNSGQILWIRGLSRLQTQQNTCNPNLDNRNDVVYGGVRRFTLSQVGGVQPLLAARRQSSYSNNEQNINLSTNQTESIIIPTATKSGSVDSNLS 4205
            + ++  EL +LM LR  EA+ +I+E + DV  +C+RLK+S   GL D+   +  RR+ FG N IPPK PKTF +L+WEALQD+TLI+L  AA+ISLAL+ Y      S+  G   G   DE E +AGWIEG AIL +VI VVLVTAFNDW KE+QFRGLQ +IE   + AV+R G   +I V ++VVGD+ QVKYGDLLPADG+++Q ND+K+DESSLTGE DHV+K V+ DPM+LSGTHVMEGS +MLVTAVG+NSQ+GIIF LLGA   EE+ K +  K      +TN N   K    V  E++ +K                        A   E++    +++KK   PKK+ SVLQ KL KLA  IG+ G +++++TV IL++ F I+T+V     W  +    +++  + F IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYIN QH R  +P   ++S N  +M++  ISIN +YTS++M       LP Q+GNKTEC LLGF+   LKRDYA +R Q PEEKL KVYTFNS RKSMST+++  +G   L +KGASE++L KCS ILG NG+ + F   D + +VK VIEPMA +GLRTI + Y++    P+ ++          ENE  ++ DLT I +VGIEDPVRPEVP AI+KCQ+AGITVRMVTGDNINTAR+IA KCGI++PG+DFL +EGK+FN R+R+   G+I+QE ID++WPKLRVLARSSP DK+TLV GIIDS +   R+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNF+SIVKAVMWGRNVYDSI+KFLQFQLTVNVVAVIVAF GAC   DSPLKAVQMLWVNLIMDT ASLALATE PTE LL R PYGR  P+IS  M+KNI+G  +YQL + F LL  G  + ++++GR       + P++H+T IFNTFV+M LFNE N+RKIHG++NVFDG+  N +F  I + TF  Q+VIVQ+GG       L ++ WLWC+  G+G LLW Q+I  +PT+    H+   K                 ++G+    ++  +      +   +  +     GQILW RGL+R+QTQ    +     R+    G VR                RR S  S      N+ST     +++ TA  S +  S LS
Sbjct:   34 FGVSLDELRNLMELRGAEALQKIQESFTDVEGLCQRLKSSTTDGLSDNPTDLEKRRQTFGQNFIPPKKPKTFLQLVWEALQDVTLIILELAAIISLALSFYQPPGEDSEVCGKGAGGAEDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEKQFRGLQSRIELEQRFAVVRNGNVIQIPVAEMVVGDMAQVKYGDLLPADGVLVQGNDLKIDESSLTGESDHVRKSVEKDPMLLSGTHVMEGSGRMLVTAVGVNSQSGIIFTLLGAGEGEEEKKEKKGKQPEAAVETNQNKAKKQDGAVAMEMQPLK-----------------------SAEGGEVEE---REKKKANVPKKEKSVLQGKLTKLAVQIGKAGLVMSAITVIILVLYFVIDTFVVGNMTWLPECTPIYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYINDQHFR-EIPDPSQISPNTLEMIVNAISINCAYTSKIMPPDVEGGLPKQVGNKTECGLLGFLL-DLKRDYAPVREQIPEEKLYKVYTFNSVRKSMSTVVQMPDGSFRLYSKGASEIVLKKCSSILGTNGEARNFRPRDRDEMVKKVIEPMACEGLRTICIGYRDLPGDPEPEW----------ENEAEIVTDLTCIAVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARAIASKCGIIQPGDDFLCLEGKDFNRRIRNE-KGEIEQERIDKIWPKLRVLARSSPTDKHTLVKGIIDSTVLEQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTEALLLRKPYGRNNPLISLTMMKNILGHGVYQLVIIFTLLFVGEKIFNIDSGRYAQLH--SPPSEHYTIIFNTFVLMQLFNEINARKIHGERNVFDGIFANPIFCSIVLGTFGVQVVIVQFGGKPFSCAPLNVEQWLWCLFVGVGELLWGQVIATVPTS----HLKCLK-----------------EAGHGPGTDEMTEDELAEDEEEIDHAERELRRGQILWFRGLNRIQTQMEVVSTF--KRSGSFQGAVR----------------RRSSVLSQLHDVTNIST--PTHVVLSTANASAAPGSELS 1176          
BLAST of Calcium-transporting ATPase vs. Ensembl Zebrafish
Match: atp2b3b (ATPase plasma membrane Ca2+ transporting 3b [Source:ZFIN;Acc:ZDB-GENE-080409-2])

HSP 1 Score: 1203.35 bits (3112), Expect = 0.000e+0
Identity = 653/1171 (55.76%), Postives = 818/1171 (69.85%), Query Frame = 3
Query:  573 YEMNTKELTDLMMLRQQEAILEIKEKYGDVYEICRRLKTSPQSGLIDDEESIGNRRREFGSNIIPPKPPKTFFRLMWEALQDLTLIVLMGAAVISLALALY------SKFSGSSHG---DETEGDAGWIEXXXXXXXXXXXXXXTAFNDWQKERQFRGLQDQIEGNHKIAVIRGGVAKEXXXXXXXXXXXCQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDIDPMMLSGTHVMEGSAKMLVTAVGLNSQAGIIFALLGAANTEEKDKAETEKPNNQVHKTNSNSKNKGCKNVDEEVELMKLTETHPEDADRCSNHKPNNYASGDANKSEIKNGKVKQEKKVRAPKKKGSVLQLKLNKLASSIGQIGTIVASLTVTILIIKFCINTYVFEKEGWSMD----HLKKMINFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYINGQHNRTHLPSFEELSFNAADMLLKNISINSSYTSRLMATRHVNELPSQIGNKTECALLGFVNGSLKRDYADLRTQWPEEKLIKVYTFNSERKSMSTIIE-DEGKLLLLTKGASEMILNKCSFILGKNGKIQPFTTEDVEALVKNVIEPMASDGLRTIGLAYKEFVKKPDHDYQGLYNEKLDLENEHTLIKDLTLIGIVGIEDPVRPEVPPAIKKCQKAGITVRMVTGDNINTARSIAIKCGILKPGEDFLVMEGKEFNNRVRDPISGKIKQELIDQVWPKLRVLARSSPQDKYTLVTGIIDSHLTRSREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFLGACFITDSPLKAVQMLWVNLIMDTLASLALATEMPTEELLDRAPYGRTKPIISRRMIKNIMGQSIYQLAVTFYLLLHGNVLLDVENGRGLTERGINKPTQHFTAIFNTFVMMTLFNEFNSRKIHGQKNVFDGLQRNVLFIIIWVTTFVGQIVIVQYGGYALHTEALELDHWLWCMLFGIGVLLWAQLINCIPTTVIPKHMPWSKKKLPTAENQALNQYKSVDSGNESEDEDYDDIGDLARQNNDEDDDDIKNSGQILWIRGLSRLQTQQNTCNPNLDNRNDVVYGGVRR 4043
            + ++  EL +LM LR  EA+ +I+E + DV  +C+RLK+S   GL D+   +  RR+ FG N IPPK PKTF +L+WEALQD+TLI+L  AA+ISLAL+ Y      S+  G   G   DE E +AGWIEG AIL +VI VVLVTAFNDW KE+QFRGLQ +IE   + AV+R G   +I V ++VVGD+ QVKYGDLLPADG+++Q ND+K+DESSLTGE DHV+K V+ DPM+LSGTHVMEGS +MLVTAVG+NSQ+GIIF LLGA   EE+ K +  K      +TN N   K    V  E++ +K                        A   E++    +++KK   PKK+ SVLQ KL KLA  IG+ G +++++TV IL++ F I+T+V     W  +    +++  + F IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYIN QH R  +P   ++S N  +M++  ISIN +YTS++M       LP Q+GNKTEC LLGF+   LKRDYA +R Q PEEKL KVYTFNS RKSMST+++  +G   L +KGASE++L KCS ILG NG+ + F   D + +VK VIEPMA +GLRTI + Y++    P+ ++          ENE  ++ DLT I +VGIEDPVRPEVP AI+KCQ+AGITVRMVTGDNINTAR+IA KCGI++PG+DFL +EGK+FN R+R+   G+I+QE ID++WPKLRVLARSSP DK+TLV GIIDS +   R+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNF+SIVKAVMWGRNVYDSI+KFLQFQLTVNVVAVIVAF GAC   DSPLKAVQMLWVNLIMDT ASLALATE PTE LL R PYGR  P+IS  M+KNI+G  +YQL + F LL  G  + ++++GR       + P++H+T IFNTFV+M LFNE N+RKIHG++NVFDG+  N +F  I + TF  Q+VIVQ+GG       L ++ WLWC+  G+G LLW Q+I  +PT+    H+   K                 ++G+    ++  +      +   +  +     GQILW RGL+R+QTQ    +     R+    G VRR
Sbjct:   34 FGVSLDELRNLMELRGAEALQKIQESFTDVEGLCQRLKSSTTDGLSDNPTDLEKRRQTFGQNFIPPKKPKTFLQLVWEALQDVTLIILELAAIISLALSFYQPPGEDSEVCGKGAGGAEDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEKQFRGLQSRIELEQRFAVVRNGNVIQIPVAEMVVGDMAQVKYGDLLPADGVLVQGNDLKIDESSLTGESDHVRKSVEKDPMLLSGTHVMEGSGRMLVTAVGVNSQSGIIFTLLGAGEGEEEKKEKKGKQPEAAVETNQNKAKKQDGAVAMEMQPLK-----------------------SAEGGEVEE---REKKKANVPKKEKSVLQGKLTKLAVQIGKAGLVMSAITVIILVLYFVIDTFVVGNMTWLPECTPIYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYINDQHFR-EIPDPSQISPNTLEMIVNAISINCAYTSKIMPPDVEGGLPKQVGNKTECGLLGFLL-DLKRDYAPVREQIPEEKLYKVYTFNSVRKSMSTVVQMPDGSFRLYSKGASEIVLKKCSSILGTNGEARNFRPRDRDEMVKKVIEPMACEGLRTICIGYRDLPGDPEPEW----------ENEAEIVTDLTCIAVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARAIASKCGIIQPGDDFLCLEGKDFNRRIRNE-KGEIEQERIDKIWPKLRVLARSSPTDKHTLVKGIIDSTVLEQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTEALLLRKPYGRNNPLISLTMMKNILGHGVYQLVIIFTLLFVGEKIFNIDSGRYAQLH--SPPSEHYTIIFNTFVLMQLFNEINARKIHGERNVFDGIFANPIFCSIVLGTFGVQVVIVQFGGKPFSCAPLNVEQWLWCLFVGVGELLWGQVIATVPTS----HLKCLK-----------------EAGHGPGTDEMTEDELAEDEEEIDHAERELRRGQILWFRGLNRIQTQMEVVSTF--KRSGSFQGAVRR 1140          
BLAST of Calcium-transporting ATPase vs. Ensembl Zebrafish
Match: atp2b3b (ATPase plasma membrane Ca2+ transporting 3b [Source:ZFIN;Acc:ZDB-GENE-080409-2])

HSP 1 Score: 1202.58 bits (3110), Expect = 0.000e+0
Identity = 653/1171 (55.76%), Postives = 818/1171 (69.85%), Query Frame = 3
Query:  573 YEMNTKELTDLMMLRQQEAILEIKEKYGDVYEICRRLKTSPQSGLIDDEESIGNRRREFGSNIIPPKPPKTFFRLMWEALQDLTLIVLMGAAVISLALALY------SKFSGSSHG---DETEGDAGWIEXXXXXXXXXXXXXXTAFNDWQKERQFRGLQDQIEGNHKIAVIRGGVAKEXXXXXXXXXXXCQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDIDPMMLSGTHVMEGSAKMLVTAVGLNSQAGIIFALLGAANTEEKDKAETEKPNNQVHKTNSNSKNKGCKNVDEEVELMKLTETHPEDADRCSNHKPNNYASGDANKSEIKNGKVKQEKKVRAPKKKGSVLQLKLNKLASSIGQIGTIVASLTVTILIIKFCINTYVFEKEGWSMD----HLKKMINFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYINGQHNRTHLPSFEELSFNAADMLLKNISINSSYTSRLMATRHVNELPSQIGNKTECALLGFVNGSLKRDYADLRTQWPEEKLIKVYTFNSERKSMSTIIE-DEGKLLLLTKGASEMILNKCSFILGKNGKIQPFTTEDVEALVKNVIEPMASDGLRTIGLAYKEFVKKPDHDYQGLYNEKLDLENEHTLIKDLTLIGIVGIEDPVRPEVPPAIKKCQKAGITVRMVTGDNINTARSIAIKCGILKPGEDFLVMEGKEFNNRVRDPISGKIKQELIDQVWPKLRVLARSSPQDKYTLVTGIIDSHLTRSREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFLGACFITDSPLKAVQMLWVNLIMDTLASLALATEMPTEELLDRAPYGRTKPIISRRMIKNIMGQSIYQLAVTFYLLLHGNVLLDVENGRGLTERGINKPTQHFTAIFNTFVMMTLFNEFNSRKIHGQKNVFDGLQRNVLFIIIWVTTFVGQIVIVQYGGYALHTEALELDHWLWCMLFGIGVLLWAQLINCIPTTVIPKHMPWSKKKLPTAENQALNQYKSVDSGNESEDEDYDDIGDLARQNNDEDDDDIKNSGQILWIRGLSRLQTQQNTCNPNLDNRNDVVYGGVRR 4043
            + ++  EL +LM LR  EA+ +I+E + DV  +C+RLK+S   GL D+   +  RR+ FG N IPPK PKTF +L+WEALQD+TLI+L  AA+ISLAL+ Y      S+  G   G   DE E +AGWIEG AIL +VI VVLVTAFNDW KE+QFRGLQ +IE   + AV+R G   +I V ++VVGD+ QVKYGDLLPADG+++Q ND+K+DESSLTGE DHV+K V+ DPM+LSGTHVMEGS +MLVTAVG+NSQ+GIIF LLGA   EE+ K +  K      +TN N   K    V  E++ +K                        A   E++    +++KK   PKK+ SVLQ KL KLA  IG+ G +++++TV IL++ F I+T+V     W  +    +++  + F IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYIN QH R  +P   ++S N  +M++  ISIN +YTS++M       LP Q+GNKTEC LLGF+   LKRDYA +R Q PEEKL KVYTFNS RKSMST+++  +G   L +KGASE++L KCS ILG NG+ + F   D + +VK VIEPMA +GLRTI + Y++    P+ ++          ENE  ++ DLT I +VGIEDPVRPEVP AI+KCQ+AGITVRMVTGDNINTAR+IA KCGI++PG+DFL +EGK+FN R+R+   G+I+QE ID++WPKLRVLARSSP DK+TLV GIIDS +   R+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNF+SIVKAVMWGRNVYDSI+KFLQFQLTVNVVAVIVAF GAC   DSPLKAVQMLWVNLIMDT ASLALATE PTE LL R PYGR  P+IS  M+KNI+G  +YQL + F LL  G  + ++++GR       + P++H+T IFNTFV+M LFNE N+RKIHG++NVFDG+  N +F  I + TF  Q+VIVQ+GG       L ++ WLWC+  G+G LLW Q+I  +PT+    H+   K                 ++G+    ++  +      +   +  +     GQILW RGL+R+QTQ    +     R+    G VRR
Sbjct:   28 FGVSLDELRNLMELRGAEALQKIQESFTDVEGLCQRLKSSTTDGLSDNPTDLEKRRQTFGQNFIPPKKPKTFLQLVWEALQDVTLIILELAAIISLALSFYQPPGEDSEVCGKGAGGAEDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEKQFRGLQSRIELEQRFAVVRNGNVIQIPVAEMVVGDMAQVKYGDLLPADGVLVQGNDLKIDESSLTGESDHVRKSVEKDPMLLSGTHVMEGSGRMLVTAVGVNSQSGIIFTLLGAGEGEEEKKEKKGKQPEAAVETNQNKAKKQDGAVAMEMQPLK-----------------------SAEGGEVEE---REKKKANVPKKEKSVLQGKLTKLAVQIGKAGLVMSAITVIILVLYFVIDTFVVGNMTWLPECTPIYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYINDQHFR-EIPDPSQISPNTLEMIVNAISINCAYTSKIMPPDVEGGLPKQVGNKTECGLLGFLL-DLKRDYAPVREQIPEEKLYKVYTFNSVRKSMSTVVQMPDGSFRLYSKGASEIVLKKCSSILGTNGEARNFRPRDRDEMVKKVIEPMACEGLRTICIGYRDLPGDPEPEW----------ENEAEIVTDLTCIAVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARAIASKCGIIQPGDDFLCLEGKDFNRRIRNE-KGEIEQERIDKIWPKLRVLARSSPTDKHTLVKGIIDSTVLEQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTEALLLRKPYGRNNPLISLTMMKNILGHGVYQLVIIFTLLFVGEKIFNIDSGRYAQLH--SPPSEHYTIIFNTFVLMQLFNEINARKIHGERNVFDGIFANPIFCSIVLGTFGVQVVIVQFGGKPFSCAPLNVEQWLWCLFVGVGELLWGQVIATVPTS----HLKCLK-----------------EAGHGPGTDEMTEDELAEDEEEIDHAERELRRGQILWFRGLNRIQTQMEVVSTF--KRSGSFQGAVRR 1134          
BLAST of Calcium-transporting ATPase vs. Ensembl Zebrafish
Match: atp2b3a (ATPase plasma membrane Ca2+ transporting 3a [Source:ZFIN;Acc:ZDB-GENE-040718-174])

HSP 1 Score: 1182.93 bits (3059), Expect = 0.000e+0
Identity = 657/1182 (55.58%), Postives = 813/1182 (68.78%), Query Frame = 3
Query:  573 YEMNTKELTDLMMLRQQEAILEIKEKYGDVYEICRRLKTSPQSGLIDDEESIGNRRREFGSNIIPPKPPKTFFRLMWEALQDLTLIVLMGAAVISLALALYSKFSGSSHG---------DETEGDAGWIEXXXXXXXXXXXXXXTAFNDWQKERQFRGLQDQIEGNHKIAVIRGGVAKEXXXXXXXXXXXCQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDIDPMMLSGTHVMEGSAKMLVTAVGLNSQAGIIFALLGAANTEEKDKAETEKPNNQVHKTNSNSKNKGCKNVDEEVELMKLTETHPEDADRCSNHKPNNYASGDANKSEIKNGKVKQEKKVRAPKKKGSVLQLKLNKLASSIGQIGTIVASLTVTILIIKFCINTYVFEKEGWSMD----HLKKMINFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYINGQHNRTHLPSFEELSFNAADMLLKNISINSSYTSRLMATRHVNELPSQIGNKTECALLGFVNGSLKRDYADLRTQWPEEKLIKVYTFNSERKSMSTIIE-DEGKLLLLTKGASEMILNKCSFILGKNGKIQPFTTEDVEALVKNVIEPMASDGLRTIGLAYKEFVKKPDHDYQGLYNEKLDLENEHTLIKDLTLIGIVGIEDPVRPEVPPAIKKCQKAGITVRMVTGDNINTARSIAIKCGILKPGEDFLVMEGKEFNNRVRDPISGKIKQELIDQVWPKLRVLARSSPQDKYTLVTGIIDSHLTRSREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFLGACFITDSPLKAVQMLWVNLIMDTLASLALATEMPTEELLDRAPYGRTKPIISRRMIKNIMGQSIYQLAVTFYLLLHGNVLLDVENGRGLTERGINKPTQHFTAIFNTFVMMTLFNEFNSRKIHGQKNVFDGLQRNVLFIIIWVTTFVGQIVIVQYGGYALHTEALELDHWLWCMLFGIGVLLWAQLINCIPTTVIPKHMPWSKKKLPTAENQALNQYKSVDSGNESEDEDYDDIGDLARQNNDEDDDDIKNSGQILWIRGLSRLQTQQNTCNPNLDNRNDVVYGGVRRFT--LSQVGGV 4070
            + ++  EL  LM LR  EA+ +I+E Y +   +C RLKTSP  GL D+   +  RR+ FG N IPPK PKTF  L+WEALQD+TLI+L  AA+ISL L+ Y    G S           DE E DA WIEG AIL +VI VVLVTAFNDW KE+QFRGLQ +IE   + AV+R     +I V ++VVGDI QVKYGDLLPADG++IQ ND+K+DESSLTGE DHV+K +D DPM+LSGTHVMEGS KMLVTAVG+NSQ GIIF LLGA   EE+ K   +   +   + N N   K  + V  E++ +K                           +E    + K++KK   PKK+ SVLQ KL KLA  IG+ G +++++TV IL++ F I T++  K+ W  +    +++  + F IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQ YI  Q  R  +P+ ++++    +++   I++N +YTS++M       LP Q+GNKTECALLG V   LK+DY  +R Q PEE L KVYTFNS RKSMST+I+  +G   L +KGASE++L KCSFIL ++G+ + F   D + +VK VIEPMA DGLRTI +AY+E    P  D+          +NE  ++ +LT I +VGIEDPVRPEVP AI+KCQ+AGITVRMVTGDNINTAR+IA KCGI+ PG+DFL MEGK+FN R+R+   G+I+QE ID++WPKLRVLARSSP DK+TLV GIIDS +   R+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNF+SIVKAVMWGRNVYDSI+KFLQFQLTVNVVAVIVAF GAC   DSPLKAVQMLWVNLIMDT ASLALATE PTE LL R PYGR  P+ISR M+KNI+G ++YQL + F LL  G  + D+++GR       + P++H+T IFNTFV+M LFNE N+RKIHG++NVFDG+  N +F  I + TF  QIVIVQ+GG       L ++ WLWC+  G+G LLW QLI+ +PT                     L   K    G  + DE  D+      +  D  + +++  GQILW RGL+R+QTQ    +     R+    G VRR +  LSQ+  V
Sbjct:   27 FGVSVDELCSLMELRGAEALQKIQENYTNTETLCHRLKTSPADGLSDNPADLEKRRKVFGMNFIPPKQPKTFLELVWEALQDITLIILEIAAIISLGLSFYQPPGGDSEACVEVSEGAEDEGEADANWIEGAAILLSVICVVLVTAFNDWSKEKQFRGLQSRIEQEQRFAVVRNSTVIQIPVAEMVVGDIAQVKYGDLLPADGVLIQGNDLKIDESSLTGESDHVRKSIDKDPMLLSGTHVMEGSGKMLVTAVGVNSQTGIIFTLLGAGEMEEEKKDCKKGKQDGTLENNQNKAKKQDEAVAMEMQPLK--------------------------SAEGGEVEEKEKKKASVPKKEKSVLQGKLTKLAVQIGKAGLVMSAITVIILMLYFVIKTFIVHKQPWLTECTPIYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQIYIGDQLFR-DIPTPDQINPRTLELISSAIAVNCAYTSKIMPADKEGGLPKQVGNKTECALLGLVL-DLKQDYQAVREQIPEELLYKVYTFNSVRKSMSTVIQMPDGSFRLYSKGASEILLKKCSFILSRDGEARAFRARDKDEMVKKVIEPMACDGLRTICIAYRELPADPLPDW----------DNETDIVSNLTCITVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARAIAAKCGIIHPGDDFLCMEGKDFNRRIRNE-KGEIEQERIDKIWPKLRVLARSSPTDKHTLVKGIIDSTVVEQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTEALLLRKPYGRNNPLISRTMMKNILGHAVYQLVIIFTLLFAGERIFDIDSGRDAPLH--SPPSEHYTIIFNTFVLMQLFNEINARKIHGERNVFDGIFSNPIFCSIVLGTFAIQIVIVQFGGKPFSCSPLNVEQWLWCLFVGMGELLWGQLISSVPT-------------------HQLKCLKEAGHG-PAPDEMLDEDLAEDEEEIDYAERELRR-GQILWFRGLNRIQTQMEVVSTF--KRSGSFQGAVRRRSSVLSQLHDV 1144          
BLAST of Calcium-transporting ATPase vs. Ensembl Zebrafish
Match: atp2b3a (ATPase plasma membrane Ca2+ transporting 3a [Source:ZFIN;Acc:ZDB-GENE-040718-174])

HSP 1 Score: 1181.39 bits (3055), Expect = 0.000e+0
Identity = 648/1150 (56.35%), Postives = 800/1150 (69.57%), Query Frame = 3
Query:  573 YEMNTKELTDLMMLRQQEAILEIKEKYGDVYEICRRLKTSPQSGLIDDEESIGNRRREFGSNIIPPKPPKTFFRLMWEALQDLTLIVLMGAAVISLALALYSKFSGSSHG---------DETEGDAGWIEXXXXXXXXXXXXXXTAFNDWQKERQFRGLQDQIEGNHKIAVIRGGVAKEXXXXXXXXXXXCQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDIDPMMLSGTHVMEGSAKMLVTAVGLNSQAGIIFALLGAANTEEKDKAETEKPNNQVHKTNSNSKNKGCKNVDEEVELMKLTETHPEDADRCSNHKPNNYASGDANKSEIKNGKVKQEKKVRAPKKKGSVLQLKLNKLASSIGQIGTIVASLTVTILIIKFCINTYVFEKEGWSMD----HLKKMINFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYINGQHNRTHLPSFEELSFNAADMLLKNISINSSYTSRLMATRHVNELPSQIGNKTECALLGFVNGSLKRDYADLRTQWPEEKLIKVYTFNSERKSMSTIIE-DEGKLLLLTKGASEMILNKCSFILGKNGKIQPFTTEDVEALVKNVIEPMASDGLRTIGLAYKEFVKKPDHDYQGLYNEKLDLENEHTLIKDLTLIGIVGIEDPVRPEVPPAIKKCQKAGITVRMVTGDNINTARSIAIKCGILKPGEDFLVMEGKEFNNRVRDPISGKIKQELIDQVWPKLRVLARSSPQDKYTLVTGIIDSHLTRSREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFLGACFITDSPLKAVQMLWVNLIMDTLASLALATEMPTEELLDRAPYGRTKPIISRRMIKNIMGQSIYQLAVTFYLLLHGNVLLDVENGRGLTERGINKPTQHFTAIFNTFVMMTLFNEFNSRKIHGQKNVFDGLQRNVLFIIIWVTTFVGQIVIVQYGGYALHTEALELDHWLWCMLFGIGVLLWAQLINCIPTTVIPKHMPWSKKKLPTAENQALNQYKSVDSGNESEDEDYDDIGDLARQNNDEDDDDIKNSGQILWIRGLSRLQTQ 3980
            + ++  EL  LM LR  EA+ +I+E Y +   +C RLKTSP  GL D+   +  RR+ FG N IPPK PKTF  L+WEALQD+TLI+L  AA+ISL L+ Y    G S           DE E DA WIEG AIL +VI VVLVTAFNDW KE+QFRGLQ +IE   + AV+R     +I V ++VVGDI QVKYGDLLPADG++IQ ND+K+DESSLTGE DHV+K +D DPM+LSGTHVMEGS KMLVTAVG+NSQ GIIF LLGA   EE+ K   +   +   + N N   K  + V  E++ +K                           +E    + K++KK   PKK+ SVLQ KL KLA  IG+ G +++++TV IL++ F I T++  K+ W  +    +++  + F IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQ YI  Q  R  +P+ ++++    +++   I++N +YTS++M       LP Q+GNKTECALLG V   LK+DY  +R Q PEE L KVYTFNS RKSMST+I+  +G   L +KGASE++L KCSFIL ++G+ + F   D + +VK VIEPMA DGLRTI +AY+E    P  D+          +NE  ++ +LT I +VGIEDPVRPEVP AI+KCQ+AGITVRMVTGDNINTAR+IA KCGI+ PG+DFL MEGK+FN R+R+   G+I+QE ID++WPKLRVLARSSP DK+TLV GIIDS +   R+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNF+SIVKAVMWGRNVYDSI+KFLQFQLTVNVVAVIVAF GAC   DSPLKAVQMLWVNLIMDT ASLALATE PTE LL R PYGR  P+ISR M+KNI+G ++YQL + F LL  G  + D+++GR       + P++H+T IFNTFV+M LFNE N+RKIHG++NVFDG+  N +F  I + TF  QIVIVQ+GG       L ++ WLWC+  G+G LLW QLI+ +PT                     L   K    G  + DE  D+      +  D  + +++  GQILW RGL+R+QTQ
Sbjct:   27 FGVSVDELCSLMELRGAEALQKIQENYTNTETLCHRLKTSPADGLSDNPADLEKRRKVFGMNFIPPKQPKTFLELVWEALQDITLIILEIAAIISLGLSFYQPPGGDSEACVEVSEGAEDEGEADANWIEGAAILLSVICVVLVTAFNDWSKEKQFRGLQSRIEQEQRFAVVRNSTVIQIPVAEMVVGDIAQVKYGDLLPADGVLIQGNDLKIDESSLTGESDHVRKSIDKDPMLLSGTHVMEGSGKMLVTAVGVNSQTGIIFTLLGAGEMEEEKKDCKKGKQDGTLENNQNKAKKQDEAVAMEMQPLK--------------------------SAEGGEVEEKEKKKASVPKKEKSVLQGKLTKLAVQIGKAGLVMSAITVIILMLYFVIKTFIVHKQPWLTECTPIYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQIYIGDQLFR-DIPTPDQINPRTLELISSAIAVNCAYTSKIMPADKEGGLPKQVGNKTECALLGLVL-DLKQDYQAVREQIPEELLYKVYTFNSVRKSMSTVIQMPDGSFRLYSKGASEILLKKCSFILSRDGEARAFRARDKDEMVKKVIEPMACDGLRTICIAYRELPADPLPDW----------DNETDIVSNLTCITVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARAIAAKCGIIHPGDDFLCMEGKDFNRRIRNE-KGEIEQERIDKIWPKLRVLARSSPTDKHTLVKGIIDSTVVEQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTEALLLRKPYGRNNPLISRTMMKNILGHAVYQLVIIFTLLFAGERIFDIDSGRDAPLH--SPPSEHYTIIFNTFVLMQLFNEINARKIHGERNVFDGIFSNPIFCSIVLGTFAIQIVIVQFGGKPFSCSPLNVEQWLWCLFVGMGELLWGQLISSVPT-------------------HQLKCLKEAGHG-PAPDEMLDEDLAEDEEEIDYAERELRR-GQILWFRGLNRIQTQ 1114          
BLAST of Calcium-transporting ATPase vs. Ensembl Xenopus
Match: atp2b1 (Xenopus tropicalis ATPase, Ca++ transporting, plasma membrane 1 (atp2b1), mRNA. [Source:RefSeq mRNA;Acc:NM_001368122])

HSP 1 Score: 1197.57 bits (3097), Expect = 0.000e+0
Identity = 660/1153 (57.24%), Postives = 815/1153 (70.69%), Query Frame = 3
Query:  567 ETYEMNTKELTDLMMLRQQEAILEIKEKYGDVYEICRRLKTSPQSGLIDDEESIGNRRREFGSNIIPPKPPKTFFRLMWEALQDLTLIVLMGAAVISLALALYSKFSGSSHGD---ETEGDAGWIEXXXXXXXXXXXXXXTAFNDWQKERQFRGLQDQIEGNHKIAVIRGGVAKEXXXXXXXXXXXCQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDIDPMMLSGTHVMEGSAKMLVTAVGLNSQAGIIFALLGAANTEEKDKAETEKPNNQVHKTNS--NSKNKGCKNVDEEVELMKLTETHPEDADRCSNHKPNNYASGDANKSEIKNGKVKQEKKVRAPKKKGSVLQLKLNKLASSIGQIGTIVASLTVTILIIKFCINTYVFEKEGWSMD----HLKKMINFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYINGQHNRTHLPSFEELSFNAADMLLKNISINSSYTSRLMATRHVNELPSQIGNKTECALLGFVNGSLKRDYADLRTQWPEEKLIKVYTFNSERKSMSTIIED-EGKLLLLTKGASEMILNKCSFILGKNGKIQPFTTEDVEALVKNVIEPMASDGLRTIGLAYKEFVKKPDHDYQGLYNEKLDLENEHTLIKDLTLIGIVGIEDPVRPEVPPAIKKCQKAGITVRMVTGDNINTARSIAIKCGILKPGEDFLVMEGKEFNNRVRDPISGKIKQELIDQVWPKLRVLARSSPQDKYTLVTGIIDSHLTRSREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFLGACFITDSPLKAVQMLWVNLIMDTLASLALATEMPTEELLDRAPYGRTKPIISRRMIKNIMGQSIYQLAVTFYLLLHGNVLLDVENGRGLTERGINKPTQHFTAIFNTFVMMTLFNEFNSRKIHGQKNVFDGLQRNVLFIIIWVTTFVGQIVIVQYGGYALHTEALELDHWLWCMLFGIGVLLWAQLINCIPTTVIPKHMPWSKKKLPTAENQALNQYKSVDSGNESEDEDYDDIGDLARQNNDEDDDDIKNSGQILWIRGLSRLQTQQNTCN 3995
            + + +  +EL  LM LR  +A+ +I+E+YGDVY IC RLKTSP  GL  +   +  R+  FG NIIPPK PKTF +L+WEALQD+TLI+L  AA+ISL L+ Y    G +  +   E EG+AGWIEG AIL +V+ VVLVTAFNDW KE+QFRGLQ +IE   K  V+RGG   +I V DIVVGDI Q+KYGDLLPADG++IQ ND+K+DESSLTGE DHVKK ++ DP++LSGTHVMEGS KM+VTA+G+NSQ GIIF LLGA   EE+ + E EK + +  K +    ++NK        +E+  L      D D                           +KK   PKK+ SVLQ KL KLA  IG+ G +++++TV IL++ F INT+  +K  W  +    +++  + F IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLT NRMTVVQS+IN +H R  +P  + +S N  D+LL  IS+N +YTS+++       LP  +GNKTECALLGF+   +KRDY D+R + PEE L KVYTFNS RKSMST++++ +G   + +KGASE+IL KC   LG NG+ + F   D + +VK VIEPMAS+GLRTI LAY++F   P  +++       D ENE+ ++  LT I +VGIEDPVRPEVP AI+KCQ+AGITVRMVTGDNINTAR+IA KCGIL PGEDFL +EGKEFN R+R+   G+I+QE ID++WPKLRVLARSSP DK+TLV GIIDS +   R+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNF+SIVKAVMWGRNVYDSI+KFLQFQLTVNVVAVIVAF GAC   DSPLKAVQMLWVNLIMDT ASLALATE PTE LL R PYGR KP+ISR M+KNI+G ++YQL V F LL  G  L D+++GR         P+QH+T +FNTFVMM LFNE N+RKIHG++NVF+G+  N++F  I + TF+ QIVIVQ+GG       L +D WLW +  G+G LLW QL+  IPT+                    L   K    G + +DE  ++      +  D  + +++  GQILW RGL+R+QTQ    N
Sbjct:    3 DQFGITIEELRTLMELRSTDALQKIQERYGDVYGICTRLKTSPHEGLSGNLADLERRQEAFGKNIIPPKKPKTFLQLVWEALQDVTLIILEIAAIISLGLSFYRPPGGDNECEYSCEEEGEAGWIEGGAILVSVVCVVLVTAFNDWSKEKQFRGLQSRIEQEQKFTVVRGGQVIQIPVADIVVGDIAQIKYGDLLPADGVLIQGNDLKIDESSLTGESDHVKKTLEKDPLLLSGTHVMEGSGKMVVTAIGVNSQTGIIFTLLGAGENEEEKEKEKEKKDKKNKKQDGAIENRNKAKAQDGAAMEMQPLKSEEGADGD--------------------------DKKKANLPKKEKSVLQGKLTKLAVQIGKAGLVMSAITVIILVLYFVINTFWVQKRPWLAECTPIYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTMNRMTVVQSFINEKHYR-KVPDPDSISENVLDLLLTGISVNCAYTSKILPPEKEGGLPRHVGNKTECALLGFIL-DMKRDYQDVRNEIPEETLFKVYTFNSVRKSMSTVLKNADGSYRMYSKGASEIILKKCFKTLGINGEAKIFRPRDRDDMVKRVIEPMASEGLRTICLAYRDF---PAGEHEP------DWENENDILTGLTCIAVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARAIATKCGILHPGEDFLCVEGKEFNRRIRNE-KGEIEQERIDKIWPKLRVLARSSPTDKHTLVKGIIDSTVCEQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTESLLLRKPYGRNKPLISRTMMKNILGHAVYQLVVVFTLLFVGEKLFDIDSGRNAPLHA--PPSQHYTIVFNTFVMMQLFNEINARKIHGERNVFEGIFNNIIFCSIVLGTFIIQIVIVQFGGKPFSCTELTVDQWLWSIFLGMGTLLWGQLVTSIPTS-------------------RLKFLKEAGHGTQ-KDEIPEEELAEDVEEIDHAERELRR-GQILWFRGLNRIQTQIRVVN 1094          
BLAST of Calcium-transporting ATPase vs. Ensembl Xenopus
Match: fam149a (family with sequence similarity 149 member A [Source:Xenbase;Acc:XB-GENE-6050471])

HSP 1 Score: 1191.02 bits (3080), Expect = 0.000e+0
Identity = 665/1195 (55.65%), Postives = 824/1195 (68.95%), Query Frame = 3
Query:  588 KELTDLMMLRQQEAILEIKEKYGDVYEICRRLKTSPQSGLIDDEESIGNRRREFGSNIIPPKPPKTFFRLMWEALQDLTLIVLMGAAVISLALALYS----------KFSGSSHGDETEGDAGWIEXXXXXXXXXXXXXXTAFNDWQKERQFRGLQDQIEGNHKIAVIRGGVAKEXXXXXXXXXXXCQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDIDPMMLSGTHVMEGSAKMLVTAVGLNSQAGIIFALLGAANTEEKDKAETEKPNNQVHKTNSNSKNKGCKNVDEEVELMKLTETHPEDADRCSNHKPNNYASGDANKSEIKNGKVKQEKKVRAPKKKGSVLQLKLNKLASSIGQIGTIVASLTVTILIIKFCINTYVFEKEGWSMD----HLKKMINFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYINGQHNRTHLPSFEELSFNAADMLLKNISINSSYTSRLMATRHVNELPSQIGNKTECALLGFVNGSLKRDYADLRTQWPEEKLIKVYTFNSERKSMSTIIE-DEGKLLLLTKGASEMILNKCSFILGKNGKIQPFTTEDVEALVKNVIEPMASDGLRTIGLAYKEFVKKPDHDYQGLYNEKLDLENEHTLIKDLTLIGIVGIEDPVRPEVPPAIKKCQKAGITVRMVTGDNINTARSIAIKCGILKPGEDFLVMEGKEFNNRVRDPISGKIKQELIDQVWPKLRVLARSSPQDKYTLVTGIIDSHLTRSREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFLGACFITDSPLKAVQMLWVNLIMDTLASLALATEMPTEELLDRAPYGRTKPIISRRMIKNIMGQSIYQLAVTFYLLLHGNVLLDVENGRGLTERGINKPTQHFTAIFNTFVMMTLFNEFNSRKIHGQKNVFDGLQRNVLFIIIWVTTFVGQIVIVQYGGYALHTEALELDHWLWCMLFGIGVLLWAQLINCIPTTVIPKHMPWSKKKLPTAENQALNQYKSVDSGNESEDEDYDDIGDLARQNNDEDDDDIKNSGQILWIRGLSRLQTQQNTCNPNLDNRNDVVYGGVRRFT--LSQVGGVQPLLAARRQSSYSNNEQ 4121
            +EL  LM LR  EAI +I++ YGDV  +CRRLKTSP  GL ++      RR+ +G N IPPK PKTF +L+WEALQD+TLI+L  AA++SL L+ Y+            SG  H DE E +AGWIEG AIL +VI VVLVTAFNDW KE+QFRGLQ +IE   + +VIR G   +I V +++VGDI Q+KYGDLLPADG++IQ ND+K+DESSLTGE DHV+K V+ DPM+LSGTHVMEGS +M+VTAVG+NSQ GIIF LLGA   EE+ K +  K  +   +TN N   K    V  E++ +K  E                   G+  + E        +KK   PKK+ SVLQ KL KLA  IG+ G +++++TV IL++ F I T+V + + W  +    +++  + F IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQS I   HN+   P    ++    D+L+  I+IN +YT++++       LP Q+GNKTECALLGFV   ++RDY  +R Q PEE L KVYTFNS RKSMSTII    G   L +KGASE++L KCS IL   G ++ F   D E +VK VIEPMA DGLRTI +AY+        D+ G+   +   ENE+ ++ DLT IG+VGIEDPVRPEVP AI+KCQ+AGITVRMVTGDNINTAR+IA KCGI++PGEDFL +EGKEFN R+R+   G+I+QE +D++WPKLRVLARSSP DK+TLV GIIDS +   R+VVAVTGDGTNDGPALKKADVGFAMG+AGTDVAKEASDIILTDDNF+SIVKAVMWGRNVYDSI+KFLQFQLTVNVVAVIVAF GAC   DSPLKAVQMLWVNLIMDT ASLALATE PTE LL R PYGR KP+ISR M+KNI+G ++YQL + F LL  G +  D+++GR         P++H+T IFNTFVMM LFNE N+RKIHG++NVFDG+  N +F  I + TF  QI+IVQ+GG       L    WLWC+  G+G L+W Q+I  +PT+                    L   K    G   +DE  D+      +  D  + +++  GQILW RGL+R+QTQ    +     R+    G VRR +  LSQ+  ++ ++ A R S Y   E+
Sbjct:   30 QELRSLMELRGSEAIQKIQDSYGDVNGLCRRLKTSPTEGLSENIADFEKRRQIYGVNFIPPKKPKTFLQLVWEALQDVTLIILEIAAIVSLGLSFYAPPGEQSDNCGNVSGGGH-DEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEKQFRGLQSRIEQEQRFSVIRNGQVVQIPVAELIVGDIAQIKYGDLLPADGVLIQGNDLKIDESSLTGESDHVRKSVEKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGGEEEEKKDKKGKQQDGAVETNQNKAKKQDGAVAMEMQPLKSAE------------------GGEMEERE--------KKKASVPKKEKSVLQGKLTKLAVQIGKAGLVMSAITVIILVLYFVIQTFVVDGKVWLTECTPVYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSNIGDIHNKDK-PDPSSINHKILDLLVNAIAINCAYTTKILPPEKEGALPQQVGNKTECALLGFVL-DMQRDYQLVRDQIPEETLYKVYTFNSVRKSMSTIIRLPNGGFRLYSKGASEIVLKKCSNILNSAGDLRAFRARDREEMVKKVIEPMACDGLRTICIAYR--------DFPGVPEPEW--ENENEIVCDLTCIGVVGIEDPVRPEVPEAIRKCQRAGITVRMVTGDNINTARAIAAKCGIIQPGEDFLCLEGKEFNRRIRNE-KGEIEQERLDKIWPKLRVLARSSPTDKHTLVKGIIDSTIGEQRQVVAVTGDGTNDGPALKKADVGFAMGLAGTDVAKEASDIILTDDNFSSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTESLLLRKPYGRNKPLISRTMMKNILGHAVYQLIIIFTLLFAGEIFFDIDSGRNAPLHA--PPSEHYTIIFNTFVMMQLFNEINARKIHGERNVFDGIFSNPIFCSIVLGTFGVQILIVQFGGKPFSCAPLNAQQWLWCLFVGVGELVWGQVIAAVPTS-------------------QLKCLKEAGHG-PGKDEITDEELAEDEEEIDHAERELRR-GQILWFRGLNRIQTQMEVVSTF--KRSGSFQGAVRRRSSVLSQLHDIR-VVKAFRSSLYEGLEK 1158          
BLAST of Calcium-transporting ATPase vs. Ensembl Xenopus
Match: fam149a (family with sequence similarity 149 member A [Source:Xenbase;Acc:XB-GENE-6050471])

HSP 1 Score: 1189.1 bits (3075), Expect = 0.000e+0
Identity = 661/1178 (56.11%), Postives = 815/1178 (69.19%), Query Frame = 3
Query:  588 KELTDLMMLRQQEAILEIKEKYGDVYEICRRLKTSPQSGLIDDEESIGNRRREFGSNIIPPKPPKTFFRLMWEALQDLTLIVLMGAAVISLALALYS----------KFSGSSHGDETEGDAGWIEXXXXXXXXXXXXXXTAFNDWQKERQFRGLQDQIEGNHKIAVIRGGVAKEXXXXXXXXXXXCQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDIDPMMLSGTHVMEGSAKMLVTAVGLNSQAGIIFALLGAANTEEKDKAETEKPNNQVHKTNSNSKNKGCKNVDEEVELMKLTETHPEDADRCSNHKPNNYASGDANKSEIKNGKVKQEKKVRAPKKKGSVLQLKLNKLASSIGQIGTIVASLTVTILIIKFCINTYVFEKEGWSMD----HLKKMINFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYINGQHNRTHLPSFEELSFNAADMLLKNISINSSYTSRLMATRHVNELPSQIGNKTECALLGFVNGSLKRDYADLRTQWPEEKLIKVYTFNSERKSMSTIIE-DEGKLLLLTKGASEMILNKCSFILGKNGKIQPFTTEDVEALVKNVIEPMASDGLRTIGLAYKEFVKKPDHDYQGLYNEKLDLENEHTLIKDLTLIGIVGIEDPVRPEVPPAIKKCQKAGITVRMVTGDNINTARSIAIKCGILKPGEDFLVMEGKEFNNRVRDPISGKIKQELIDQVWPKLRVLARSSPQDKYTLVTGIIDSHLTRSREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFLGACFITDSPLKAVQMLWVNLIMDTLASLALATEMPTEELLDRAPYGRTKPIISRRMIKNIMGQSIYQLAVTFYLLLHGNVLLDVENGRGLTERGINKPTQHFTAIFNTFVMMTLFNEFNSRKIHGQKNVFDGLQRNVLFIIIWVTTFVGQIVIVQYGGYALHTEALELDHWLWCMLFGIGVLLWAQLINCIPTTVIPKHMPWSKKKLPTAENQALNQYKSVDSGNESEDEDYDDIGDLARQNNDEDDDDIKNSGQILWIRGLSRLQTQQNTCNPNLDNRNDVVYGGVRRFT--LSQVGGV 4070
            +EL  LM LR  EAI +I++ YGDV  +CRRLKTSP  GL ++      RR+ +G N IPPK PKTF +L+WEALQD+TLI+L  AA++SL L+ Y+            SG  H DE E +AGWIEG AIL +VI VVLVTAFNDW KE+QFRGLQ +IE   + +VIR G   +I V +++VGDI Q+KYGDLLPADG++IQ ND+K+DESSLTGE DHV+K V+ DPM+LSGTHVMEGS +M+VTAVG+NSQ GIIF LLGA   EE+ K +  K  +   +TN N   K    V  E++ +K  E                   G+  + E        +KK   PKK+ SVLQ KL KLA  IG+ G +++++TV IL++ F I T+V + + W  +    +++  + F IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQS I   HN+   P    ++    D+L+  I+IN +YT++++       LP Q+GNKTECALLGFV   ++RDY  +R Q PEE L KVYTFNS RKSMSTII    G   L +KGASE++L KCS IL   G ++ F   D E +VK VIEPMA DGLRTI +AY+        D+ G+   +   ENE+ ++ DLT IG+VGIEDPVRPEVP AI+KCQ+AGITVRMVTGDNINTAR+IA KCGI++PGEDFL +EGKEFN R+R+   G+I+QE +D++WPKLRVLARSSP DK+TLV GIIDS +   R+VVAVTGDGTNDGPALKKADVGFAMG+AGTDVAKEASDIILTDDNF+SIVKAVMWGRNVYDSI+KFLQFQLTVNVVAVIVAF GAC   DSPLKAVQMLWVNLIMDT ASLALATE PTE LL R PYGR KP+ISR M+KNI+G ++YQL + F LL  G +  D+++GR         P++H+T IFNTFVMM LFNE N+RKIHG++NVFDG+  N +F  I + TF  QI+IVQ+GG       L    WLWC+  G+G L+W Q+I  +PT+                    L   K    G   +DE  D+      +  D  + +++  GQILW RGL+R+QTQ    +     R+    G VRR +  LSQ+  V
Sbjct:   30 QELRSLMELRGSEAIQKIQDSYGDVNGLCRRLKTSPTEGLSENIADFEKRRQIYGVNFIPPKKPKTFLQLVWEALQDVTLIILEIAAIVSLGLSFYAPPGEQSDNCGNVSGGGH-DEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEKQFRGLQSRIEQEQRFSVIRNGQVVQIPVAELIVGDIAQIKYGDLLPADGVLIQGNDLKIDESSLTGESDHVRKSVEKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGGEEEEKKDKKGKQQDGAVETNQNKAKKQDGAVAMEMQPLKSAE------------------GGEMEERE--------KKKASVPKKEKSVLQGKLTKLAVQIGKAGLVMSAITVIILVLYFVIQTFVVDGKVWLTECTPVYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSNIGDIHNKDK-PDPSSINHKILDLLVNAIAINCAYTTKILPPEKEGALPQQVGNKTECALLGFVL-DMQRDYQLVRDQIPEETLYKVYTFNSVRKSMSTIIRLPNGGFRLYSKGASEIVLKKCSNILNSAGDLRAFRARDREEMVKKVIEPMACDGLRTICIAYR--------DFPGVPEPEW--ENENEIVCDLTCIGVVGIEDPVRPEVPEAIRKCQRAGITVRMVTGDNINTARAIAAKCGIIQPGEDFLCLEGKEFNRRIRNE-KGEIEQERLDKIWPKLRVLARSSPTDKHTLVKGIIDSTIGEQRQVVAVTGDGTNDGPALKKADVGFAMGLAGTDVAKEASDIILTDDNFSSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTESLLLRKPYGRNKPLISRTMMKNILGHAVYQLIIIFTLLFAGEIFFDIDSGRNAPLHA--PPSEHYTIIFNTFVMMQLFNEINARKIHGERNVFDGIFSNPIFCSIVLGTFGVQILIVQFGGKPFSCAPLNAQQWLWCLFVGVGELVWGQVIAAVPTS-------------------QLKCLKEAGHG-PGKDEITDEELAEDEEEIDHAERELRR-GQILWFRGLNRIQTQMEVVSTF--KRSGSFQGAVRRRSSVLSQLHDV 1142          
BLAST of Calcium-transporting ATPase vs. Ensembl Xenopus
Match: fam149a (family with sequence similarity 149 member A [Source:Xenbase;Acc:XB-GENE-6050471])

HSP 1 Score: 1188.71 bits (3074), Expect = 0.000e+0
Identity = 657/1173 (56.01%), Postives = 813/1173 (69.31%), Query Frame = 3
Query:  588 KELTDLMMLRQQEAILEIKEKYGDVYEICRRLKTSPQSGLIDDEESIGNRRREFGSNIIPPKPPKTFFRLMWEALQDLTLIVLMGAAVISLALALYS----------KFSGSSHGDETEGDAGWIEXXXXXXXXXXXXXXTAFNDWQKERQFRGLQDQIEGNHKIAVIRGGVAKEXXXXXXXXXXXCQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDIDPMMLSGTHVMEGSAKMLVTAVGLNSQAGIIFALLGAANTEEKDKAETEKPN----NQVHKTNS--NSKNKGCKNVDEEVELMKLTETHPEDADRCSNHKPNNYASGDANKSEIKNGKVKQEKKVRAPKKKGSVLQLKLNKLASSIGQIGTIVASLTVTILIIKFCINTYVFEKEGWSMD----HLKKMINFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYINGQHNRTHLPSFEELSFNAADMLLKNISINSSYTSRLMATRHVNELPSQIGNKTECALLGFVNGSLKRDYADLRTQWPEEKLIKVYTFNSERKSMSTIIE-DEGKLLLLTKGASEMILNKCSFILGKNGKIQPFTTEDVEALVKNVIEPMASDGLRTIGLAYKEFVKKPDHDYQGLYNEKLDLENEHTLIKDLTLIGIVGIEDPVRPEVPPAIKKCQKAGITVRMVTGDNINTARSIAIKCGILKPGEDFLVMEGKEFNNRVRDPISGKIKQELIDQVWPKLRVLARSSPQDKYTLVTGIIDSHLTRSREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFLGACFITDSPLKAVQMLWVNLIMDTLASLALATEMPTEELLDRAPYGRTKPIISRRMIKNIMGQSIYQLAVTFYLLLHGNVLLDVENGRGLTERGINKPTQHFTAIFNTFVMMTLFNEFNSRKIHGQKNVFDGLQRNVLFIIIWVTTFVGQIVIVQYGGYALHTEALELDHWLWCMLFGIGVLLWAQLINCIPTTVIPKHMPWSKKKLPTAENQALNQYKSVDSGNESEDEDYDDIGDLARQNNDEDDDDIKNSGQILWIRGLSRLQTQQNTCNPNLDNRNDVVYGGVRR 4043
            +EL  LM LR  EAI +I++ YGDV  +CRRLKTSP  GL ++      RR+ +G N IPPK PKTF +L+WEALQD+TLI+L  AA++SL L+ Y+            SG  H DE E +AGWIEG AIL +VI VVLVTAFNDW KE+QFRGLQ +IE   + +VIR G   +I V +++VGDI Q+KYGDLLPADG++IQ ND+K+DESSLTGE DHV+K V+ DPM+LSGTHVMEGS +M+VTAVG+NSQ GIIF LLGA   EE+ K +    +    +Q+   N+   S     K  D  VE  +  +   +D       +P   A G   +        +++KK   PKK+ SVLQ KL KLA  IG+ G +++++TV IL++ F I T+V + + W  +    +++  + F IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQS I   HN+   P    ++    D+L+  I+IN +YT++++       LP Q+GNKTECALLGFV   ++RDY  +R Q PEE L KVYTFNS RKSMSTII    G   L +KGASE++L KCS IL   G ++ F   D E +VK VIEPMA DGLRTI +AY+        D+ G+   +   ENE+ ++ DLT IG+VGIEDPVRPEVP AI+KCQ+AGITVRMVTGDNINTAR+IA KCGI++PGEDFL +EGKEFN R+R+   G+I+QE +D++WPKLRVLARSSP DK+TLV GIIDS +   R+VVAVTGDGTNDGPALKKADVGFAMG+AGTDVAKEASDIILTDDNF+SIVKAVMWGRNVYDSI+KFLQFQLTVNVVAVIVAF GAC   DSPLKAVQMLWVNLIMDT ASLALATE PTE LL R PYGR KP+ISR M+KNI+G ++YQL + F LL  G +  D+++GR         P++H+T IFNTFVMM LFNE N+RKIHG++NVFDG+  N +F  I + TF  QI+IVQ+GG       L    WLWC+  G+G L+W Q+I  +PT+                    L   K    G   +DE  D+      +  D  + +++  GQILW RGL+R+QTQ    +     R+    G VRR
Sbjct:   30 QELRSLMELRGSEAIQKIQDSYGDVNGLCRRLKTSPTEGLSENIADFEKRRQIYGVNFIPPKKPKTFLQLVWEALQDVTLIILEIAAIVSLGLSFYAPPGEQSDNCGNVSGGGH-DEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEKQFRGLQSRIEQEQRFSVIRNGQVVQIPVAELIVGDIAQIKYGDLLPADGVLIQGNDLKIDESSLTGESDHVRKSVEKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGGEEEEKKDKKASKSAVNAHQITAANAFLPSGYINGKQQDGAVETNQ-NKAKKQDGAVAMEMQPLKSAEGGEMEE-------REKKKASVPKKEKSVLQGKLTKLAVQIGKAGLVMSAITVIILVLYFVIQTFVVDGKVWLTECTPVYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSNIGDIHNKDK-PDPSSINHKILDLLVNAIAINCAYTTKILPPEKEGALPQQVGNKTECALLGFVL-DMQRDYQLVRDQIPEETLYKVYTFNSVRKSMSTIIRLPNGGFRLYSKGASEIVLKKCSNILNSAGDLRAFRARDREEMVKKVIEPMACDGLRTICIAYR--------DFPGVPEPEW--ENENEIVCDLTCIGVVGIEDPVRPEVPEAIRKCQRAGITVRMVTGDNINTARAIAAKCGIIQPGEDFLCLEGKEFNRRIRNE-KGEIEQERLDKIWPKLRVLARSSPTDKHTLVKGIIDSTIGEQRQVVAVTGDGTNDGPALKKADVGFAMGLAGTDVAKEASDIILTDDNFSSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTESLLLRKPYGRNKPLISRTMMKNILGHAVYQLIIIFTLLFAGEIFFDIDSGRNAPLHA--PPSEHYTIIFNTFVMMQLFNEINARKIHGERNVFDGIFSNPIFCSIVLGTFGVQILIVQFGGKPFSCAPLNAQQWLWCLFVGVGELVWGQVIAAVPTS-------------------QLKCLKEAGHG-PGKDEITDEELAEDEEEIDHAERELRR-GQILWFRGLNRIQTQMEVVSTF--KRSGSFQGAVRR 1155          
BLAST of Calcium-transporting ATPase vs. Ensembl Xenopus
Match: fam149a (family with sequence similarity 149 member A [Source:Xenbase;Acc:XB-GENE-6050471])

HSP 1 Score: 1186.79 bits (3069), Expect = 0.000e+0
Identity = 654/1171 (55.85%), Postives = 813/1171 (69.43%), Query Frame = 3
Query:  588 KELTDLMMLRQQEAILEIKEKYGDVYEICRRLKTSPQSGLIDDEESIGNRRREFGSNIIPPKPPKTFFRLMWEALQDLTLIVLMGAAVISLALALYS--------KFSGSSHGDETEGDAGWIEXXXXXXXXXXXXXXTAFNDWQKERQFRGLQDQIEGNHKIAVIRGGVAKEXXXXXXXXXXXCQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDIDPMMLSGTHVMEGSAKMLVTAVGLNSQAGIIFALLGAANTEEK------DKAETEKPNNQVHKTNSNSKNKGCKNVDEEVELMKLTETHPEDADRCSNHKPNNYASGDANKSEIKNGKVKQEKKVRAPKKKGSVLQLKLNKLASSIGQIGTIVASLTVTILIIKFCINTYVFEKEGWSMD----HLKKMINFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYINGQHNRTHLPSFEELSFNAADMLLKNISINSSYTSRLMATRHVNELPSQIGNKTECALLGFVNGSLKRDYADLRTQWPEEKLIKVYTFNSERKSMSTIIE-DEGKLLLLTKGASEMILNKCSFILGKNGKIQPFTTEDVEALVKNVIEPMASDGLRTIGLAYKEFVKKPDHDYQGLYNEKLDLENEHTLIKDLTLIGIVGIEDPVRPEVPPAIKKCQKAGITVRMVTGDNINTARSIAIKCGILKPGEDFLVMEGKEFNNRVRDPISGKIKQELIDQVWPKLRVLARSSPQDKYTLVTGIIDSHLTRSREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFLGACFITDSPLKAVQMLWVNLIMDTLASLALATEMPTEELLDRAPYGRTKPIISRRMIKNIMGQSIYQLAVTFYLLLHGNVLLDVENGRGLTERGINKPTQHFTAIFNTFVMMTLFNEFNSRKIHGQKNVFDGLQRNVLFIIIWVTTFVGQIVIVQYGGYALHTEALELDHWLWCMLFGIGVLLWAQLINCIPTTVIPKHMPWSKKKLPTAENQALNQYKSVDSGNESEDEDYDDIGDLARQNNDEDDDDIKNSGQILWIRGLSRLQTQQNTCNPNLDNRNDVVYGGVRR 4043
            +EL  LM LR  EAI +I++ YGDV  +CRRLKTSP  GL ++      RR+ +G N IPPK PKTF +L+WEALQD+TLI+L  AA++SL L+ Y+          SG  H DE E +AGWIEG AIL +VI VVLVTAFNDW KE+QFRGLQ +IE   + +VIR G   +I V +++VGDI Q+KYGDLLPADG++IQ ND+K+DESSLTGE DHV+K V+ DPM+LSGTHVMEGS +M+VTAVG+NSQ GIIF LLGA   EE+      +  E +   N++    +  +++     D  VE  +  +   +D       +P   A G   +        +++KK   PKK+ SVLQ KL KLA  IG+ G +++++TV IL++ F I T+V + + W  +    +++  + F IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQS I   HN+   P    ++    D+L+  I+IN +YT++++       LP Q+GNKTECALLGFV   ++RDY  +R Q PEE L KVYTFNS RKSMSTII    G   L +KGASE++L KCS IL   G ++ F   D E +VK VIEPMA DGLRTI +AY+        D+ G+   +   ENE+ ++ DLT IG+VGIEDPVRPEVP AI+KCQ+AGITVRMVTGDNINTAR+IA KCGI++PGEDFL +EGKEFN R+R+   G+I+QE +D++WPKLRVLARSSP DK+TLV GIIDS +   R+VVAVTGDGTNDGPALKKADVGFAMG+AGTDVAKEASDIILTDDNF+SIVKAVMWGRNVYDSI+KFLQFQLTVNVVAVIVAF GAC   DSPLKAVQMLWVNLIMDT ASLALATE PTE LL R PYGR KP+ISR M+KNI+G ++YQL + F LL  G +  D+++GR         P++H+T IFNTFVMM LFNE N+RKIHG++NVFDG+  N +F  I + TF  QI+IVQ+GG       L    WLWC+  G+G L+W Q+I  +PT+                    L   K    G   +DE  D+      +  D  + +++  GQILW RGL+R+QTQ    +     R+    G VRR
Sbjct:   30 QELRSLMELRGSEAIQKIQDSYGDVNGLCRRLKTSPTEGLSENIADFEKRRQIYGVNFIPPKKPKTFLQLVWEALQDVTLIILEIAAIVSLGLSFYAPPGEQNCGNVSGGGH-DEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEKQFRGLQSRIEQEQRFSVIRNGQVVQIPVAELIVGDIAQIKYGDLLPADGVLIQGNDLKIDESSLTGESDHVRKSVEKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGGEEEEKKDKKGNSLEHDSFYNKMSFFFNLFQSQLVPQQDGAVETNQ-NKAKKQDGAVAMEMQPLKSAEGGEMEE-------REKKKASVPKKEKSVLQGKLTKLAVQIGKAGLVMSAITVIILVLYFVIQTFVVDGKVWLTECTPVYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSNIGDIHNKDK-PDPSSINHKILDLLVNAIAINCAYTTKILPPEKEGALPQQVGNKTECALLGFVL-DMQRDYQLVRDQIPEETLYKVYTFNSVRKSMSTIIRLPNGGFRLYSKGASEIVLKKCSNILNSAGDLRAFRARDREEMVKKVIEPMACDGLRTICIAYR--------DFPGVPEPEW--ENENEIVCDLTCIGVVGIEDPVRPEVPEAIRKCQRAGITVRMVTGDNINTARAIAAKCGIIQPGEDFLCLEGKEFNRRIRNE-KGEIEQERLDKIWPKLRVLARSSPTDKHTLVKGIIDSTIGEQRQVVAVTGDGTNDGPALKKADVGFAMGLAGTDVAKEASDIILTDDNFSSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTESLLLRKPYGRNKPLISRTMMKNILGHAVYQLIIIFTLLFAGEIFFDIDSGRNAPLHA--PPSEHYTIIFNTFVMMQLFNEINARKIHGERNVFDGIFSNPIFCSIVLGTFGVQILIVQFGGKPFSCAPLNAQQWLWCLFVGVGELVWGQVIAAVPTS-------------------QLKCLKEAGHG-PGKDEITDEELAEDEEEIDHAERELRR-GQILWFRGLNRIQTQMEVVSTF--KRSGSFQGAVRR 1153          
BLAST of Calcium-transporting ATPase vs. Ensembl Mouse
Match: Atp2b3 (ATPase, Ca++ transporting, plasma membrane 3 [Source:MGI Symbol;Acc:MGI:1347353])

HSP 1 Score: 1211.44 bits (3133), Expect = 0.000e+0
Identity = 670/1200 (55.83%), Postives = 827/1200 (68.92%), Query Frame = 3
Query:  591 ELTDLMMLRQQEAILEIKEKYGDVYEICRRLKTSPQSGLIDDEESIGNRRREFGSNIIPPKPPKTFFRLMWEALQDLTLIVLMGAAVISLALALY------SKFSGSSHG---DETEGDAGWIEXXXXXXXXXXXXXXTAFNDWQKERQFRGLQDQIEGNHKIAVIRGGVAKEXXXXXXXXXXXCQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDIDPMMLSGTHVMEGSAKMLVTAVGLNSQAGIIFALLGAANTEEKDKAETEKPNNQVHKTNSNSKNKGCKNVDEEVELMKLTETHPEDADRCSNHKPNNYASGDANKSEIKNGKVKQEKKVRAPKKKGSVLQLKLNKLASSIGQIGTIVASLTVTILIIKFCINTYVFEKEGWSMD----HLKKMINFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYINGQHNRTHLPSFEELSFNAADMLLKNISINSSYTSRLMATRHVNELPSQIGNKTECALLGFVNGSLKRDYADLRTQWPEEKLIKVYTFNSERKSMSTIIE-DEGKLLLLTKGASEMILNKCSFILGKNGKIQPFTTEDVEALVKNVIEPMASDGLRTIGLAYKEF--VKKPDHDYQGLYNEKLDLENEHTLIKDLTLIGIVGIEDPVRPEVPPAIKKCQKAGITVRMVTGDNINTARSIAIKCGILKPGEDFLVMEGKEFNNRVRDPISGKIKQELIDQVWPKLRVLARSSPQDKYTLVTGIIDSHLTRSREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFLGACFITDSPLKAVQMLWVNLIMDTLASLALATEMPTEELLDRAPYGRTKPIISRRMIKNIMGQSIYQLAVTFYLLLHGNVLLDVENGRGLTERGINKPTQHFTAIFNTFVMMTLFNEFNSRKIHGQKNVFDGLQRNVLFIIIWVTTFVGQIVIVQYGGYALHTEALELDHWLWCMLFGIGVLLWAQLINCIPTTVIPKHMPWSKKKLPTAENQALNQYKSVDSGNESEDEDYDDIGDLARQNNDEDDDDIKNSGQILWIRGLSRLQTQQNTCNPNLDNRNDVVYGGVRRFT--LSQVGGVQPL-------LAARRQSSYSNN 4115
            EL  LM LR  EA+ +I+E YGDV  +CRRLKTSP  GL D+   +  RR+ +G N IPPK PKTF +L+WEALQD+TLI+L  AA++SL L+ Y      S+  G+  G   DE E +AGWIEG AIL +VI VVLVTAFNDW KE+QFRGLQ +IE   K  VIR G   ++ V  +VVGDI QVKYGDLLPADG++IQ ND+K+DESSLTGE DHV+K  D DPM+LSGTHVMEGS +M+VTAVG+NSQ GIIF LLGA   EE+ K +  K  +    ++     K    V  E++ +K  E                   G+  + E        +KK   PKK+ SVLQ KL KLA  IG+ G +++++TV IL++ F I T+V +   W  +    +++  + F IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSY+   H +  +P+   L+    D+L+  ISINS+YT++++       LP Q+GNKTECALLGFV   LKRD+  +R Q PE++L KVYTFNS RKSMST+I   +G   L +KGASE++L KC+ IL  NG+++ F   D + +VK +IEPMA DGLRTI +AY++F  +++PD D            NE+ ++ DLT I +VGIEDPVRPEVP AI+KCQ+AGITVRMVTGDNINTAR+IA KCGI++PGEDFL +EGKEFN R+R+   G+I+QE +D+VWPKLRVLARSSP DK+TLV GIIDS     R+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSI+KFLQFQLTVNVVAVIVAF GAC   DSPLKAVQMLWVNLIMDT ASLALATE PTE LL R PYGR KP+ISR M+KNI+G ++YQL + F LL  G +  D+++GR       + P++H+T IFNTFVMM LFNE N+RKIHG++NVFDG+  N +F  I + TF  QIVIVQ+GG       L  + WLWC+  G+G L+W Q+I  IPT+                    L   K    G   +DE  D+      +  D  + +++  GQILW RGL+R+QTQ    +     R+    G VRR +  LSQ+  V  L       L+A +  S + N
Sbjct:   33 ELRSLMELRGAEALQKIQEAYGDVSGLCRRLKTSPTEGLADNTNDLEKRRQIYGQNFIPPKQPKTFLQLVWEALQDVTLIILEVAAIVSLGLSFYAPPGEESEACGNVSGGAEDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEKQFRGLQSRIEQEQKFTVIRNGQLLQVPVAALVVGDIAQVKYGDLLPADGVLIQGNDLKIDESSLTGESDHVRKSADKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGGEEEEKKDKKGKQQDGAMDSSQTRAKKQDGAVAMEMQPLKSAE------------------GGEMEERE--------KKKANVPKKEKSVLQGKLTKLAVQIGKAGLVMSAITVIILVLYFVIETFVVDGRVWLAECTPVYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYLGDTHYK-EIPAPSALTPKILDLLVHAISINSAYTTKILPPEKEGALPRQVGNKTECALLGFVL-DLKRDFQPVREQIPEDQLYKVYTFNSVRKSMSTVIRMPDGGFRLFSKGASEILLKKCTNILNSNGELRGFRPRDRDDMVKKIIEPMACDGLRTICIAYRDFSAIQEPDWD------------NENEVVGDLTCIAVVGIEDPVRPEVPEAIRKCQRAGITVRMVTGDNINTARAIAAKCGIIQPGEDFLCLEGKEFNRRIRNE-KGEIEQERLDKVWPKLRVLARSSPTDKHTLVKGIIDSTTGEQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTESLLLRKPYGRDKPLISRTMMKNILGHAVYQLTIIFTLLFVGELFFDIDSGRNAPLH--SPPSEHYTIIFNTFVMMQLFNEINARKIHGERNVFDGIFSNPIFCTIVLGTFGIQIVIVQFGGKPFSCSPLSTEQWLWCLFVGVGELVWGQVIATIPTS-------------------QLKCLKEAGHG-PGKDEMTDEELAEGEEEIDHAERELRR-GQILWFRGLNRIQTQMEVVSTF--KRSGSFQGAVRRRSSVLSQLHDVTNLSTPTHVTLSAAKPPSAAGN 1166          
BLAST of Calcium-transporting ATPase vs. Ensembl Mouse
Match: Atp2b3 (ATPase, Ca++ transporting, plasma membrane 3 [Source:MGI Symbol;Acc:MGI:1347353])

HSP 1 Score: 1209.51 bits (3128), Expect = 0.000e+0
Identity = 656/1146 (57.24%), Postives = 806/1146 (70.33%), Query Frame = 3
Query:  591 ELTDLMMLRQQEAILEIKEKYGDVYEICRRLKTSPQSGLIDDEESIGNRRREFGSNIIPPKPPKTFFRLMWEALQDLTLIVLMGAAVISLALALY------SKFSGSSHG---DETEGDAGWIEXXXXXXXXXXXXXXTAFNDWQKERQFRGLQDQIEGNHKIAVIRGGVAKEXXXXXXXXXXXCQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDIDPMMLSGTHVMEGSAKMLVTAVGLNSQAGIIFALLGAANTEEKDKAETEKPNNQVHKTNSNSKNKGCKNVDEEVELMKLTETHPEDADRCSNHKPNNYASGDANKSEIKNGKVKQEKKVRAPKKKGSVLQLKLNKLASSIGQIGTIVASLTVTILIIKFCINTYVFEKEGWSMD----HLKKMINFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYINGQHNRTHLPSFEELSFNAADMLLKNISINSSYTSRLMATRHVNELPSQIGNKTECALLGFVNGSLKRDYADLRTQWPEEKLIKVYTFNSERKSMSTIIE-DEGKLLLLTKGASEMILNKCSFILGKNGKIQPFTTEDVEALVKNVIEPMASDGLRTIGLAYKEF--VKKPDHDYQGLYNEKLDLENEHTLIKDLTLIGIVGIEDPVRPEVPPAIKKCQKAGITVRMVTGDNINTARSIAIKCGILKPGEDFLVMEGKEFNNRVRDPISGKIKQELIDQVWPKLRVLARSSPQDKYTLVTGIIDSHLTRSREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFLGACFITDSPLKAVQMLWVNLIMDTLASLALATEMPTEELLDRAPYGRTKPIISRRMIKNIMGQSIYQLAVTFYLLLHGNVLLDVENGRGLTERGINKPTQHFTAIFNTFVMMTLFNEFNSRKIHGQKNVFDGLQRNVLFIIIWVTTFVGQIVIVQYGGYALHTEALELDHWLWCMLFGIGVLLWAQLINCIPTTVIPKHMPWSKKKLPTAENQALNQYKSVDSGNESEDEDYDDIGDLARQNNDEDDDDIKNSGQILWIRGLSRLQTQ 3980
            EL  LM LR  EA+ +I+E YGDV  +CRRLKTSP  GL D+   +  RR+ +G N IPPK PKTF +L+WEALQD+TLI+L  AA++SL L+ Y      S+  G+  G   DE E +AGWIEG AIL +VI VVLVTAFNDW KE+QFRGLQ +IE   K  VIR G   ++ V  +VVGDI QVKYGDLLPADG++IQ ND+K+DESSLTGE DHV+K  D DPM+LSGTHVMEGS +M+VTAVG+NSQ GIIF LLGA   EE+ K +  K  +    ++     K    V  E++ +K  E                   G+  + E        +KK   PKK+ SVLQ KL KLA  IG+ G +++++TV IL++ F I T+V +   W  +    +++  + F IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSY+   H +  +P+   L+    D+L+  ISINS+YT++++       LP Q+GNKTECALLGFV   LKRD+  +R Q PE++L KVYTFNS RKSMST+I   +G   L +KGASE++L KC+ IL  NG+++ F   D + +VK +IEPMA DGLRTI +AY++F  +++PD D            NE+ ++ DLT I +VGIEDPVRPEVP AI+KCQ+AGITVRMVTGDNINTAR+IA KCGI++PGEDFL +EGKEFN R+R+   G+I+QE +D+VWPKLRVLARSSP DK+TLV GIIDS     R+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSI+KFLQFQLTVNVVAVIVAF GAC   DSPLKAVQMLWVNLIMDT ASLALATE PTE LL R PYGR KP+ISR M+KNI+G ++YQL + F LL  G +  D+++GR       + P++H+T IFNTFVMM LFNE N+RKIHG++NVFDG+  N +F  I + TF  QIVIVQ+GG       L  + WLWC+  G+G L+W Q+I  IPT+                    L   K    G   +DE  D+      +  D  + +++  GQILW RGL+R+QTQ
Sbjct:   33 ELRSLMELRGAEALQKIQEAYGDVSGLCRRLKTSPTEGLADNTNDLEKRRQIYGQNFIPPKQPKTFLQLVWEALQDVTLIILEVAAIVSLGLSFYAPPGEESEACGNVSGGAEDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEKQFRGLQSRIEQEQKFTVIRNGQLLQVPVAALVVGDIAQVKYGDLLPADGVLIQGNDLKIDESSLTGESDHVRKSADKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGGEEEEKKDKKGKQQDGAMDSSQTRAKKQDGAVAMEMQPLKSAE------------------GGEMEERE--------KKKANVPKKEKSVLQGKLTKLAVQIGKAGLVMSAITVIILVLYFVIETFVVDGRVWLAECTPVYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYLGDTHYK-EIPAPSALTPKILDLLVHAISINSAYTTKILPPEKEGALPRQVGNKTECALLGFVL-DLKRDFQPVREQIPEDQLYKVYTFNSVRKSMSTVIRMPDGGFRLFSKGASEILLKKCTNILNSNGELRGFRPRDRDDMVKKIIEPMACDGLRTICIAYRDFSAIQEPDWD------------NENEVVGDLTCIAVVGIEDPVRPEVPEAIRKCQRAGITVRMVTGDNINTARAIAAKCGIIQPGEDFLCLEGKEFNRRIRNE-KGEIEQERLDKVWPKLRVLARSSPTDKHTLVKGIIDSTTGEQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTESLLLRKPYGRDKPLISRTMMKNILGHAVYQLTIIFTLLFVGELFFDIDSGRNAPLH--SPPSEHYTIIFNTFVMMQLFNEINARKIHGERNVFDGIFSNPIFCTIVLGTFGIQIVIVQFGGKPFSCSPLSTEQWLWCLFVGVGELVWGQVIATIPTS-------------------QLKCLKEAGHG-PGKDEMTDEELAEGEEEIDHAERELRR-GQILWFRGLNRIQTQ 1114          
BLAST of Calcium-transporting ATPase vs. Ensembl Mouse
Match: Atp2b3 (ATPase, Ca++ transporting, plasma membrane 3 [Source:MGI Symbol;Acc:MGI:1347353])

HSP 1 Score: 1208.36 bits (3125), Expect = 0.000e+0
Identity = 658/1158 (56.82%), Postives = 809/1158 (69.86%), Query Frame = 3
Query:  591 ELTDLMMLRQQEAILEIKEKYGDVYEICRRLKTSPQSGLIDDEESIGNRRREFGSNIIPPKPPKTFFRLMWEALQDLTLIVLMGAAVISLALALY------SKFSGSSHG---DETEGDAGWIEXXXXXXXXXXXXXXTAFNDWQKERQFRGLQDQIEGNHKIAVIRGGVAKEXXXXXXXXXXXCQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDIDPMMLSGTHVMEGSAKMLVTAVGLNSQAGIIFALLGAANTEEKDKAETEKPNNQVHKTNSNSKNKGCKNVDEEVELMKLTETHPEDADRCSNHKPNNYASGDANKSEIKNGKVKQEKKVRAPKKKGSVLQLKLNKLASSIGQIGTIVASLTVTILIIKFCINTYVFEKEGWSMD----HLKKMINFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYINGQHNRTHLPSFEELSFNAADMLLKNISINSSYTSRLMATRHVNELPSQIGNKTECALLGFVNGSLKRDYADLRTQWPEEKLIKVYTFNSERKSMSTIIE-DEGKLLLLTKGASEMILNKCSFILGKNGKIQPFTTEDVEALVKNVIEPMASDGLRTIGLAYKEF--VKKPDHDYQGLYNEKLDLENEHTLIKDLTLIGIVGIEDPVRPEVPPAIKKCQKAGITVRMVTGDNINTARSIAIKCGILKPGEDFLVMEGKEFNNRVRDPISGKIKQELIDQVWPKLRVLARSSPQDKYTLVTGIIDSHLTRSREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFLGACFITDSPLKAVQMLWVNLIMDTLASLALATEMPTEELLDRAPYGRTKPIISRRMIKNIMGQSIYQLAVTFYLLLHGNVLLDVENGRGLTERGINKPTQHFTAIFNTFVMMTLFNEFNSRKIHGQKNVFDGLQRNVLFIIIWVTTFVGQIVIVQYGGYALHTEALELDHWLWCMLFGIGVLLWAQLINCIPTTVIPKHMPWSKKKLPTAENQALNQYKSVDSGNESEDEDYDDIGDLARQNNDEDDDDIKNSGQILWIRGLSRLQTQ-----QNTCNPN 4001
            EL  LM LR  EA+ +I+E YGDV  +CRRLKTSP  GL D+   +  RR+ +G N IPPK PKTF +L+WEALQD+TLI+L  AA++SL L+ Y      S+  G+  G   DE E +AGWIEG AIL +VI VVLVTAFNDW KE+QFRGLQ +IE   K  VIR G   ++ V  +VVGDI QVKYGDLLPADG++IQ ND+K+DESSLTGE DHV+K  D DPM+LSGTHVMEGS +M+VTAVG+NSQ GIIF LLGA   EE+ K +  K  +    ++     K    V  E++ +K  E                   G+  + E        +KK   PKK+ SVLQ KL KLA  IG+ G +++++TV IL++ F I T+V +   W  +    +++  + F IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSY+   H +  +P+   L+    D+L+  ISINS+YT++++       LP Q+GNKTECALLGFV   LKRD+  +R Q PE++L KVYTFNS RKSMST+I   +G   L +KGASE++L KC+ IL  NG+++ F   D + +VK +IEPMA DGLRTI +AY++F  +++PD D            NE+ ++ DLT I +VGIEDPVRPEVP AI+KCQ+AGITVRMVTGDNINTAR+IA KCGI++PGEDFL +EGKEFN R+R+   G+I+QE +D+VWPKLRVLARSSP DK+TLV GIIDS     R+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSI+KFLQFQLTVNVVAVIVAF GAC   DSPLKAVQMLWVNLIMDT ASLALATE PTE LL R PYGR KP+ISR M+KNI+G ++YQL + F LL  G +  D+++GR       + P++H+T IFNTFVMM LFNE N+RKIHG++NVFDG+  N +F  I + TF  QIVIVQ+GG       L  + WLWC+  G+G L+W Q+I  IPT+                    L   K    G   +DE  D+      +  D  + +++  GQILW RGL+R+QTQ       +C P 
Sbjct:   33 ELRSLMELRGAEALQKIQEAYGDVSGLCRRLKTSPTEGLADNTNDLEKRRQIYGQNFIPPKQPKTFLQLVWEALQDVTLIILEVAAIVSLGLSFYAPPGEESEACGNVSGGAEDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEKQFRGLQSRIEQEQKFTVIRNGQLLQVPVAALVVGDIAQVKYGDLLPADGVLIQGNDLKIDESSLTGESDHVRKSADKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGGEEEEKKDKKGKQQDGAMDSSQTRAKKQDGAVAMEMQPLKSAE------------------GGEMEERE--------KKKANVPKKEKSVLQGKLTKLAVQIGKAGLVMSAITVIILVLYFVIETFVVDGRVWLAECTPVYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYLGDTHYK-EIPAPSALTPKILDLLVHAISINSAYTTKILPPEKEGALPRQVGNKTECALLGFVL-DLKRDFQPVREQIPEDQLYKVYTFNSVRKSMSTVIRMPDGGFRLFSKGASEILLKKCTNILNSNGELRGFRPRDRDDMVKKIIEPMACDGLRTICIAYRDFSAIQEPDWD------------NENEVVGDLTCIAVVGIEDPVRPEVPEAIRKCQRAGITVRMVTGDNINTARAIAAKCGIIQPGEDFLCLEGKEFNRRIRNE-KGEIEQERLDKVWPKLRVLARSSPTDKHTLVKGIIDSTTGEQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTESLLLRKPYGRDKPLISRTMMKNILGHAVYQLTIIFTLLFVGELFFDIDSGRNAPLH--SPPSEHYTIIFNTFVMMQLFNEINARKIHGERNVFDGIFSNPIFCTIVLGTFGIQIVIVQFGGKPFSCSPLSTEQWLWCLFVGVGELVWGQVIATIPTS-------------------QLKCLKEAGHG-PGKDEMTDEELAEGEEEIDHAERELRR-GQILWFRGLNRIQTQATGPISGSCEPQ 1126          
BLAST of Calcium-transporting ATPase vs. Ensembl Mouse
Match: Atp2b2 (ATPase, Ca++ transporting, plasma membrane 2 [Source:MGI Symbol;Acc:MGI:105368])

HSP 1 Score: 1177.54 bits (3045), Expect = 0.000e+0
Identity = 657/1200 (54.75%), Postives = 812/1200 (67.67%), Query Frame = 3
Query:  573 YEMNTKELTDLMMLRQQEAILEIKEKYGDVYEICRRLKTSPQSGLIDDEESIGNRRREFGSNIIPPKPPKTFFRLMWEALQDLTLIVLMGAAVISLALALYSKFSGSSHG---------DETEGDAGWIEXXXXXXXXXXXXXXTAFNDWQKERQFRGLQDQIEGNHKIAVIRGGVAKEXXXXXXXXXXXCQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDIDPMMLSGTHVMEGSAKMLVTAVGLNSQAGIIFALLGAANTEEKDKAETEKPNNQVHKTNSNSKNKGCKNVDEEVELMKLTETHPEDADRCSNHKPNNYASGDANKSEIKNGKVKQEKKVRAPKKKGSVLQLKLNKLASSIGQIGTIVASLTVTILIIKFCINTYVFEKEGWSMD----HLKKMINFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYINGQHNRTHLPSFEELSFNAADMLLKNISINSSYTSRLMATRHVNELPSQIGNKTECALLGFVNGSLKRDYADLRTQWPEEKLIKVYTFNSERKSMSTIIE--DEGKLLLLTKGASEMILNKCSFILGKNGKIQPFTTEDVEALVKNVIEPMASDGLRTIGLAYKEFVKKPDHDYQGLYNEKLDLENEHTLIKDLTLIGIVGIEDPVRPEVPPAIKKCQKAGITVRMVTGDNINTARSIAIKCGILKPGEDFLVMEGKEFNNRVRDPISGKIKQELIDQVWPKLRVLARSSPQDKYTLVTGIIDSHLTRSREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFLGACFITDSPLKAVQMLWVNLIMDTLASLALATEMPTEELLDRAPYGRTKPIISRRMIKNIMGQSIYQLAVTFYLLLHGNVLLDVENGRGLTERGINKPTQHFTAIFNTFVMMTLFNEFNSRKIHGQKNVFDGLQRNVLFIIIWVTTFVGQIVIVQYGGYALHTEALELDHWLWCMLFGIGVLLWAQLINCIPTTVIPKHMPWSKKKLPTAENQALNQYKSVDSGNESEDEDYDDIGDLARQNNDEDDDDIKNSGQILWIRGLSRLQTQQNTCNPNLDNRNDVVYGGVRRFTLSQVGGVQPLLAARRQSSYSNNEQNI 4127
            +    +EL  LM LR  EA+++IKE YGD   ICRRLKTSP  GL      +  R++ FG N IPPK PKTF +L+WEALQD+TLI+L  AA+ISL L+ Y     S+ G         DE E +AGWIEG AIL +VI VVLVTAFNDW KE+QFRGLQ +IE   K  V+R G   +I V +IVVGDI Q+KYGDLLPADG+ IQ ND+K+DESSLTGE D V+K VD DPM+LSGTHVMEGS +M+VTAVG+NSQ GIIF LLGA   EE+ K                                   +   +D       +P   A G         G    +KK    KK+ SVLQ KL KLA  IG+ G +++++TV IL++ F ++T+V  K+ W  +    +++  + F IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQ+Y+   H +  +P    ++    ++L+  I+INS+YT++++       LP Q+GNKTEC LLGFV   L++DY  +R+Q PEEKL KVYTFNS RKSMST+I+  DE    + +KGASE++L KC  IL   G+ + F   D + +VK VIEPMA DGLRTI +AY++F   P+ D+          +NE+ ++ +LT I +VGIEDPVRPEVP AI+KCQ+AGITVRMVTGDNINTAR+IAIKCGI+ PGEDFL +EGKEFN R+R+   G+I+QE ID++WPKLRVLARSSP DK+TLV GIIDS  T  R+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNF+SIVKAVMWGRNVYDSI+KFLQFQLTVNVVAVIVAF GAC   DSPLKAVQMLWVNLIMDT ASLALATE PTE LL R PYGR KP+ISR M+KNI+G ++YQL + F LL  G  +  +++GR       + P++H+T IFNTFVMM LFNE N+RKIHG++NVFDG+ RN +F  I + TF  QIVIVQ+GG       L+LD W+WC+  G+G L+W Q+I  IPT+ + K +  + +     E       + V+  + +E E       L R             GQILW RGL+R+QTQ    N     ++   + G                A RRQSS ++  Q++
Sbjct:   24 FGCTMEELRSLMELRGTEAVVKIKETYGDTEAICRRLKTSPVEGLPGTAPDLEKRKQIFGQNFIPPKKPKTFLQLVWEALQDVTLIILEIAAIISLGLSFYHPPGESNEGCATAQGGAEDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEKQFRGLQSRIEQEQKFTVVRAGQVVQIPVAEIVVGDIAQIKYGDLLPADGLFIQGNDLKIDESSLTGESDQVRKSVDKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGGEEEEKKD---------------------------------KKAKQQDGAAAMEMQPLKSAEG---------GDADDKKKANMHKKEKSVLQGKLTKLAVQIGKAGLVMSAITVIILVLYFTVDTFVVNKKPWLTECTPVYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAYVGDVHYK-EIPDPSSINAKTLELLVNAIAINSAYTTKILPPEKEGALPRQVGNKTECGLLGFVL-DLRQDYEPVRSQMPEEKLYKVYTFNSVRKSMSTVIKMPDE-SFRMYSKGASEIVLKKCCKILSGAGEARVFRPRDRDEMVKKVIEPMACDGLRTICVAYRDFPSSPEPDW----------DNENDILNELTCICVVGIEDPVRPEVPEAIRKCQRAGITVRMVTGDNINTARAIAIKCGIIHPGEDFLCLEGKEFNRRIRNE-KGEIEQERIDKIWPKLRVLARSSPTDKHTLVKGIIDSTHTEQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTETLLLRKPYGRNKPLISRTMMKNILGHAVYQLTLIFTLLFVGEKMFQIDSGRNAPLH--SPPSEHYTIIFNTFVMMQLFNEINARKIHGERNVFDGIFRNPIFCTIVLGTFAIQIVIVQFGGKPFSCSPLQLDQWMWCIFIGLGELVWGQVIATIPTSRL-KFLKEAGRLTQKEEIPEEELNEDVEEIDHAERE-------LRR-------------GQILWFRGLNRIQTQIEVVN---TFKSGASFQG----------------ALRRQSSVTSQSQDV 1125          
BLAST of Calcium-transporting ATPase vs. Ensembl Mouse
Match: Atp2b2 (ATPase, Ca++ transporting, plasma membrane 2 [Source:MGI Symbol;Acc:MGI:105368])

HSP 1 Score: 1176.77 bits (3043), Expect = 0.000e+0
Identity = 647/1149 (56.31%), Postives = 800/1149 (69.63%), Query Frame = 3
Query:  588 KELTDLMMLRQQEAILEIKEKYGDVYEICRRLKTSPQSGLIDDEESIGNRRREFGSNIIPPKPPKTFFRLMWEALQDLTLIVLMGAAVISLALALYSKFSGSSHG---------DETEGDAGWIEXXXXXXXXXXXXXXTAFNDWQKERQFRGLQDQIEGNHKIAVIRGGVAKEXXXXXXXXXXXCQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDIDPMMLSGTHVMEGSAKMLVTAVGLNSQAGIIFALLGAANTEEKDKAETEKPNNQVHKTNSNSKNKGCKNVDEEVELMKLTETHPEDADRCSNHKPNNYASGDANKSEIKN---GKVKQEKKVRAPKKKGSVLQLKLNKLASSIGQIGTIVASLTVTILIIKFCINTYVFEKEGWSMD----HLKKMINFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYINGQHNRTHLPSFEELSFNAADMLLKNISINSSYTSRLMATRHVNELPSQIGNKTECALLGFVNGSLKRDYADLRTQWPEEKLIKVYTFNSERKSMSTIIE--DEGKLLLLTKGASEMILNKCSFILGKNGKIQPFTTEDVEALVKNVIEPMASDGLRTIGLAYKEFVKKPDHDYQGLYNEKLDLENEHTLIKDLTLIGIVGIEDPVRPEVPPAIKKCQKAGITVRMVTGDNINTARSIAIKCGILKPGEDFLVMEGKEFNNRVRDPISGKIKQELIDQVWPKLRVLARSSPQDKYTLVTGIIDSHLTRSREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFLGACFITDSPLKAVQMLWVNLIMDTLASLALATEMPTEELLDRAPYGRTKPIISRRMIKNIMGQSIYQLAVTFYLLLHGNVLLDVENGRGLTERGINKPTQHFTAIFNTFVMMTLFNEFNSRKIHGQKNVFDGLQRNVLFIIIWVTTFVGQIVIVQYGGYALHTEALELDHWLWCMLFGIGVLLWAQLINCIPTTVIPKHMPWSKKKLPTAENQALNQYKSVDSGNESEDEDYDDIGDLARQNNDEDDDDIKNSGQILWIRGLSRLQTQ 3980
            +EL  LM LR  EA+++IKE YGD   ICRRLKTSP  GL      +  R++ FG N IPPK PKTF +L+WEALQD+TLI+L  AA+ISL L+ Y     S+ G         DE E +AGWIEG AIL +VI VVLVTAFNDW KE+QFRGLQ +IE   K  V+R G   +I V +IVVGDI Q+KYGDLLPADG+ IQ ND+K+DESSLTGE D V+K VD DPM+LSGTHVMEGS +M+VTAVG+NSQ GIIF LLGA   EE+ K +         +  +                +   +     AD   +       +       +K+   G    +KK    KK+ SVLQ KL KLA  IG+ G +++++TV IL++ F ++T+V  K+ W  +    +++  + F IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQ+Y+   H +  +P    ++    ++L+  I+INS+YT++++       LP Q+GNKTEC LLGFV   L++DY  +R+Q PEEKL KVYTFNS RKSMST+I+  DE    + +KGASE++L KC  IL   G+ + F   D + +VK VIEPMA DGLRTI +AY++F   P+ D+          +NE+ ++ +LT I +VGIEDPVRPEVP AI+KCQ+AGITVRMVTGDNINTAR+IAIKCGI+ PGEDFL +EGKEFN R+R+   G+I+QE ID++WPKLRVLARSSP DK+TLV GIIDS  T  R+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNF+SIVKAVMWGRNVYDSI+KFLQFQLTVNVVAVIVAF GAC   DSPLKAVQMLWVNLIMDT ASLALATE PTE LL R PYGR KP+ISR M+KNI+G ++YQL + F LL  G  +  +++GR       + P++H+T IFNTFVMM LFNE N+RKIHG++NVFDG+ RN +F  I + TF  QIVIVQ+GG       L+LD W+WC+  G+G L+W Q+I  IPT+ + K +  + +     E       + V+  + +E E       L R             GQILW RGL+R+QTQ
Sbjct:   29 EELRSLMELRGTEAVVKIKETYGDTEAICRRLKTSPVEGLPGTAPDLEKRKQIFGQNFIPPKKPKTFLQLVWEALQDVTLIILEIAAIISLGLSFYHPPGESNEGCATAQGGAEDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEKQFRGLQSRIEQEQKFTVVRAGQVVQIPVAEIVVGDIAQIKYGDLLPADGLFIQGNDLKIDESSLTGESDQVRKSVDKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGGEEEEKKDKKGVKKGDGLQIPAADGAAPANAAGSANASLVNGKMQDGSADSSQSKAKQQDGAAAMEMQPLKSAEGGDADDKKKANMHKKEKSVLQGKLTKLAVQIGKAGLVMSAITVIILVLYFTVDTFVVNKKPWLTECTPVYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAYVGDVHYK-EIPDPSSINAKTLELLVNAIAINSAYTTKILPPEKEGALPRQVGNKTECGLLGFVL-DLRQDYEPVRSQMPEEKLYKVYTFNSVRKSMSTVIKMPDES-FRMYSKGASEIVLKKCCKILSGAGEARVFRPRDRDEMVKKVIEPMACDGLRTICVAYRDFPSSPEPDW----------DNENDILNELTCICVVGIEDPVRPEVPEAIRKCQRAGITVRMVTGDNINTARAIAIKCGIIHPGEDFLCLEGKEFNRRIRNE-KGEIEQERIDKIWPKLRVLARSSPTDKHTLVKGIIDSTHTEQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTETLLLRKPYGRNKPLISRTMMKNILGHAVYQLTLIFTLLFVGEKMFQIDSGRNAPLH--SPPSEHYTIIFNTFVMMQLFNEINARKIHGERNVFDGIFRNPIFCTIVLGTFAIQIVIVQFGGKPFSCSPLQLDQWMWCIFIGLGELVWGQVIATIPTSRL-KFLKEAGRLTQKEEIPEEELNEDVEEIDHAERE-------LRR-------------GQILWFRGLNRIQTQ 1140          
BLAST of Calcium-transporting ATPase vs. UniProt/SwissProt
Match: sp|Q16720|AT2B3_HUMAN (Plasma membrane calcium-transporting ATPase 3 OS=Homo sapiens OX=9606 GN=ATP2B3 PE=1 SV=3)

HSP 1 Score: 1214.52 bits (3141), Expect = 0.000e+0
Identity = 657/1144 (57.43%), Postives = 808/1144 (70.63%), Query Frame = 3
Query:  591 ELTDLMMLRQQEAILEIKEKYGDVYEICRRLKTSPQSGLIDDEESIGNRRREFGSNIIPPKPPKTFFRLMWEALQDLTLIVLMGAAVISLALALY------SKFSGSSHG---DETEGDAGWIEXXXXXXXXXXXXXXTAFNDWQKERQFRGLQDQIEGNHKIAVIRGGVAKEXXXXXXXXXXXCQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDIDPMMLSGTHVMEGSAKMLVTAVGLNSQAGIIFALLGAANTEEKDKAETEKPNNQVHKTNSNSKNKGCKNVDEEVELMKLTETHPEDADRCSNHKPNNYASGDANKSEIKNGKVKQEKKVRAPKKKGSVLQLKLNKLASSIGQIGTIVASLTVTILIIKFCINTYVFEKEGWSMD----HLKKMINFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYINGQHNRTHLPSFEELSFNAADMLLKNISINSSYTSRLMATRHVNELPSQIGNKTECALLGFVNGSLKRDYADLRTQWPEEKLIKVYTFNSERKSMSTIIE-DEGKLLLLTKGASEMILNKCSFILGKNGKIQPFTTEDVEALVKNVIEPMASDGLRTIGLAYKEFVKKPDHDYQGLYNEKLDLENEHTLIKDLTLIGIVGIEDPVRPEVPPAIKKCQKAGITVRMVTGDNINTARSIAIKCGILKPGEDFLVMEGKEFNNRVRDPISGKIKQELIDQVWPKLRVLARSSPQDKYTLVTGIIDSHLTRSREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFLGACFITDSPLKAVQMLWVNLIMDTLASLALATEMPTEELLDRAPYGRTKPIISRRMIKNIMGQSIYQLAVTFYLLLHGNVLLDVENGRGLTERGINKPTQHFTAIFNTFVMMTLFNEFNSRKIHGQKNVFDGLQRNVLFIIIWVTTFVGQIVIVQYGGYALHTEALELDHWLWCMLFGIGVLLWAQLINCIPTTVIPKHMPWSKKKLPTAENQALNQYKSVDSGNESEDEDYDDIGDLARQNNDEDDDDIKNSGQILWIRGLSRLQTQ 3980
            EL  LM LR  EA+ +I+E YGDV  +CRRLKTSP  GL D+   +  RR+ +G N IPPK PKTF +L+WEALQD+TLI+L  AA++SL L+ Y      S+  G+  G   DE E +AGWIEG AIL +VI VVLVTAFNDW KE+QFRGLQ +IE   K  VIR G   ++ V  +VVGDI QVKYGDLLPADG++IQ+ND+K+DESSLTGE DHV+K  D DPM+LSGTHVMEGS +M+VTAVG+NSQ GIIF LLGA   EE+ K +  K  +   +++     K    V  E++ +K  E                   G+  + E        +KK  APKK+ SVLQ KL KLA  IG+ G +++++TV IL++ F I T+V E   W  +    +++  + F IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSY+   H +  +P+   L+    D+L+  ISINS+YT++++       LP Q+GNKTECALLGFV   LKRD+  +R Q PE+KL KVYTFNS RKSMST+I   +G   L +KGASE++L KC+ IL  NG+++ F   D + +V+ +IEPMA DGLRTI +AY++F    + D+          +NE+ ++ DLT I +VGIEDPVRPEVP AI+KCQ+AGITVRMVTGDNINTAR+IA KCGI++PGEDFL +EGKEFN R+R+   G+I+QE +D+VWPKLRVLARSSP DK+TLV GIIDS     R+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSI+KFLQFQLTVNVVAVIVAF GAC   DSPLKAVQMLWVNLIMDT ASLALATE PTE LL R PYGR KP+ISR M+KNI+G ++YQLA+ F LL  G +  D+++GR       + P++H+T IFNTFVMM LFNE N+RKIHG++NVFDG+  N +F  I + TF  QIVIVQ+GG       L  + WLWC+  G+G L+W Q+I  IPT+                    L   K    G   +DE  D+      +  D  + +++  GQILW RGL+R+QTQ
Sbjct:   33 ELRTLMELRGAEALQKIEEAYGDVSGLCRRLKTSPTEGLADNTNDLEKRRQIYGQNFIPPKQPKTFLQLVWEALQDVTLIILEVAAIVSLGLSFYAPPGEESEACGNVSGGAEDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEKQFRGLQSRIEQEQKFTVIRNGQLLQVPVAALVVGDIAQVKYGDLLPADGVLIQANDLKIDESSLTGESDHVRKSADKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGGEEEEKKDKKGKQQDGAMESSQTKAKKQDGAVAMEMQPLKSAE------------------GGEMEERE--------KKKANAPKKEKSVLQGKLTKLAVQIGKAGLVMSAITVIILVLYFVIETFVVEGRTWLAECTPVYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYLGDTHYK-EIPAPSALTPKILDLLVHAISINSAYTTKILPPEKEGALPRQVGNKTECALLGFVL-DLKRDFQPVREQIPEDKLYKVYTFNSVRKSMSTVIRMPDGGFRLFSKGASEILLKKCTNILNSNGELRGFRPRDRDDMVRKIIEPMACDGLRTICIAYRDFSAGQEPDW----------DNENEVVGDLTCIAVVGIEDPVRPEVPEAIRKCQRAGITVRMVTGDNINTARAIAAKCGIIQPGEDFLCLEGKEFNRRIRNE-KGEIEQERLDKVWPKLRVLARSSPTDKHTLVKGIIDSTTGEQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTESLLLRKPYGRDKPLISRTMMKNILGHAVYQLAIIFTLLFVGELFFDIDSGRNAPLH--SPPSEHYTIIFNTFVMMQLFNEINARKIHGERNVFDGIFSNPIFCTIVLGTFGIQIVIVQFGGKPFSCSPLSTEQWLWCLFVGVGELVWGQVIATIPTS-------------------QLKCLKEAGHG-PGKDEMTDEELAEGEEEIDHAERELRR-GQILWFRGLNRIQTQ 1114          
BLAST of Calcium-transporting ATPase vs. UniProt/SwissProt
Match: sp|Q64568|AT2B3_RAT (Plasma membrane calcium-transporting ATPase 3 OS=Rattus norvegicus OX=10116 GN=Atp2b3 PE=1 SV=2)

HSP 1 Score: 1211.82 bits (3134), Expect = 0.000e+0
Identity = 665/1181 (56.31%), Postives = 821/1181 (69.52%), Query Frame = 3
Query:  591 ELTDLMMLRQQEAILEIKEKYGDVYEICRRLKTSPQSGLIDDEESIGNRRREFGSNIIPPKPPKTFFRLMWEALQDLTLIVLMGAAVISLALALY------SKFSGSSHG---DETEGDAGWIEXXXXXXXXXXXXXXTAFNDWQKERQFRGLQDQIEGNHKIAVIRGGVAKEXXXXXXXXXXXCQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDIDPMMLSGTHVMEGSAKMLVTAVGLNSQAGIIFALLGAANTEEKDKAETEKPNNQVHKTNSNSKNKGCKNVDEEVELMKLTETHPEDADRCSNHKPNNYASGDANKSEIKNGKVKQEKKVRAPKKKGSVLQLKLNKLASSIGQIGTIVASLTVTILIIKFCINTYVFEKEGWSMD----HLKKMINFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYINGQHNRTHLPSFEELSFNAADMLLKNISINSSYTSRLMATRHVNELPSQIGNKTECALLGFVNGSLKRDYADLRTQWPEEKLIKVYTFNSERKSMSTIIE-DEGKLLLLTKGASEMILNKCSFILGKNGKIQPFTTEDVEALVKNVIEPMASDGLRTIGLAYKEF--VKKPDHDYQGLYNEKLDLENEHTLIKDLTLIGIVGIEDPVRPEVPPAIKKCQKAGITVRMVTGDNINTARSIAIKCGILKPGEDFLVMEGKEFNNRVRDPISGKIKQELIDQVWPKLRVLARSSPQDKYTLVTGIIDSHLTRSREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFLGACFITDSPLKAVQMLWVNLIMDTLASLALATEMPTEELLDRAPYGRTKPIISRRMIKNIMGQSIYQLAVTFYLLLHGNVLLDVENGRGLTERGINKPTQHFTAIFNTFVMMTLFNEFNSRKIHGQKNVFDGLQRNVLFIIIWVTTFVGQIVIVQYGGYALHTEALELDHWLWCMLFGIGVLLWAQLINCIPTTVIPKHMPWSKKKLPTAENQALNQYKSVDSGNESEDEDYDDIGDLARQNNDEDDDDIKNSGQILWIRGLSRLQTQQNTCNPNLDNRNDVVYGGVRRFT--LSQVGGVQPL 4079
            EL  LM LR  EA+ +I+E YGDV  +CRRLKTSP  GL D+   +  RR+ +G N IPPK PKTF +L+WEALQD+TLI+L  AA++SL L+ Y      S+  G+  G   DE E +AGWIEG AIL +VI VVLVTAFNDW KE+QFRGLQ +IE   K  VIR G   ++ V  +VVGDI QVKYGDLLPADG++IQ ND+K+DESSLTGE DHV+K  D DPM+LSGTHVMEGS +M+VTAVG+NSQ GIIF LLGA   EE+ K +  K  +   +++     K    V  E++ +K  E                   G+  + E        +KK   PKK+ SVLQ KL KLA  IG+ G +++++TV IL++ F I T+V +   W  +    +++  + F IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSY+   H +  +P+   L+    D+L+  ISINS+YT++++       LP Q+GNKTECALLGF+   LKRD+  +R Q PE++L KVYTFNS RKSMST+I   +G   L +KGASE++L KC+ IL  NG+++ F   D + +VK +IEPMA DGLRTI +AY++F  +++PD D            NE+ ++ DLT I +VGIEDPVRPEVP AI+KCQ+AGITVRMVTGDNINTAR+IA KCGI++PGEDFL +EGKEFN R+R+   G+I+QE +D+VWPKLRVLARSSP DK+TLV GIIDS     R+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSI+KFLQFQLTVNVVAVIVAF GAC   DSPLKAVQMLWVNLIMDT ASLALATE PTE LL R PYGR KP+ISR M+KNI+G ++YQL + F LL  G +  D+++GR       + P++H+T IFNTFVMM LFNE N+RKIHG++NVFDG+  N +F  I + TF  QIVIVQ+GG       L  + WLWC+  G+G L+W Q+I  IPT+                    L   K    G   +DE  D+      +  D  + +++  GQILW RGL+R+QTQ    +     R+    G VRR +  LSQ+  V  L
Sbjct:   33 ELRSLMELRGAEALQKIQEAYGDVSGLCRRLKTSPTEGLADNTNDLEKRRQIYGQNFIPPKQPKTFLQLVWEALQDVTLIILEVAAIVSLGLSFYAPPGEESEACGNVSGGAEDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEKQFRGLQSRIEQEQKFTVIRNGQLLQVPVAALVVGDIAQVKYGDLLPADGVLIQGNDLKIDESSLTGESDHVRKSADKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGGEEEEKKDKKGKQQDGAMESSQTKAKKQDGAVAMEMQPLKSAE------------------GGEMEERE--------KKKANVPKKEKSVLQGKLTKLAVQIGKAGLVMSAITVIILVLYFVIETFVVDGRVWLAECTPVYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYLGDTHYK-EIPAPSALTPKILDLLVHAISINSAYTTKILPPEKEGALPRQVGNKTECALLGFIL-DLKRDFQPVREQIPEDQLYKVYTFNSVRKSMSTVIRMPDGGFRLFSKGASEILLKKCTNILNSNGELRGFRPRDRDDMVKKIIEPMACDGLRTICIAYRDFSAIQEPDWD------------NENEVVGDLTCIAVVGIEDPVRPEVPEAIRKCQRAGITVRMVTGDNINTARAIAAKCGIIQPGEDFLCLEGKEFNRRIRNE-KGEIEQERLDKVWPKLRVLARSSPTDKHTLVKGIIDSTTGEQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTESLLLRKPYGRDKPLISRTMMKNILGHAVYQLTIIFTLLFVGELFFDIDSGRNAPLH--SPPSEHYTIIFNTFVMMQLFNEINARKIHGERNVFDGIFSNPIFCTIVLGTFGIQIVIVQFGGKPFSCSPLSTEQWLWCLFVGVGELVWGQVIATIPTS-------------------QLKCLKEAGHG-PGKDEMTDEELAEGEEEIDHAERELRR-GQILWFRGLNRIQTQMEVVSTF--KRSGSFQGAVRRRSSVLSQLHDVTNL 1147          
BLAST of Calcium-transporting ATPase vs. UniProt/SwissProt
Match: sp|Q64542|AT2B4_RAT (Plasma membrane calcium-transporting ATPase 4 OS=Rattus norvegicus OX=10116 GN=Atp2b4 PE=1 SV=1)

HSP 1 Score: 1189.48 bits (3076), Expect = 0.000e+0
Identity = 662/1211 (54.67%), Postives = 834/1211 (68.87%), Query Frame = 3
Query:  567 ETYE----MNTKELTDLMMLRQQEAILEIKEKYGDVYEICRRLKTSPQSGLIDDEESIGNRRREFGSNIIPPKPPKTFFRLMWEALQDLTLIVLMGAAVISLALALYSKFSG---------SSHGDETEGDAGWIEXXXXXXXXXXXXXXTAFNDWQKERQFRGLQDQIEGNHKIAVIRGGVAKEXXXXXXXXXXXCQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDIDPMMLSGTHVMEGSAKMLVTAVGLNSQAGIIFALLGAANTEEKDKAETEKPNNQVHKTNSNSKNKGCKNVDEEVELMKLTETHPEDADRCSNHKPNNYASGDANKSEIKNGKVKQEKKVRAPKKKGSVLQLKLNKLASSIGQIGTIVASLTVTILIIKFCINTYVFEKEGWSMD----HLKKMINFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYINGQHNRTHLPSFEELSFNAADMLLKNISINSSYTSRLMATRHVNELPSQIGNKTECALLGFVNGSLKRDYADLRTQWPEEKLIKVYTFNSERKSMSTII-EDEGKLLLLTKGASEMILNKCSFILGKNGKIQPFTTEDVEALVKNVIEPMASDGLRTIGLAYKEFVKKPDHDYQGLYNEKLDLENEHTLIKDLTLIGIVGIEDPVRPEVPPAIKKCQKAGITVRMVTGDNINTARSIAIKCGILKPGEDFLVMEGKEFNNRVRDPISGKIKQELIDQVWPKLRVLARSSPQDKYTLVTGIIDSHLTRSREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFLGACFITDSPLKAVQMLWVNLIMDTLASLALATEMPTEELLDRAPYGRTKPIISRRMIKNIMGQSIYQLAVTFYLLLHGNVLLDVENGRGLTERGINKPTQHFTAIFNTFVMMTLFNEFNSRKIHGQKNVFDGLQRNVLFIIIWVTTFVGQIVIVQYGGYALHTEALELDHWLWCMLFGIGVLLWAQLINCIPTTVIPKHMPWSKKKLPTAENQALNQYKSVDSGNESEDEDYDDIGDLARQNNDEDDDDIKNSGQILWIRGLSRLQTQQNTCNPNLDNRNDVVYGGVRRFTLSQVGGVQPLLAA--RRQSSYSNNEQNINLST 4139
            E+YE        +L  LM LR  +A+ +I   YG V EIC RLKTSP  GL  +   +  RR  FG N+IPPK PKTF  L+WEALQD+TLI+L  AA+ISL L+ Y    G         S+  ++ EG+ GWIEG AIL +VI+VV VTAFNDW KE+QFRGLQ +IE   K ++IR G   ++ V +IVVGDI QVKYGDLLPADGI+IQ ND+K+DESSLTGE DHVKK +D DPM+LSGTHVMEGS +M+VTAVG+NSQ GIIF LLGA N EE D+ + +     V    S ++NK        +E+  L                        N  E  + + K++K  + PKK+ SVLQ KL +LA  IG+ G I++ LTV ILI+ F ++ +V ++  W  +    +++  + F IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLT NRMTVVQ+YI G H R  +P  ++L  N  D+++ +I INS+YTS+++       LP Q+GNKTEC LLGFV   LK+DY  +R++ PEEKL KVYTFNS RKSMST+I + EG   + +KGASE++L KC  IL K G I PF T+D + +V+NVIEPMAS+GLRTIG+AY++F             E+   ENE+ +   L  I +VGIEDPVRPEVP AI KC++AGITVRMVTGDN+NTAR+IA KCGIL PG+DFL +EGKEFN  +R+   G+++QE +D+VWP+LRVLARSSP DK+TLV GIIDS++   R+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSI+KFLQFQLTVNVVAVIVAF GAC   DSPLKAVQMLWVNLIMDT ASLALATE PT+ LL R PYGR KP+ISR M+KNI+G ++YQL + F L+  G+ L D+++GR       + P+QH+T +FNTFV+M LFNE NSRKIHG+KNVF G+ RN++F  + + TF  QI+IV+ GG       L ++ W+WC+  GIG LLW Q+I+ IPT                   ++L   K    G++ E+   D  G    +  D  + +++  GQILW+RGL+R+QTQ         +  DV++    + ++      QP  AA      S+ N E++ +L++
Sbjct:   16 ESYEGEFGCTLMDLRKLMELRAADAVTQISAHYGSVQEICARLKTSPVEGLSGNPADLEKRRLVFGKNMIPPKKPKTFLELVWEALQDVTLIILEIAAIISLVLSFYRPPGGENEICGHIVSNPEEDEEGETGWIEGAAILASVIIVVFVTAFNDWSKEKQFRGLQSRIELEQKFSIIRNGQLIQLPVAEIVVGDIAQVKYGDLLPADGILIQGNDLKIDESSLTGESDHVKKTLDKDPMLLSGTHVMEGSGRMVVTAVGINSQTGIIFTLLGA-NEEEDDEKKKKGKKQGV----SENRNKAKTQDGVALEIQPL------------------------NSQEGLDSEEKEKKASKGPKKEKSVLQGKLTRLAVQIGKAGLIMSILTVLILILYFVVDNFVIQRRAWLPECTPVYIQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTMNRMTVVQAYIGGTHYR-QIPKPDDLPPNVLDLIVNSICINSAYTSKILPPEKEGGLPRQVGNKTECGLLGFVT-DLKQDYQAVRSEMPEEKLFKVYTFNSVRKSMSTVIRKPEGGFRVFSKGASEIMLRKCDRILNKEGGIVPFKTKDRDNMVRNVIEPMASEGLRTIGIAYRDF-----------DGEEPSWENENEIFTGLVCIAVVGIEDPVRPEVPDAINKCKRAGITVRMVTGDNVNTARAIATKCGILTPGDDFLCLEGKEFNRLIRNE-KGEVEQEKLDKVWPRLRVLARSSPTDKHTLVKGIIDSNIGEQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFSGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTDSLLRRRPYGRNKPLISRTMMKNILGHAVYQLGIVFLLVFAGDKLFDIDSGRKAPLN--SPPSQHYTIVFNTFVLMQLFNEINSRKIHGEKNVFAGVYRNIIFCSVVLGTFFCQILIVEVGGKPFSCTNLTMEQWMWCLFIGIGELLWGQVISAIPT-------------------KSLKFLKEAGHGSDKEEISKDAEG---LEEIDHAEMELRR-GQILWVRGLNRIQTQIRVVKV-FHSFRDVIHKSKNQVSIHSF-MTQPEYAADDEMSQSFLNQEESPSLAS 1156          
BLAST of Calcium-transporting ATPase vs. UniProt/SwissProt
Match: sp|P58165|AT2B2_OREMO (Plasma membrane calcium-transporting ATPase 2 (Fragment) OS=Oreochromis mossambicus OX=8127 GN=atp2b2 PE=2 SV=1)

HSP 1 Score: 1178.31 bits (3047), Expect = 0.000e+0
Identity = 627/1071 (58.54%), Postives = 774/1071 (72.27%), Query Frame = 3
Query:  591 ELTDLMMLRQQEAILEIKEKYGDVYEICRRLKTSPQSGLIDDEESIGNRRREFGSNIIPPKPPKTFFRLMWEALQDLTLIVLMGAAVISLALALY---SKFSGSSHG-------DETEGDAGWIEXXXXXXXXXXXXXXTAFNDWQKERQFRGLQDQIEGNHKIAVIRGGVAKEXXXXXXXXXXXCQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDIDPMMLSGTHVMEGSAKMLVTAVGLNSQAGIIFALLGAANTEEKDKAETEKPNNQVHKTNSNSKNKGCKNVDEEVELMKLTETHPEDADRCSNHKPNNYASGDANKSEIKNGKVKQEKKVRAPKKKGSVLQLKLNKLASSIGQIGTIVASLTVTILIIKFCINTYVFEKEGWSMD----HLKKMINFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYINGQHNRTHLPSFEELSFNAADMLLKNISINSSYTSRLMATRHVNELPSQIGNKTECALLGFVNGSLKRDYADLRTQWPEEKLIKVYTFNSERKSMSTIIE-DEGKLLLLTKGASEMILNKCSFILGKNGKIQPFTTEDVEALVKNVIEPMASDGLRTIGLAYKEFVKKPDHDYQGLYNEKLDLENEHTLIKDLTLIGIVGIEDPVRPEVPPAIKKCQKAGITVRMVTGDNINTARSIAIKCGILKPGEDFLVMEGKEFNNRVRDPISGKIKQELIDQVWPKLRVLARSSPQDKYTLVTGIIDSHLTRSREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFLGACFITDSPLKAVQMLWVNLIMDTLASLALATEMPTEELLDRAPYGRTKPIISRRMIKNIMGQSIYQLAVTFYLLLHGNVLLDVENGRGLTERGINKPTQHFTAIFNTFVMMTLFNEFNSRKIHGQKNVFDGLQRNVLFIIIWVTTFVGQIVIVQYGGYALHTEALELDHWLWCMLFGIGVLLWAQLINCIPTT 3758
            EL  LM LR  EA+++++E YG V  +C+RLKTSP  GL   +  +  R+  FG N+IPPK PKTF +L+WEALQD+TLI+L  AA+ISL L+ Y    +  G S G       DE E DAGWIEG AIL +V+ VVLVTAFNDW KE+QFRGLQ +IE   K  V+RG    ++ V DI+VGDI Q+KYGDLLP+DG++IQ ND+K+DESSLTGE DHVKK  D DPM+LSGTHVMEGS +M+VTAVG+NSQ GIIF LLGA   EE+ K +        H+     ++   ++   ++++ K      +D       +P   A G            K+ KKV APKK+ SVLQ KL KLA  IG+ G +++++TV IL++ F I+ +V +K  W  +    +++  + F IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMT VQ Y+ G      +P    L   + D+L+  ISINS+YT++++       LP Q+GNKTEC LLG V   LKRDY  +R Q PEEKL KVYTFNS RKSMST+I+  +G   + +KGASE++L KCS IL + G+ + F   D + +VK VIEPMA DGLRTI +AY++F   P+ ++          ++E+ ++ DLT I +VGIEDPVRPEVP AI+KCQ+AGITVRMVTG NINTAR+IAIKCGI+ PGEDFL ++GKEFN R+R+   G+++QE ID+VWPKLRVLARSSP DK+TLV GIIDS +   R+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNF+SIVKAVMWGRNVYDSI+KFLQFQLTVNVVAVIVAF GAC   DSPLKAVQMLWVNLIMDT ASLALATE PTE LL R PYGR KP+IS  M KNI+G  +YQL + F LL  G  + D+++GR       + P++H+T IFNTFVMM LFNE N+RKIHG++NVFDG+ RN +F  I   TF  QIVIVQ+GG     + L+L+ W+WC+  G+G L+W Q+I  IP +
Sbjct:   30 ELRSLMELRGTEAVVKLQEDYGGVEGLCKRLKTSPTEGLAGAQTDLDKRKEIFGKNLIPPKKPKTFLQLVWEALQDVTLIILEIAALISLGLSFYHPPGETGGESCGAAAGGVEDEGEADAGWIEGAAILLSVVCVVLVTAFNDWSKEKQFRGLQSRIEQEQKFQVVRGSQVIQLPVADILVGDIAQIKYGDLLPSDGVLIQGNDLKIDESSLTGESDHVKKSADKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGVEEEEKKEKKGGAVEDGHQNTGKMQDGNMES--NQIKVKK------QDGAAAMEMQPLKSAEGGEADE-------KERKKVSAPKKEKSVLQGKLTKLAVQIGKAGLLMSAITVIILVLYFAIDNFVMQKRPWMPECTPIYIQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTAVQLYV-GDVRYKEIPDPGVLPPKSLDLLVNAISINSAYTTKILPPDKEGGLPKQVGNKTECGLLGLVL-ELKRDYQPIRNQIPEEKLYKVYTFNSVRKSMSTVIKLPDGSFRMYSKGASEIVLKKCSHILNEVGEPRVFRPRDKDEMVKKVIEPMACDGLRTICVAYRDFSSNPEPNW----------DDENNILNDLTAICVVGIEDPVRPEVPNAIQKCQRAGITVRMVTGANINTARAIAIKCGIIHPGEDFLCIDGKEFNRRIRNE-KGEVEQERIDKVWPKLRVLARSSPTDKHTLVKGIIDSTMADQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTESLLKRKPYGRNKPLISSTMTKNILGHGVYQLIIIFTLLFVGEQIFDIDSGRNAPLH--SPPSEHYTIIFNTFVMMQLFNEINARKIHGERNVFDGIFRNPIFCSIVFGTFAVQIVIVQFGGKPFSCQPLDLEKWMWCVFLGLGELVWGQVIATIPNS 1070          
BLAST of Calcium-transporting ATPase vs. UniProt/SwissProt
Match: sp|P11506|AT2B2_RAT (Plasma membrane calcium-transporting ATPase 2 OS=Rattus norvegicus OX=10116 GN=Atp2b2 PE=1 SV=2)

HSP 1 Score: 1176.77 bits (3043), Expect = 0.000e+0
Identity = 646/1156 (55.88%), Postives = 799/1156 (69.12%), Query Frame = 3
Query:  573 YEMNTKELTDLMMLRQQEAILEIKEKYGDVYEICRRLKTSPQSGLIDDEESIGNRRREFGSNIIPPKPPKTFFRLMWEALQDLTLIVLMGAAVISLALALYSKFSGSSHG---------DETEGDAGWIEXXXXXXXXXXXXXXTAFNDWQKERQFRGLQDQIEGNHKIAVIRGGVAKEXXXXXXXXXXXCQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDIDPMMLSGTHVMEGSAKMLVTAVGLNSQAGIIFALLGAANTEEKDKAETEKPNNQVHKTNSNSKNKGCKNVDEEVELMKLTETHPEDADRCSNHKPNNYASGDANKSEIKN---GKVKQEKKVRAPKKKGSVLQLKLNKLASSIGQIGTIVASLTVTILIIKFCINTYVFEKEGWSMD----HLKKMINFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYINGQHNRTHLPSFEELSFNAADMLLKNISINSSYTSRLMATRHVNELPSQIGNKTECALLGFVNGSLKRDYADLRTQWPEEKLIKVYTFNSERKSMSTIIE--DEGKLLLLTKGASEMILNKCSFILGKNGKIQPFTTEDVEALVKNVIEPMASDGLRTIGLAYKEFVKKPDHDYQGLYNEKLDLENEHTLIKDLTLIGIVGIEDPVRPEVPPAIKKCQKAGITVRMVTGDNINTARSIAIKCGILKPGEDFLVMEGKEFNNRVRDPISGKIKQELIDQVWPKLRVLARSSPQDKYTLVTGIIDSHLTRSREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFLGACFITDSPLKAVQMLWVNLIMDTLASLALATEMPTEELLDRAPYGRTKPIISRRMIKNIMGQSIYQLAVTFYLLLHGNVLLDVENGRGLTERGINKPTQHFTAIFNTFVMMTLFNEFNSRKIHGQKNVFDGLQRNVLFIIIWVTTFVGQIVIVQYGGYALHTEALELDHWLWCMLFGIGVLLWAQLINCIPTTVIP--KHMPWSKKKLPTAENQALNQYKSVDSGNESEDEDYDDIGDLARQNNDEDDDDIKNSGQILWIRGLSRLQTQ 3980
            +  + +EL  LM LR  EA+++IKE YGD   ICRRLKTSP  GL      +  R++ FG N IPPK PKTF +L+WEALQD+TLI+L  AA+ISL L+ Y     S+ G         DE E +AGWIEG AIL +VI VVLVTAFNDW KE+QFRGLQ +IE   K  V+R G   +I V +IVVGDI Q+KYGDLLPADG+ IQ ND+K+DESSLTGE D V+K VD DPM+LSGTHVMEGS +M+VTAVG+NSQ GIIF LLGA   EE+ K +         +  +                +   +     AD   +       +       +K+   G    +KK    KK+ SVLQ KL KLA  IG+ G +++++TV IL++ F ++T+V  K+ W  +    +++  + F IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQ+Y+   H +  +P    ++    ++L+  I+INS+YT++++       LP Q+GNKTEC LLGFV   L++DY  +R+Q PEEKL KVYTFNS RKSMST+I+  DE    + +KGASE++L KC  IL   G+ + F   D + +VK VIEPMA DGLRTI +AY++F   P+ D+          +NE+ ++ +LT I +VGIEDPVRPEVP AI+KCQ+AGITVRMVTGDNINTAR+IAIKCGI+ PGEDFL +EGKEFN R+R+   G+I+QE ID++WPKLRVLARSSP DK+TLV GIIDS  T  R+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNF+SIVKAVMWGRNVYDSI+KFLQFQLTVNVVAVIVAF GAC   DSPLKAVQMLWVNLIMDT ASLALATE PTE LL R PYGR KP+ISR M+KNI+G ++YQL + F LL  G  +  +++GR       + P++H+T IFNTFVMM LFNE N+RKIHG++NVFDG+ RN +F  I + TF  QIVIVQ+GG       L+LD W+WC+  G+G L+W Q+I  IPT+ +   K      +K    E +     + +D              +L R             GQILW RGL+R+QTQ
Sbjct:   24 FGCSMEELRSLMELRGTEAVVKIKETYGDTESICRRLKTSPVEGLPGTAPDLEKRKQIFGQNFIPPKKPKTFLQLVWEALQDVTLIILEIAAIISLGLSFYHPPGESNEGCATAQGGAEDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEKQFRGLQSRIEQEQKFTVVRAGQVVQIPVAEIVVGDIAQIKYGDLLPADGLFIQGNDLKIDESSLTGESDQVRKSVDKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGGEEEEKKDKKGVKKGDGLQLPAADGAAPANAAGSANASLVNGKMQDGSADSSQSKAKQQDGAAAMEMQPLKSAEGGDADDKKKANMHKKEKSVLQGKLTKLAVQIGKAGLVMSAITVIILVLYFTVDTFVVNKKPWLTECTPVYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAYVGDVHYK-EIPDPSSINAKTLELLVNAIAINSAYTTKILPPEKEGALPRQVGNKTECGLLGFVL-DLRQDYEPVRSQMPEEKLYKVYTFNSVRKSMSTVIKMPDES-FRMYSKGASEIVLKKCCKILSGAGEPRVFRPRDRDEMVKKVIEPMACDGLRTICVAYRDFPSSPEPDW----------DNENDILNELTCICVVGIEDPVRPEVPEAIRKCQRAGITVRMVTGDNINTARAIAIKCGIIHPGEDFLCLEGKEFNRRIRNE-KGEIEQERIDKIWPKLRVLARSSPTDKHTLVKGIIDSTHTEQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTETLLLRKPYGRNKPLISRTMMKNILGHAVYQLTLIFTLLFVGEKMFQIDSGRNAPLH--SPPSEHYTIIFNTFVMMQLFNEINARKIHGERNVFDGIFRNPIFCTIVLGTFAIQIVIVQFGGKPFSCSPLQLDQWMWCIFIGLGELVWGQVIATIPTSRLKFLKEAGRLTQKEEIPEEELNEDVEEIDHAER----------ELRR-------------GQILWFRGLNRIQTQ 1140          
BLAST of Calcium-transporting ATPase vs. TrEMBL
Match: A0A4S2LFL9 (Calcium-transporting ATPase OS=Opisthorchis felineus OX=147828 GN=CRM22_007480 PE=3 SV=1)

HSP 1 Score: 1429.46 bits (3699), Expect = 0.000e+0
Identity = 774/1272 (60.85%), Postives = 924/1272 (72.64%), Query Frame = 3
Query:  567 ETYEMNTKELTDLMMLRQQEAILEIKEKYGDVYEICRRLKTSPQSGLIDDEESIGNRRREFGSNIIPPKPPKTFFRLMWEALQDLTLIVLMGAAVISLALALYSKFSG---SSHG-DETEGDAGWIEXXXXXXXXXXXXXXTAFNDWQKERQFRGLQDQIEGNHKIAVIRGGVAKEXXXXXXXXXXXCQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDIDPMMLSGTHVMEGSAKMLVTAVGLNSQAGIIFALLGAANTEEK-------------------DKAETEKPNNQVHKTNSNSKNKGCKNV---DEEVELMKLTETHPEDADRCSNHKPNNYA-----SGDANKSEIKNGKVKQ----EKKVRAPKKKGSVLQLKLNKLASSIGQIGTIVASLTVTILIIKFCINTYVFEKEGWSMD-HLKKMINFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYINGQHNR--THLPSFEELSFNAADMLLKNISINSSYTSRLMATRHVNELPSQIGNKTECALLGFVNGSLKRDYADLRTQWPEEKLIKVYTFNSERKSMSTIIED----EGKLLLLTKGASEMILNKCSFILGKNGKIQPFTTEDVEALVKNVIEPMASDGLRTIGLAYKEFVKK---PDHDYQGLYNEKL-DLENEHTLIKDLTLIGIVGIEDPVRPEVPPAIKKCQKAGITVRMVTGDNINTARSIAIKCGILKPGEDFLVMEGKEFNNRVRDPISGKIKQELIDQVWPKLRVLARSSPQDKYTLVTGIIDSHLTRSREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFLGACFITDSPLKAVQMLWVNLIMDTLASLALATEMPTEELLDRAPYGRTKPIISRRMIKNIMGQSIYQLAVTFYLLLHGNVLLDVENGRGLTERGINKPTQHFTAIFNTFVMMTLFNEFNSRKIHGQKNVFDGLQRNVLFIIIWVTTFVGQIVIVQYGGYALHTEALELDHWLWCMLFGIGVLLWAQLINCIPTTVIPKHMPWSKKKLPTAENQALNQYKSVDSGNESEDEDYD---------------DIGDLARQNN----------------------------DEDDDDIKNSGQILWIRGLSRLQTQQNTCNPNLDNRNDVVYGGVRRFTLSQV---GGVQPL-LAARRQSS 4103
            + ++   +EL  LM LR  EA+  I  KY     +C+RL+TSP  GL + E  +  RR  FG+N+IPP PPKTF +LMW ALQD+TLIVLM AA +SL LALYS++ G   +SHG DETEG+  WIEGVAIL AV+VVVLVTA NDWQKERQFRGLQD+IE +H+++V+R G   E++VGDIVVGDIC VKYGDLLPADG+IIQSND+KVDESSLTGEPDHVKKG  +DPM+LSGTHVMEGS KM+VTAVG+NSQAGIIF LLGA   +                     D+     P    H    +   +   +V    E+VE+ +LT T     D   NH+  N A      GD N+      +        K  +  KKK SVLQ KL +LAS IGQ+GT+VA+LTV ILIIKF + T+ F+KE W    HL + + F+IIGVTVLVVAVPEGLPLAVTISLAYSVKKMM+DNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQ Y+ G+  +    LP   +L       L+ +++INSSYTSR+      +ELP Q+GNKTECALLGFV   L  +Y D+R +WP+E L+KVYTFNS RKSMSTII+D       + + TKGASEM+L KC+FIL  NG+ QPFT    EALV+ VIEPMASDGLRTIGLAYK ++     P+ +   L   +L DL++E +++ DLT IG+VGIEDPVRPEVP AI+KCQ+AGITVRMVTGDNINTARSIA+KCGILKPGE+++V+EGKEFNNRVRDP + +++Q+LIDQVWP+LRVLARSSPQDKYTLV+GIIDSH+T  REVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSI+KFLQFQLTVN+VA+IVAF+GACFITDSPLKAVQMLWVNLIMDTLASLALATE+PTEELL+RAPYGR+KPII R MIKNI+GQ++YQLAV FYLL  G  +LDVENGRGL+E+GIN+PT+HFT IFNTFVMMTLFNE N+RKIHGQ+N+F GL  N+LF+IIWV TF  Q++IVQ+GGYA  T  L L+HWLWC+ FGIG L+W Q+I  IP+++IPK      +K P      L     V++   +   D +                 G +A+  N                            +    ++KN+GQILWIRGLSRLQTQ     P+LD R D   G VRRFTLSQ+   G V PL LAARRQS+
Sbjct:   15 DKFDCTMQELQGLMQLRGAEALDVITRKYDGATGLCKRLRTSPTEGLFNKE--LTQRREVFGTNVIPPTPPKTFLQLMWAALQDVTLIVLMVAAGVSLLLALYSEYFGGDNTSHGGDETEGEVSWIEGVAILCAVVVVVLVTATNDWQKERQFRGLQDKIESDHRMSVVREGEIVEVLVGDIVVGDICLVKYGDLLPADGVIIQSNDLKVDESSLTGEPDHVKKGELLDPMLLSGTHVMEGSGKMVVTAVGVNSQAGIIFTLLGATEGDATAIPPPPPTEFATQTANPNVDRNGRPTPAGHGHHGADDLNKRNASHVAFRGEDVEMGRLTAT----GDHIENHQHGNLARENGAGGDDNELSPDTDEAADLDAGAKPKKRKKKKYSVLQAKLTRLASLIGQLGTVVATLTVIILIIKFSVQTFYFDKEPWDTGRHLHQFVRFVIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMRDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQCYLGGRFTQREAELPRLNDLHHRVGHRLVHSVAINSSYTSRITVPAKSSELPQQLGNKTECALLGFVR-HLGVNYEDIREKWPQETLLKVYTFNSVRKSMSTIIKDLEPSRPGITVFTKGASEMVLKKCAFILDNNGEPQPFTQSHQEALVREVIEPMASDGLRTIGLAYKTYLNPGIDPERNEIQLSRGQLPDLDDEDSIVTDLTCIGVVGIEDPVRPEVPAAIRKCQRAGITVRMVTGDNINTARSIALKCGILKPGENYIVLEGKEFNNRVRDPKTNRVRQDLIDQVWPQLRVLARSSPQDKYTLVSGIIDSHMTTRREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNMVAIIVAFVGACFITDSPLKAVQMLWVNLIMDTLASLALATELPTEELLERAPYGRSKPIIGRTMIKNIVGQALYQLAVIFYLLWFGEQILDVENGRGLSEKGINRPTEHFTVIFNTFVMMTLFNEINARKIHGQRNIFSGLMNNILFLIIWVATFFLQVIIVQFGGYAFSTAPLPLEHWLWCLFFGIGSLVWGQVITTIPSSIIPKR----TRKPPKGRRATLVPVTDVNAPETTGLMDAEAGGPPMADGGLGHRPSTGFVAKAANVVARGLGAIYPASAPEEEEEEDEDEEHENMTGAELKNTGQILWIRGLSRLQTQAAR-EPSLDTRTDEWMGRVRRFTLSQINTEGMVHPLVLAARRQST 1274          
BLAST of Calcium-transporting ATPase vs. TrEMBL
Match: A0A068YDN3 (Calcium-transporting ATPase OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000790100 PE=3 SV=1)

HSP 1 Score: 1422.14 bits (3680), Expect = 0.000e+0
Identity = 781/1282 (60.92%), Postives = 928/1282 (72.39%), Query Frame = 3
Query:  567 ETYEMNTKELTDLMMLRQQEAILEIKEKYGDVYEICRRLKTSPQSGLIDDEESIGNRRREFGSNIIPPKPPKTFFRLMWEALQDLTLIVLMGAAVISLALALYSKFSGSS-HGDETEGDAGWIEXXXXXXXXXXXXXXTAFNDWQKERQFRGLQDQIEGNHKIAVIRGGVAKEXXXXXXXXXXXCQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDIDPMMLSGTHVMEGSAKMLVTAVGLNSQAGIIFALLGAA------------------NTE--------------EKDKAETEKP---NNQVHKTNSNSKNKGCKNVDEEVELMKLT----ETHPEDADRCSNHKPNNYASGDANKSEIKNGKVKQEKKVRAPKKKGS----VLQLKLNKLASSIGQIGTIVASLTVTILIIKFCINTYVFEKEGWSMD-HLKKMINFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYINGQHNR--THLPSFEELSFNAADMLLKNISINSSYTSRLMATRHVNELPSQIGNKTECALLGFVNGSLKRDYADLRTQWPEEKLIKVYTFNSERKSMSTIIE--DEGK--LLLLTKGASEMILNKCSFILGKNGKIQPFTTEDVEALVKNVIEPMASDGLRTIGLAYKEFVKK---PDHDYQGLYN-EKLDLENEHTLIKDLTLIGIVGIEDPVRPEVPPAIKKCQKAGITVRMVTGDNINTARSIAIKCGILKPGEDFLVMEGKEFNNRVRDPISGKIKQELIDQVWPKLRVLARSSPQDKYTLVTGIIDSHLTRSREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFLGACFITDSPLKAVQMLWVNLIMDTLASLALATEMPTEELLDRAPYGRTKPIISRRMIKNIMGQSIYQLAVTFYLLLHGNVLLDVENGRGLTERGINKPTQHFTAIFNTFVMMTLFNEFNSRKIHGQKNVFDGLQRNVLFIIIWVTTFVGQIVIVQYGGYALHTEALELDHWLWCMLFGIGVLLWAQLINCIPTTVIPKHMPWSKKKLPTAENQALNQYKSV--DSGNESEDEDYDD----------------IGDL--------------ARQNNDEDDDDIKNSGQILWIRGLSRLQTQQNTCNPNLDNRNDVVYGGVRRFTLSQV---GGVQPL-LAARRQSSYSNNEQNINLST 4139
            ++Y +   EL ++M LR  EAI  IK +Y  V  +C+RLKTSP SG+   E  +  R + FGSN+IPPKPPKTF +LMWEALQD+TLIVLM AAV+SLAL+LYSK+SG S  GDETEGDAGWIEGVAILGAV+VVVLVTA NDWQKERQFRGLQD+IE +H+I+++R G   E +VGDIVVGDIC +KYGDLLPADG+IIQSND+KVDESSLTGE DHVKKG  IDPM+LSGTHVMEGS K LVTAVG++SQAGIIF LLGA                   +TE                +KA  + P    N   +      ++G       VE+ +L          D        P N   GD       NG V +EK+    KK+      VLQ KLN LA  IGQIGT++A  TV IL +KF +NTY  E + W+   HLK+ I+F+IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQ Y+ G H +   +LP    L+   A +L+  I+INS YTSR++  +   +LP+Q+GNKTECALLGFV+ +L   Y D+R QWPE+ L+KV+TFNSERKSMSTII   D+ K  L + TKGASEM+L KCSFILG  G+  PF     E +V+ VIEPMASDGLRTI +AYK +V     P+ +   L N  + +LE+E +LI DLT +GIVGIEDPVRPEVP AI+KCQ+AGITVRMVTGDNINTARSIA+KCGI+  G+++ ++EGK FN RVRDP +GK+KQELIDQ+WP LRVLARSSPQDKYTLV+GIIDSH+TRSREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAF+GACFITDSPLKAVQMLWVNLIMDTLASLALATE+P+EELL+RAPYGRTKPII R MIK I GQ+IYQL V FYL+  G +LLDV++GRGL+ +G N+PT+HFT IFNTFV+MTLFNE N+RKIHGQ+NVF+GL RN+LF+ IW TTFV Q++IVQ+GGYA  T  L ++ WLWC+ FG+G L+W QL+  +P  V+PKH+   +K+ P      L Q  ++  ++G  S  +                    + D+                   D    D+K++GQILWIRGLSRLQTQ  T +  LD+R+D   G VRRFTLSQ+   G   PL LAARRQS        INLS+
Sbjct:   14 KSYGVTVSELQEMMQLRGLEAIEYIKSRYDGVNGLCKRLKTSPNSGVHSAE--VAERIKVFGSNVIPPKPPKTFLQLMWEALQDVTLIVLMAAAVVSLALSLYSKYSGGSVGGDETEGDAGWIEGVAILGAVLVVVLVTAVNDWQKERQFRGLQDKIESDHRISIMRDGEFFECLVGDIVVGDICLIKYGDLLPADGVIIQSNDLKVDESSLTGEADHVKKGEQIDPMLLSGTHVMEGSGKFLVTAVGVHSQAGIIFTLLGATEGFGGMDTVPGGGLPMLPSTETIPHAPVAATAAVAPVEKASAQTPLLMQNNKQRMADGIGHRGTGPHPATVEMGRLNNLVDHMGTGDDQNLEPLLPRNGKGGD-------NGGVAKEKEAPKRKKRPKKKSSVLQAKLNHLAGVIGQIGTVIAVFTVVILFVKFAVNTYYIEGQSWNTSVHLKQFIHFIIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQCYLGGCHFKDPNNLPKLSHLNPKLAHLLIHGIAINSGYTSRVLPPKRPTDLPTQLGNKTECALLGFVH-TLGASYEDIRQQWPEDSLLKVFTFNSERKSMSTIIRSLDQKKRGLTVFTKGASEMVLKKCSFILGAGGEPLPFPQSAQEEIVRTVIEPMASDGLRTIAIAYKNYVGNGVTPESNEFVLPNGRRANLEDEASLICDLTCLGIVGIEDPVRPEVPAAIRKCQRAGITVRMVTGDNINTARSIALKCGIISEGDNYAILEGKTFNLRVRDPRTGKVKQELIDQIWPTLRVLARSSPQDKYTLVSGIIDSHVTRSREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFVGACFITDSPLKAVQMLWVNLIMDTLASLALATEIPSEELLERAPYGRTKPIIGRTMIKAISGQAIYQLTVIFYLIFSGEILLDVDSGRGLSAQGQNRPTEHFTVIFNTFVLMTLFNELNARKIHGQRNVFEGLHRNLLFVGIWATTFVLQVIIVQFGGYAFSTHPLNVEQWLWCIFFGLGSLIWGQLVISVPVWVVPKHLIPRRKRKPVPRKSVLYQELALAPEAGVASTGDQMATAAGAGAAVGMPVARPVVSDVEEELSGSEVESESEESGAEDTGSGDLKSTGQILWIRGLSRLQTQA-TRDHELDHRSDEFMGRVRRFTLSQINTEGMQHPLVLAARRQS--------INLSS 1276          
BLAST of Calcium-transporting ATPase vs. TrEMBL
Match: A0A0X3P095 (Calcium-transporting ATPase OS=Schistocephalus solidus OX=70667 GN=TR117220 PE=3 SV=1)

HSP 1 Score: 1415.98 bits (3664), Expect = 0.000e+0
Identity = 773/1261 (61.30%), Postives = 928/1261 (73.59%), Query Frame = 3
Query:  573 YEMNTKELTDLMMLRQQEAILEIKEKYGDVYEICRRLKTSPQSGLIDDEESIGNRRREFGSNIIPPKPPKTFFRLMWEALQDLTLIVLMGAAVISLALALYSKFSGSSH--GDETEGDAGWIEXXXXXXXXXXXXXXTAFNDWQKERQFRGLQDQIEGNHKIAVIRGGVAKEXXXXXXXXXXXCQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDIDPMMLSGTHVMEGSAKMLVTAVGLNSQAGIIFALLGA---ANTEEKDKAET------EKPNNQV------HKTNSNSKNKGCKNVDE-----------EVELMKLTETHPEDADRCSNHKPNNYASGDANKSEIKNGKVKQEKKVRAPKKKG------------SVLQLKLNKLASSIGQIGTIVASLTVTILIIKFCINTYVFEKEGWSMD-HLKKMINFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYINGQHNR--THLPSFEELSFNAADMLLKNISINSSYTSRLMATRHVNELPSQIGNKTECALLGFVNGSLKRDYADLRTQWPEEKLIKVYTFNSERKSMSTIIE--DEGK--LLLLTKGASEMILNKCSFILGKNGKIQPFTTEDVEALVKNVIEPMASDGLRTIGLAYKEFV----KKPDHDYQGLYNEKL-DLENEHTLIKDLTLIGIVGIEDPVRPEVPPAIKKCQKAGITVRMVTGDNINTARSIAIKCGILKPGEDFLVMEGKEFNNRVRDPISGKIKQELIDQVWPKLRVLARSSPQDKYTLVTGIIDSHLTRSREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFLGACFITDSPLKAVQMLWVNLIMDTLASLALATEMPTEELLDRAPYGRTKPIISRRMIKNIMGQSIYQLAVTFYLLLHGNVLLDVENGRGLTERGINKPTQHFTAIFNTFVMMTLFNEFNSRKIHGQKNVFDGLQRNVLFIIIWVTTFVGQIVIVQYGGYALHTEALELDHWLWCMLFGIGVLLWAQLINCIPTTVIP-----------------KHMPWSKKKLPTAENQALNQ------------YKSVDSGNESEDEDYDDIGDLARQNNDEDDDDIKNSGQILWIRGLSRLQTQQNTCNPNLDNRNDVVYGGVRRFTLSQV---GGVQPLLAARRQSS 4103
            Y    +EL ++M LR  EAI  IK KYG +  +C+RL+TSP +GL   E  +    + FGSN+IPPKPPKTF +LMWEALQD+TLIVLM AAV+SLALALYSK+SG +   GDETEGDAGWIEGVAILGAV+VVVLVTA NDWQKERQFRGLQD+IE +H+I+V+R     E +VG+IVVGDIC VKYGDLLPADG+IIQSND+KVDESSLTGE DHVKKG  IDP++LSGTHVMEGS +MLVTAVG+NSQAGIIF LLGA    N +  +   T      EK ++QV         +  +    C+  D            + E+ +L + HP       N       +   N      G + Q   V  P  +             SVLQ KLN LA  IGQ+GT++A LTV IL IKF + TY    E W+   HLK+ I+F+IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSY+ G+  R  + LP+ + L+     +L+  ISINS YTSR++  +  N+LP+Q+GNKTECALLGFV  +L   Y D+R +WPEE ++KV+TFNS RKSMST I   D  K  + + TKGASEM+L KCSFIL  NG+ +PF+  D E L+  VIEPMASDGLRTIGLAYK ++     K  +D++ L + KL DL++E  LI +LT +GIVGIEDPVRPEVP AI+KCQ++GITVRMVTGDN+NTARSIA+KCGI+  G+++ ++EGK FN  VRDP +GK+KQELID+VWP LRVLARSSPQDKYTLV+GIIDSH+TR REVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVN VAVIVAF+GACFITDSPLKAVQMLWVNLIMDTLASLALATE+P+EELL+RAPYGRTKPII R MIK I+GQS+YQLAV FYL+  G VLLDV++GRGL+ RGI KPT+HFT IFNTFV+MTLFNE N+RKIHGQ+NVF GL RN+LF++IW+TTFV Q++IVQ+GGYA  T  L ++HWLWC+ FG+G LLW QL+  +P  +IP                   +  S + +P A +                 Y++     ESE+E+ ++  D    + D  D  ++++GQILWIRGLSRLQT Q+T  P LD+R+D   G VRR+TLSQ+   G   PL+AARRQS+
Sbjct:   17 YGCTVQELQEMMQLRGAEAIEYIKSKYGGIDGLCKRLRTSPHNGLPSSE--VSEHAQVFGSNVIPPKPPKTFLQLMWEALQDVTLIVLMVAAVVSLALALYSKYSGGNPPGGDETEGDAGWIEGVAILGAVLVVVLVTAVNDWQKERQFRGLQDKIESDHRISVMRDNEFFECLVGEIVVGDICLVKYGDLLPADGLIIQSNDLKVDESSLTGEADHVKKGEHIDPVLLSGTHVMEGSGRMLVTAVGVNSQAGIIFTLLGATDGGNVDSPNMPPTVTTVPLEKMDSQVTTPLLPSPPDHRADGYACRPRDSLGNPDHGGNPLDAEMSRLPD-HPTGDHVVFNKYSIANTTSPGNGKSAGGGDMDQATGVVVPDAEAPKKKKKRTKKKSSVLQAKLNYLAGVIGQVGTVIAVLTVLILFIKFAVETYYVRGESWNTQIHLKQFIHFVIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYLGGELTRDSSQLPTLQSLNEKLGHLLVHCISINSGYTSRVLPPKKANDLPTQLGNKTECALLGFVQ-TLGGSYEDIRQRWPEESMLKVFTFNSVRKSMSTAIRNLDPNKRGITVFTKGASEMVLKKCSFILDGNGQPKPFSQADQENLISTVIEPMASDGLRTIGLAYKNYIAPGFPKDTNDFE-LPDGKLPDLDDEDQLICNLTCLGIVGIEDPVRPEVPAAIRKCQRSGITVRMVTGDNLNTARSIALKCGIIHEGDNYTILEGKTFNQLVRDPNTGKVKQELIDKVWPSLRVLARSSPQDKYTLVSGIIDSHVTRGREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNCVAVIVAFIGACFITDSPLKAVQMLWVNLIMDTLASLALATEIPSEELLERAPYGRTKPIIGRPMIKVILGQSLYQLAVVFYLIWGGEVLLDVDSGRGLSARGIKKPTEHFTVIFNTFVLMTLFNELNARKIHGQRNVFSGLHRNMLFVVIWITTFVLQVIIVQFGGYAFSTHPLAVEHWLWCLFFGLGSLLWGQLVISLPNWIIPKRCIRRKKKRASKKSDYAEVYLSPESVPLAASAGTPSPAGPPPPGSEPFYRAATVVAESEEEEEEESEDEEPGDLDSGD--LRSAGQILWIRGLSRLQT-QSTRGPELDHRSDEFMGRVRRYTLSQISTEGMNHPLVAARRQSA 1269          
BLAST of Calcium-transporting ATPase vs. TrEMBL
Match: A0A0X3PBV0 (Calcium-transporting ATPase OS=Schistocephalus solidus OX=70667 GN=TR117220 PE=3 SV=1)

HSP 1 Score: 1413.67 bits (3658), Expect = 0.000e+0
Identity = 773/1261 (61.30%), Postives = 928/1261 (73.59%), Query Frame = 3
Query:  573 YEMNTKELTDLMMLRQQEAILEIKEKYGDVYEICRRLKTSPQSGLIDDEESIGNRRREFGSNIIPPKPPKTFFRLMWEALQDLTLIVLMGAAVISLALALYSKFSGSSH--GDETEGDAGWIEXXXXXXXXXXXXXXTAFNDWQKERQFRGLQDQIEGNHKIAVIRGGVAKEXXXXXXXXXXXCQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDIDPMMLSGTHVMEGSAKMLVTAVGLNSQAGIIFALLGA---ANTEEKDKAET------EKPNNQV------HKTNSNSKNKGCKNVDE-----------EVELMKLTETHPEDADRCSNHKPNNYASGDANKSEIKNGKVKQEKKVRAPKKKG------------SVLQLKLNKLASSIGQIGTIVASLTVTILIIKFCINTYVFEKEGWSMD-HLKKMINFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYINGQHNR--THLPSFEELSFNAADMLLKNISINSSYTSRLMATRHVNELPSQIGNKTECALLGFVNGSLKRDYADLRTQWPEEKLIKVYTFNSERKSMSTIIE--DEGK--LLLLTKGASEMILNKCSFILGKNGKIQPFTTEDVEALVKNVIEPMASDGLRTIGLAYKEFV----KKPDHDYQGLYNEKL-DLENEHTLIKDLTLIGIVGIEDPVRPEVPPAIKKCQKAGITVRMVTGDNINTARSIAIKCGILKPGEDFLVMEGKEFNNRVRDPISGKIKQELIDQVWPKLRVLARSSPQDKYTLVTGIIDSHLTRSREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFLGACFITDSPLKAVQMLWVNLIMDTLASLALATEMPTEELLDRAPYGRTKPIISRRMIKNIMGQSIYQLAVTFYLLLHGNVLLDVENGRGLTERGINKPTQHFTAIFNTFVMMTLFNEFNSRKIHGQKNVFDGLQRNVLFIIIWVTTFVGQIVIVQYGGYALHTEALELDHWLWCMLFGIGVLLWAQLINCIPTTVIP-----------------KHMPWSKKKLPTAENQALNQ------------YKSVDSGNESEDEDYDDIGDLARQNNDEDDDDIKNSGQILWIRGLSRLQTQQNTCNPNLDNRNDVVYGGVRRFTLSQV---GGVQPLLAARRQSS 4103
            Y    +EL ++M LR  EAI  IK KYG +  +C+RL+TSP +GL   E  +    + FGSN+IPPKPPKTF +LMWEALQD+TLIVLM AAV+SLALALYSK+SG +   GDETEGDAGWIEGVAILGAV+VVVLVTA NDWQKERQFRGLQD+IE +H+I+V+R     E +VG+IVVGDIC VKYGDLLPADG+IIQSND+KVDESSLTGE DHVKKG  IDP++LSGTHVMEGS +MLVTAVG+NSQAGIIF LLGA    N +  +   T      EK ++QV         +  +    C+  D            + E+ +L + HP       N       +   N      G + Q   V  P  +             SVLQ KLN LA  IGQ+GT++A LTV IL IKF + TY    E W+   HLK+ I+F+IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSY+ G+  R  + LP+ + L+     +L+  ISINS YTSR++  +  N+LP+Q+GNKTECALLGFV  +L   Y D+R +WPEE ++KV+TFNS RKSMST I   D  K  + + TKGASEM+L KCSFIL  NG+ +PF+  D E L+  VIEPMASDGLRTIGLAYK ++     K  +D++ L + KL DL++E  LI +LT +GIVGIEDPVRPEVP AI+KCQ++GITVRMVTGDN+NTARSIA+KCGI+  G+++ ++EGK FN  VRDP +GK+KQELID+VWP LRVLARSSPQDKYTLV+GIIDSH+TR REVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVN VAVIVAF+GACFITDSPLKAVQMLWVNLIMDTLASLALATE+P+EELL+RAPYGRTKPII R MIK I+GQS+YQLAV FYL+  G VLLDV++GRGL+ RGI KPT+HFT IFNTFV+MTLFNE N+RKIHGQ+NVF GL RN+LF++IW+TTFV Q++IVQ+GGYA  T  L ++HWLWC+ FG+G LLW QL+  +P  +IP                   +  S + +P A +                 Y++     ESE+E+ ++  D    + D  D  ++++GQILWIRGLSRLQT Q+T  P LD+R+D   G VRR+TLSQ+   G   PL+AARRQS+
Sbjct:   17 YGCTVQELQEMMQLRGAEAIEYIKSKYGGIDGLCKRLRTSPHNGLPSSE--VSEHAQVFGSNVIPPKPPKTFLQLMWEALQDVTLIVLMVAAVVSLALALYSKYSGGNPPGGDETEGDAGWIEGVAILGAVLVVVLVTAVNDWQKERQFRGLQDKIESDHRISVMRDNEFFECLVGEIVVGDICLVKYGDLLPADGLIIQSNDLKVDESSLTGEADHVKKGEHIDPVLLSGTHVMEGSGRMLVTAVGVNSQAGIIFTLLGATDGGNVDSPNMPPTVTTVPLEKMDSQVTTPLLPSPPDHRADGYACRPRDSLGNPDHGGNPLDAEMSRLPD-HPTGDHVVFNKYSIANTTSPGNGKSAGGGDMDQATGVVVPDAEAPKKKKKRTKKKSSVLQAKLNYLAGVIGQVGTVIAVLTVLILFIKFAVETYYVRGESWNTQIHLKQFIHFVIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYLGGELTRDSSQLPTLQSLNEKLGHLLVHCISINSGYTSRVLPPKKANDLPTQLGNKTECALLGFVQ-TLGGSYEDIRQRWPEESMLKVFTFNSVRKSMSTAIRNLDPNKRGITVFTKGASEMVLKKCSFILDGNGQPKPFSQADQENLISTVIEPMASDGLRTIGLAYKNYIAPGFPKDTNDFE-LPDGKLPDLDDEDQLICNLTCLGIVGIEDPVRPEVPAAIRKCQRSGITVRMVTGDNLNTARSIALKCGIIHEGDNYTILEGKTFNQLVRDPNTGKVKQELIDKVWPSLRVLARSSPQDKYTLVSGIIDSHVTRGREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNCVAVIVAFIGACFITDSPLKAVQMLWVNLIMDTLASLALATEIPSEELLERAPYGRTKPIIGRPMIKVILGQSLYQLAVVFYLIWGGEVLLDVDSGRGLSARGIKKPTEHFTVIFNTFVLMTLFNELNARKIHGQRNVFSGLHRNMLFVVIWITTFVLQVIIVQFGGYAFSTHPLAVEHWLWCLFFGLGSLLWGQLVISLPNWIIPKRCIRRKKKRASKKSDYAEVYLSPESVPLAASAGTPSPAGPPPPGSEPFYRAATVVAESEEEEEEESEDEEPGDLDSGD--LRSAGQILWIRGLSRLQT-QSTRGPELDHRSDEFMGRVRRYTLSQISTEGMNHPLVAARRQSA 1269          
BLAST of Calcium-transporting ATPase vs. TrEMBL
Match: A0A4S2LG80 (Calcium-transporting ATPase OS=Opisthorchis felineus OX=147828 GN=CRM22_007480 PE=3 SV=1)

HSP 1 Score: 1399.03 bits (3620), Expect = 0.000e+0
Identity = 753/1246 (60.43%), Postives = 904/1246 (72.55%), Query Frame = 3
Query:  567 ETYEMNTKELTDLMMLRQQEAILEIKEKYGDVYEICRRLKTSPQSGLIDDEESIGNRRREFGSNIIPPKPPKTFFRLMWEALQDLTLIVLMGAAVISLALALYSKFSG---SSHG-DETEGDAGWIEXXXXXXXXXXXXXXTAFNDWQKERQFRGLQDQIEGNHKIAVIRGGVAKEXXXXXXXXXXXCQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDIDPMMLSGTHVMEGSAKMLVTAVGLNSQAGIIFALLGAANTEEK-------------------DKAETEKPNNQVHKTNSNSKNKGCKNV---DEEVELMKLTETHPEDADRCSNHKPNNYA-----SGDANKSEIKNGKVKQ----EKKVRAPKKKGSVLQLKLNKLASSIGQIGTIVASLTVTILIIKFCINTYVFEKEGWSMD-HLKKMINFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYINGQHNR--THLPSFEELSFNAADMLLKNISINSSYTSRLMATRHVNELPSQIGNKTECALLGFVNGSLKRDYADLRTQWPEEKLIKVYTFNSERKSMSTIIED----EGKLLLLTKGASEMILNKCSFILGKNGKIQPFTTEDVEALVKNVIEPMASDGLRTIGLAYKEFVKK---PDHDYQGLYNEKL-DLENEHTLIKDLTLIGIVGIEDPVRPEVPPAIKKCQKAGITVRMVTGDNINTARSIAIKCGILKPGEDFLVMEGKEFNNRVRDPISGKIKQELIDQVWPKLRVLARSSPQDKYTLVTGIIDSHLTRSREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFLGACFITDSPLKAVQMLWVNLIMDTLASLALATEMPTEELLDRAPYGRTKPIISRRMIKNIMGQSIYQLAVTFYLLLHGNVLLDVENGRGLTERGINKPTQHFTAIFNTFVMMTLFNEFNSRKIHGQKNVFDGLQRNVLFIIIWVTTFVGQIVIVQYGGYALHTEALELDHWLWCMLFGIGVLLWAQLINCIPTTVIPKHMPWSKKKLPTAENQALNQYKSVDSGNESEDEDYD---------------DIGDLARQNN----------------------------DEDDDDIKNSGQILWIRGLSRLQTQQNTCN---PNLDNRNDVVY 4028
            + ++   +EL  LM LR  EA+  I  KY     +C+RL+TSP  GL + E  +  RR  FG+N+IPP PPKTF +LMW ALQD+TLIVLM AA +SL LALYS++ G   +SHG DETEG+  WIEGVAIL AV+VVVLVTA NDWQKERQFRGLQD+IE +H+++V+R G   E++VGDIVVGDIC VKYGDLLPADG+IIQSND+KVDESSLTGEPDHVKKG  +DPM+LSGTHVMEGS KM+VTAVG+NSQAGIIF LLGA   +                     D+     P    H    +   +   +V    E+VE+ +LT T     D   NH+  N A      GD N+      +        K  +  KKK SVLQ KL +LAS IGQ+GT+VA+LTV ILIIKF + T+ F+KE W    HL + + F+IIGVTVLVVAVPEGLPLAVTISLAYSVKKMM+DNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQ Y+ G+  +    LP   +L       L+ +++INSSYTSR+      +ELP Q+GNKTECALLGFV   L  +Y D+R +WP+E L+KVYTFNS RKSMSTII+D       + + TKGASEM+L KC+FIL  NG+ QPFT    EALV+ VIEPMASDGLRTIGLAYK ++     P+ +   L   +L DL++E +++ DLT IG+VGIEDPVRPEVP AI+KCQ+AGITVRMVTGDNINTARSIA+KCGILKPGE+++V+EGKEFNNRVRDP + +++Q+LIDQVWP+LRVLARSSPQDKYTLV+GIIDSH+T  REVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSI+KFLQFQLTVN+VA+IVAF+GACFITDSPLKAVQMLWVNLIMDTLASLALATE+PTEELL+RAPYGR+KPII R MIKNI+GQ++YQLAV FYLL  G  +LDVENGRGL+E+GIN+PT+HFT IFNTFVMMTLFNE N+RKIHGQ+N+F GL  N+LF+IIWV TF  Q++IVQ+GGYA  T  L L+HWLWC+ FGIG L+W Q+I  IP+++IPK      +K P      L     V++   +   D +                 G +A+  N                            +    ++KN+GQILWIRGLSRLQTQ    N     + +R DV++
Sbjct:   15 DKFDCTMQELQGLMQLRGAEALDVITRKYDGATGLCKRLRTSPTEGLFNKE--LTQRREVFGTNVIPPTPPKTFLQLMWAALQDVTLIVLMVAAGVSLLLALYSEYFGGDNTSHGGDETEGEVSWIEGVAILCAVVVVVLVTATNDWQKERQFRGLQDKIESDHRMSVVREGEIVEVLVGDIVVGDICLVKYGDLLPADGVIIQSNDLKVDESSLTGEPDHVKKGELLDPMLLSGTHVMEGSGKMVVTAVGVNSQAGIIFTLLGATEGDATAIPPPPPTEFATQTANPNVDRNGRPTPAGHGHHGADDLNKRNASHVAFRGEDVEMGRLTAT----GDHIENHQHGNLARENGAGGDDNELSPDTDEAADLDAGAKPKKRKKKKYSVLQAKLTRLASLIGQLGTVVATLTVIILIIKFSVQTFYFDKEPWDTGRHLHQFVRFVIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMRDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQCYLGGRFTQREAELPRLNDLHHRVGHRLVHSVAINSSYTSRITVPAKSSELPQQLGNKTECALLGFVR-HLGVNYEDIREKWPQETLLKVYTFNSVRKSMSTIIKDLEPSRPGITVFTKGASEMVLKKCAFILDNNGEPQPFTQSHQEALVREVIEPMASDGLRTIGLAYKTYLNPGIDPERNEIQLSRGQLPDLDDEDSIVTDLTCIGVVGIEDPVRPEVPAAIRKCQRAGITVRMVTGDNINTARSIALKCGILKPGENYIVLEGKEFNNRVRDPKTNRVRQDLIDQVWPQLRVLARSSPQDKYTLVSGIIDSHMTTRREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNMVAIIVAFVGACFITDSPLKAVQMLWVNLIMDTLASLALATELPTEELLERAPYGRSKPIIGRTMIKNIVGQALYQLAVIFYLLWFGEQILDVENGRGLSEKGINRPTEHFTVIFNTFVMMTLFNEINARKIHGQRNIFSGLMNNILFLIIWVATFFLQVIIVQFGGYAFSTAPLPLEHWLWCLFFGIGSLVWGQVITTIPSSIIPKR----TRKPPKGRRATLVPVTDVNAPETTGLMDAEAGGPPMADGGLGHRPSTGFVAKAANVVARGLGAIYPASAPEEEEEEDEDEEHENMTGAELKNTGQILWIRGLSRLQTQIRVINAFRAGIPSRLDVLH 1249          
BLAST of Calcium-transporting ATPase vs. Ensembl Cavefish
Match: ENSAMXT00000014864.2 (pep primary_assembly:Astyanax_mexicanus-2.0:7:35306831:35359735:-1 gene:ENSAMXG00000014383.2 transcript:ENSAMXT00000014864.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 1196.8 bits (3095), Expect = 0.000e+0
Identity = 655/1158 (56.56%), Postives = 810/1158 (69.95%), Query Frame = 3
Query:  564 EETYEMNTKELTDLMMLRQQEAILEIKEKYGDVYEICRRLKTSPQSGLIDDEESIGNRRREFGSNIIPPKPPKTFFRLMWEALQDLTLIVLMGAAVISLALALY------SKFSGSSHG---DETEGDAGWIEXXXXXXXXXXXXXXTAFNDWQKERQFRGLQDQIEGNHKIAVIRGGVAKEXXXXXXXXXXXCQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDIDPMMLSGTHVMEGSAKMLVTAVGLNSQAGIIFALLGAANTEEKDKAETEKPNNQVHKTNSNSKNKGCKNVDEEVELMKLTETHPEDADRCSNHKPNNYASGDANKSEIKNGKVKQEKKVRAPKKKGSVLQLKLNKLASSIGQIGTIVASLTVTILIIKFCINTYVFEKEGWSMD----HLKKMINFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYINGQHNRTHLPSFEELSFNAADMLLKNISINSSYTSRLMATRHVNELPSQIGNKTECALLGFVNGSLKRDYADLRTQWPEEKLIKVYTFNSERKSMSTIIED-EGKLLLLTKGASEMILNKCSFILGKNGKIQPFTTEDVEALVKNVIEPMASDGLRTIGLAYKEFVKKPDHDYQGLYNEKLDLENEHTLIKDLTLIGIVGIEDPVRPEVPPAIKKCQKAGITVRMVTGDNINTARSIAIKCGILKPGEDFLVMEGKEFNNRVRDPISGKIKQELIDQVWPKLRVLARSSPQDKYTLVTGIIDSHLTRSREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFLGACFITDSPLKAVQMLWVNLIMDTLASLALATEMPTEELLDRAPYGRTKPIISRRMIKNIMGQSIYQLAVTFYLLLHGNVLLDVENGRGLTERGINKPTQHFTAIFNTFVMMTLFNEFNSRKIHGQKNVFDGLQRNVLFIIIWVTTFVGQIVIVQYGGYALHTEALELDHWLWCMLFGIGVLLWAQLINCIPTTVIPKHMPWSKKKLPTAENQALNQYKSVDSGNESEDEDYDDIGDLARQNNDEDDDDIKNSGQILWIRGLSRLQTQQNTCN 3995
            E  +  + KEL  LM LR  E I +I+E Y DV  +C RLKTSP  GL      +  R   FG N IPPK PKTF +L+WEALQD+TLI+L  AA++SL L+ Y      S   G   G   DE E +AGWIEG AIL +VI VVLVTAFNDW KE+QFRGLQ +IE   K  V+RGG   +I V +IVVGDI Q+KYGDLLPADG++IQ ND+K+DESSLTGE DHVKK ++ DPM+LSGTHVMEGS KMLVTA+G+NSQ GIIF LLGA   +++D+ + EK   +  K    +K +    +          E  P ++D  ++                     ++++K   PKK+ SVLQ KL KLA  IG+ G +++++TV ILI+ F +NT+  +   W       +++  + F IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLT NRMTVVQ+YI  +H R  +P  E +  +  D+L+  IS+N +YT+++M+      LP Q+GNKTECALLGFV   LK+DY  +R + PEEKL KVYTFNS RKSMST++++ +G   + +KGASE++L KC  IL   G+ + F   D + +VK VIEPMAS+GLRTI LAY++F   P  D +       D ENE  ++  LT + +VGIEDPVRPEVP AI+KCQ+AGITVRMVTGDNINTAR+IA KCGIL+PG+DFL +EGKEFN R+R+   G+I+QE ID++WPKLRVLARSSP DK+TLV GIIDS +   R+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNF+SIVKAVMWGRNVYDSI+KFLQFQLTVN+VAVIVAF GAC   DSPLKAVQMLWVNLIMDT ASLALATE PTE LL R PYGR KP+ISR M+KNI+G  +YQL + F LL  G  + D+++GR         P++H+T +FNTFVMM LFNE N+RKIHG++NVFDG+  N++F  I   TFV QIVIVQ+GG       L ++ WLWC+  G G LLW Q+I+ IPT+ +        K L TA +    +        E  DE+ +D+ DL   ++ E +      GQILW RGL+R+QTQ    N
Sbjct:   22 EGEFGCSLKELRGLMELRGTEGIRKIQETYADVNGLCSRLKTSPVDGLSGQPADLEKRTIVFGQNFIPPKKPKTFLQLVWEALQDVTLIILEVAAIVSLGLSFYRPPEADSTNCGEGTGGVEDEGESEAGWIEGAAILLSVICVVLVTAFNDWSKEKQFRGLQSRIEQEQKFTVVRGGQVIQIPVAEIVVGDIAQIKYGDLLPADGVLIQGNDLKIDESSLTGESDHVKKTLEKDPMLLSGTHVMEGSGKMLVTAIGVNSQTGIIFTLLGAGGEDDEDEEKEEKKKEKERKKEKKTKAQDGAAM----------EMQPLNSDEGAD--------------------AEEKRKANLPKKEKSVLQGKLTKLAVQIGKAGLVMSAITVIILIVLFIVNTFWVQGLAWEKSCTPIYIQFFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTMNRMTVVQAYIADKHYR-RVPEPEVIPGSIMDLLVLGISVNCAYTTKIMSPEKEGGLPRQVGNKTECALLGFVL-DLKKDYQPIRNEIPEEKLYKVYTFNSVRKSMSTVLKNPDGSFRMFSKGASEILLKKCYKILTATGEAKVFRPRDRDDMVKKVIEPMASEGLRTICLAYRDF---PASDGEP------DWENESDILTSLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARAIATKCGILQPGDDFLCLEGKEFNRRIRNE-KGEIEQERIDKIWPKLRVLARSSPTDKHTLVKGIIDSTVIEQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGRNVYDSISKFLQFQLTVNIVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTESLLLRKPYGRNKPLISRTMMKNILGHGVYQLTIIFTLLFAGERMFDIDSGRNAPLHA--PPSEHYTIVFNTFVMMQLFNEINARKIHGERNVFDGIFNNMIFCSIVFGTFVIQIVIVQFGGKPFSCVGLSIEQWLWCVFLGFGCLLWGQVISSIPTSRL--------KFLKTAGHGTQKE--------EIPDEELEDMEDLDEIDHAERE---LRRGQILWFRGLNRIQTQIRVVN 1116          
BLAST of Calcium-transporting ATPase vs. Ensembl Cavefish
Match: atp2b1b (plasma membrane calcium-transporting ATPase 1-like [Source:NCBI gene;Acc:103045095])

HSP 1 Score: 1176.39 bits (3042), Expect = 0.000e+0
Identity = 649/1150 (56.43%), Postives = 808/1150 (70.26%), Query Frame = 3
Query:  588 KELTDLMMLRQQEAILEIKEKYGDVYEICRRLKTSPQSGLIDDEESIGNRRREFGSNIIPPKPPKTFFRLMWEALQDLTLIVLMGAAVISLALALYS------KFSGSSHG---DETEGDAGWIEXXXXXXXXXXXXXXTAFNDWQKERQFRGLQDQIEGNHKIAVIRGGVAKEXXXXXXXXXXXCQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDIDPMMLSGTHVMEGSAKMLVTAVGLNSQAGIIFALLGAANTEEKDKAETEKPNNQVHKTNSNSKNKGCKNVDEEVELMKLTETHPEDADRCSNHKPNNYASGDANKSEIKNGKVKQEKKVRAPKKKGSVLQLKLNKLASSIGQIGTIVASLTVTILIIKFCINTYVFEKEGWSMD----HLKKMINFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYINGQHNRTHLPSFEELSFNAADMLLKNISINSSYTSRLMATRHVNELPSQIGNKTECALLGFVNGSLKRDYADLRTQWPEEKLIKVYTFNSERKSMSTIIED-EGKLLLLTKGASEMILNKCSFILGKNGKIQPFTTEDVEALVKNVIEPMASDGLRTIGLAYKEFVKKPDHDYQGLYNEKLDLENEHTLIKDLTLIGIVGIEDPVRPEVPPAIKKCQKAGITVRMVTGDNINTARSIAIKCGILKPGEDFLVMEGKEFNNRVRDPISGKIKQELIDQVWPKLRVLARSSPQDKYTLVTGIIDSHLTRSREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFLGACFITDSPLKAVQMLWVNLIMDTLASLALATEMPTEELLDRAPYGRTKPIISRRMIKNIMGQSIYQLAVTFYLLLHGNVLLDVENGRGLTERGINKPTQHFTAIFNTFVMMTLFNEFNSRKIHGQKNVFDGLQRNVLFIIIWVTTFVGQIVIVQYGGYALHTEALELDHWLWCMLFGIGVLLWAQLINCIPTTVIPKHMPWSKKKLPTAENQALNQYKSVDSGNESEDEDYDDIGDLARQNNDEDDDDIKNSGQILWIRGLSRLQTQQNTCN 3995
            KEL  LM LR  E +  I+E YGDV  +C RLK+S   GL    + I NR+  +G N IPPK PKTF +L+WEALQD+TLI+L  AA+ISL L+ Y       +  G + G   DE E +AGWIEG AIL +V+ VVLVTAFNDW KE+QFRGLQ +IE   K  V+RGG   +I V ++VVGDI QVKYGDLLPADG++IQ ND+K+DESSLTGE DHVKK +D DPM+LSGTHVMEGS KMLVTAVG+NSQ GIIF LLGA + E+ D  + ++  ++  +     K +  +   E+       +   + +D+  +       +   +  +  +G VK  KK   PKK+ SVLQ KL KLA  IG+ G  ++++TV IL++ F ++T+  +   W  D    +++  + F IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLT NRMTVVQ Y+  +H R  +P  + +     D+L+  IS+N +YT+++M       LP Q+GNKTECALLGF +  L++DY  +R ++PEEK  KVYTFNS RKSMST++ + +G   + +KGASE++L KC  IL  NG+   F   D + L+K VIEPMAS+GLRTI LAY++F          +   + D +NE  ++  LT I +VGIEDPVRPEVP AI+KCQ+AGITVRMVTGDNINTAR+IA KCGIL PG+DFL +EGKEFN R+R+ + G+I+QE ID++WPKLRVLARSSP DK+TLV GIIDS +   R+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNF+SIVKAVMWGRNVYDSI+KFLQFQLTVNVVAVIVAF GAC   DSPLKAVQMLWVNLIMDT ASLALATE PTE LL R PYGR KP+ISR M+KNI+G +IYQL + F LL  G  + D+++GR         P++H+T +FNTFVMM LFNE N+RKIHG++NVFDG+  N++F  I   TF+ QIVIVQ+GG       L ++ WLWC+  G G LLW QLI  IPT+ +        K L TA +      K     +E E+ D D+I        D  + +++  GQ+LW RGL R+QTQ    N
Sbjct:   26 KELRSLMELRGPEGLQRIQECYGDVQGLCSRLKSSCTEGLSGHSDDIANRKDVYGKNFIPPKKPKTFLQLVWEALQDVTLIILEVAAIISLGLSFYRPPDAERENCGKAAGGVEDEGEAEAGWIEGAAILLSVVCVVLVTAFNDWSKEKQFRGLQSRIEQEQKFTVVRGGQIIQIPVAELVVGDIAQVKYGDLLPADGVLIQGNDLKIDESSLTGESDHVKKTMDKDPMLLSGTHVMEGSGKMLVTAVGVNSQTGIIFTLLGAGD-EDGDNEDEKEEKDRKKREKEEKKKEKERKKKEKKGKKSKKQ---DGSDKNKSKDGGGVDTEPLSSEDGIDGDVK--KKTNLPKKEKSVLQGKLTKLAVQIGKAGLFMSAITVIILVVLFLVDTFWVQGLPWIKDCTPVYIQFFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTMNRMTVVQVYVGDRHYR-KVPEPDLIPGKIMDLLVTGISVNCAYTTKIMPPEREGGLPRQVGNKTECALLGF-SLDLRKDYQIIRNEYPEEKFFKVYTFNSVRKSMSTVLRNYDGSYRMFSKGASEILLKKCCKILTANGEPIYFKPRDRDDLMKMVIEPMASEGLRTICLAYRDF---------PVSEGEPDWDNETDILTGLTCICVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARAIATKCGILHPGDDFLCLEGKEFNRRIRNEL-GEIEQERIDRIWPKLRVLARSSPTDKHTLVKGIIDSTVVEQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTESLLLRKPYGRNKPLISRTMMKNILGHAIYQLTIIFTLLFAGEQIFDIDSGRNAPLHA--PPSEHYTIVFNTFVMMQLFNEINARKIHGERNVFDGIFNNLIFCSIVFGTFLIQIVIVQFGGKPFSCVGLSIEQWLWCVFLGFGCLLWGQLITTIPTSRL--------KFLMTAGH---GTQKEEIPEDELEEMDMDEI--------DHAEMELRR-GQVLWCRGLQRIQTQIRVVN 1135          
BLAST of Calcium-transporting ATPase vs. Ensembl Cavefish
Match: atp2b1b (plasma membrane calcium-transporting ATPase 1-like [Source:NCBI gene;Acc:103045095])

HSP 1 Score: 1176.39 bits (3042), Expect = 0.000e+0
Identity = 649/1150 (56.43%), Postives = 808/1150 (70.26%), Query Frame = 3
Query:  588 KELTDLMMLRQQEAILEIKEKYGDVYEICRRLKTSPQSGLIDDEESIGNRRREFGSNIIPPKPPKTFFRLMWEALQDLTLIVLMGAAVISLALALYS------KFSGSSHG---DETEGDAGWIEXXXXXXXXXXXXXXTAFNDWQKERQFRGLQDQIEGNHKIAVIRGGVAKEXXXXXXXXXXXCQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDIDPMMLSGTHVMEGSAKMLVTAVGLNSQAGIIFALLGAANTEEKDKAETEKPNNQVHKTNSNSKNKGCKNVDEEVELMKLTETHPEDADRCSNHKPNNYASGDANKSEIKNGKVKQEKKVRAPKKKGSVLQLKLNKLASSIGQIGTIVASLTVTILIIKFCINTYVFEKEGWSMD----HLKKMINFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYINGQHNRTHLPSFEELSFNAADMLLKNISINSSYTSRLMATRHVNELPSQIGNKTECALLGFVNGSLKRDYADLRTQWPEEKLIKVYTFNSERKSMSTIIED-EGKLLLLTKGASEMILNKCSFILGKNGKIQPFTTEDVEALVKNVIEPMASDGLRTIGLAYKEFVKKPDHDYQGLYNEKLDLENEHTLIKDLTLIGIVGIEDPVRPEVPPAIKKCQKAGITVRMVTGDNINTARSIAIKCGILKPGEDFLVMEGKEFNNRVRDPISGKIKQELIDQVWPKLRVLARSSPQDKYTLVTGIIDSHLTRSREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFLGACFITDSPLKAVQMLWVNLIMDTLASLALATEMPTEELLDRAPYGRTKPIISRRMIKNIMGQSIYQLAVTFYLLLHGNVLLDVENGRGLTERGINKPTQHFTAIFNTFVMMTLFNEFNSRKIHGQKNVFDGLQRNVLFIIIWVTTFVGQIVIVQYGGYALHTEALELDHWLWCMLFGIGVLLWAQLINCIPTTVIPKHMPWSKKKLPTAENQALNQYKSVDSGNESEDEDYDDIGDLARQNNDEDDDDIKNSGQILWIRGLSRLQTQQNTCN 3995
            KEL  LM LR  E +  I+E YGDV  +C RLK+S   GL    + I NR+  +G N IPPK PKTF +L+WEALQD+TLI+L  AA+ISL L+ Y       +  G + G   DE E +AGWIEG AIL +V+ VVLVTAFNDW KE+QFRGLQ +IE   K  V+RGG   +I V ++VVGDI QVKYGDLLPADG++IQ ND+K+DESSLTGE DHVKK +D DPM+LSGTHVMEGS KMLVTAVG+NSQ GIIF LLGA + E+ D  + ++  ++  +     K +  +   E+       +   + +D+  +       +   +  +  +G VK  KK   PKK+ SVLQ KL KLA  IG+ G  ++++TV IL++ F ++T+  +   W  D    +++  + F IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLT NRMTVVQ Y+  +H R  +P  + +     D+L+  IS+N +YT+++M       LP Q+GNKTECALLGF +  L++DY  +R ++PEEK  KVYTFNS RKSMST++ + +G   + +KGASE++L KC  IL  NG+   F   D + L+K VIEPMAS+GLRTI LAY++F          +   + D +NE  ++  LT I +VGIEDPVRPEVP AI+KCQ+AGITVRMVTGDNINTAR+IA KCGIL PG+DFL +EGKEFN R+R+ + G+I+QE ID++WPKLRVLARSSP DK+TLV GIIDS +   R+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNF+SIVKAVMWGRNVYDSI+KFLQFQLTVNVVAVIVAF GAC   DSPLKAVQMLWVNLIMDT ASLALATE PTE LL R PYGR KP+ISR M+KNI+G +IYQL + F LL  G  + D+++GR         P++H+T +FNTFVMM LFNE N+RKIHG++NVFDG+  N++F  I   TF+ QIVIVQ+GG       L ++ WLWC+  G G LLW QLI  IPT+ +        K L TA +      K     +E E+ D D+I        D  + +++  GQ+LW RGL R+QTQ    N
Sbjct:   26 KELRSLMELRGPEGLQRIQECYGDVQGLCSRLKSSCTEGLSGHSDDIANRKDVYGKNFIPPKKPKTFLQLVWEALQDVTLIILEVAAIISLGLSFYRPPDAERENCGKAAGGVEDEGEAEAGWIEGAAILLSVVCVVLVTAFNDWSKEKQFRGLQSRIEQEQKFTVVRGGQIIQIPVAELVVGDIAQVKYGDLLPADGVLIQGNDLKIDESSLTGESDHVKKTMDKDPMLLSGTHVMEGSGKMLVTAVGVNSQTGIIFTLLGAGD-EDGDNEDEKEEKDRKKREKEEKKKEKERKKKEKKGKKSKKQ---DGSDKNKSKDGGGVDTEPLSSEDGIDGDVK--KKTNLPKKEKSVLQGKLTKLAVQIGKAGLFMSAITVIILVVLFLVDTFWVQGLPWIKDCTPVYIQFFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTMNRMTVVQVYVGDRHYR-KVPEPDLIPGKIMDLLVTGISVNCAYTTKIMPPEREGGLPRQVGNKTECALLGF-SLDLRKDYQIIRNEYPEEKFFKVYTFNSVRKSMSTVLRNYDGSYRMFSKGASEILLKKCCKILTANGEPIYFKPRDRDDLMKMVIEPMASEGLRTICLAYRDF---------PVSEGEPDWDNETDILTGLTCICVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARAIATKCGILHPGDDFLCLEGKEFNRRIRNEL-GEIEQERIDRIWPKLRVLARSSPTDKHTLVKGIIDSTVVEQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTESLLLRKPYGRNKPLISRTMMKNILGHAIYQLTIIFTLLFAGEQIFDIDSGRNAPLHA--PPSEHYTIVFNTFVMMQLFNEINARKIHGERNVFDGIFNNLIFCSIVFGTFLIQIVIVQFGGKPFSCVGLSIEQWLWCVFLGFGCLLWGQLITTIPTSRL--------KFLMTAGH---GTQKEEIPEDELEEMDMDEI--------DHAEMELRR-GQVLWCRGLQRIQTQIRVVN 1135          
BLAST of Calcium-transporting ATPase vs. Ensembl Cavefish
Match: atp2b1b (plasma membrane calcium-transporting ATPase 1-like [Source:NCBI gene;Acc:103045095])

HSP 1 Score: 1176.39 bits (3042), Expect = 0.000e+0
Identity = 649/1150 (56.43%), Postives = 808/1150 (70.26%), Query Frame = 3
Query:  588 KELTDLMMLRQQEAILEIKEKYGDVYEICRRLKTSPQSGLIDDEESIGNRRREFGSNIIPPKPPKTFFRLMWEALQDLTLIVLMGAAVISLALALYS------KFSGSSHG---DETEGDAGWIEXXXXXXXXXXXXXXTAFNDWQKERQFRGLQDQIEGNHKIAVIRGGVAKEXXXXXXXXXXXCQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDIDPMMLSGTHVMEGSAKMLVTAVGLNSQAGIIFALLGAANTEEKDKAETEKPNNQVHKTNSNSKNKGCKNVDEEVELMKLTETHPEDADRCSNHKPNNYASGDANKSEIKNGKVKQEKKVRAPKKKGSVLQLKLNKLASSIGQIGTIVASLTVTILIIKFCINTYVFEKEGWSMD----HLKKMINFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYINGQHNRTHLPSFEELSFNAADMLLKNISINSSYTSRLMATRHVNELPSQIGNKTECALLGFVNGSLKRDYADLRTQWPEEKLIKVYTFNSERKSMSTIIED-EGKLLLLTKGASEMILNKCSFILGKNGKIQPFTTEDVEALVKNVIEPMASDGLRTIGLAYKEFVKKPDHDYQGLYNEKLDLENEHTLIKDLTLIGIVGIEDPVRPEVPPAIKKCQKAGITVRMVTGDNINTARSIAIKCGILKPGEDFLVMEGKEFNNRVRDPISGKIKQELIDQVWPKLRVLARSSPQDKYTLVTGIIDSHLTRSREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFLGACFITDSPLKAVQMLWVNLIMDTLASLALATEMPTEELLDRAPYGRTKPIISRRMIKNIMGQSIYQLAVTFYLLLHGNVLLDVENGRGLTERGINKPTQHFTAIFNTFVMMTLFNEFNSRKIHGQKNVFDGLQRNVLFIIIWVTTFVGQIVIVQYGGYALHTEALELDHWLWCMLFGIGVLLWAQLINCIPTTVIPKHMPWSKKKLPTAENQALNQYKSVDSGNESEDEDYDDIGDLARQNNDEDDDDIKNSGQILWIRGLSRLQTQQNTCN 3995
            KEL  LM LR  E +  I+E YGDV  +C RLK+S   GL    + I NR+  +G N IPPK PKTF +L+WEALQD+TLI+L  AA+ISL L+ Y       +  G + G   DE E +AGWIEG AIL +V+ VVLVTAFNDW KE+QFRGLQ +IE   K  V+RGG   +I V ++VVGDI QVKYGDLLPADG++IQ ND+K+DESSLTGE DHVKK +D DPM+LSGTHVMEGS KMLVTAVG+NSQ GIIF LLGA + E+ D  + ++  ++  +     K +  +   E+       +   + +D+  +       +   +  +  +G VK  KK   PKK+ SVLQ KL KLA  IG+ G  ++++TV IL++ F ++T+  +   W  D    +++  + F IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLT NRMTVVQ Y+  +H R  +P  + +     D+L+  IS+N +YT+++M       LP Q+GNKTECALLGF +  L++DY  +R ++PEEK  KVYTFNS RKSMST++ + +G   + +KGASE++L KC  IL  NG+   F   D + L+K VIEPMAS+GLRTI LAY++F          +   + D +NE  ++  LT I +VGIEDPVRPEVP AI+KCQ+AGITVRMVTGDNINTAR+IA KCGIL PG+DFL +EGKEFN R+R+ + G+I+QE ID++WPKLRVLARSSP DK+TLV GIIDS +   R+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNF+SIVKAVMWGRNVYDSI+KFLQFQLTVNVVAVIVAF GAC   DSPLKAVQMLWVNLIMDT ASLALATE PTE LL R PYGR KP+ISR M+KNI+G +IYQL + F LL  G  + D+++GR         P++H+T +FNTFVMM LFNE N+RKIHG++NVFDG+  N++F  I   TF+ QIVIVQ+GG       L ++ WLWC+  G G LLW QLI  IPT+ +        K L TA +      K     +E E+ D D+I        D  + +++  GQ+LW RGL R+QTQ    N
Sbjct:   26 KELRSLMELRGPEGLQRIQECYGDVQGLCSRLKSSCTEGLSGHSDDIANRKDVYGKNFIPPKKPKTFLQLVWEALQDVTLIILEVAAIISLGLSFYRPPDAERENCGKAAGGVEDEGEAEAGWIEGAAILLSVVCVVLVTAFNDWSKEKQFRGLQSRIEQEQKFTVVRGGQIIQIPVAELVVGDIAQVKYGDLLPADGVLIQGNDLKIDESSLTGESDHVKKTMDKDPMLLSGTHVMEGSGKMLVTAVGVNSQTGIIFTLLGAGD-EDGDNEDEKEEKDRKKREKEEKKKEKERKKKEKKGKKSKKQ---DGSDKNKSKDGGGVDTEPLSSEDGIDGDVK--KKTNLPKKEKSVLQGKLTKLAVQIGKAGLFMSAITVIILVVLFLVDTFWVQGLPWIKDCTPVYIQFFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTMNRMTVVQVYVGDRHYR-KVPEPDLIPGKIMDLLVTGISVNCAYTTKIMPPEREGGLPRQVGNKTECALLGF-SLDLRKDYQIIRNEYPEEKFFKVYTFNSVRKSMSTVLRNYDGSYRMFSKGASEILLKKCCKILTANGEPIYFKPRDRDDLMKMVIEPMASEGLRTICLAYRDF---------PVSEGEPDWDNETDILTGLTCICVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARAIATKCGILHPGDDFLCLEGKEFNRRIRNEL-GEIEQERIDRIWPKLRVLARSSPTDKHTLVKGIIDSTVVEQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTESLLLRKPYGRNKPLISRTMMKNILGHAIYQLTIIFTLLFAGEQIFDIDSGRNAPLHA--PPSEHYTIVFNTFVMMQLFNEINARKIHGERNVFDGIFNNLIFCSIVFGTFLIQIVIVQFGGKPFSCVGLSIEQWLWCVFLGFGCLLWGQLITTIPTSRL--------KFLMTAGH---GTQKEEIPEDELEEMDMDEI--------DHAEMELRR-GQVLWCRGLQRIQTQIRVVN 1135          
BLAST of Calcium-transporting ATPase vs. Ensembl Cavefish
Match: atp2b1b (plasma membrane calcium-transporting ATPase 1-like [Source:NCBI gene;Acc:103045095])

HSP 1 Score: 1176.39 bits (3042), Expect = 0.000e+0
Identity = 649/1150 (56.43%), Postives = 808/1150 (70.26%), Query Frame = 3
Query:  588 KELTDLMMLRQQEAILEIKEKYGDVYEICRRLKTSPQSGLIDDEESIGNRRREFGSNIIPPKPPKTFFRLMWEALQDLTLIVLMGAAVISLALALYS------KFSGSSHG---DETEGDAGWIEXXXXXXXXXXXXXXTAFNDWQKERQFRGLQDQIEGNHKIAVIRGGVAKEXXXXXXXXXXXCQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDIDPMMLSGTHVMEGSAKMLVTAVGLNSQAGIIFALLGAANTEEKDKAETEKPNNQVHKTNSNSKNKGCKNVDEEVELMKLTETHPEDADRCSNHKPNNYASGDANKSEIKNGKVKQEKKVRAPKKKGSVLQLKLNKLASSIGQIGTIVASLTVTILIIKFCINTYVFEKEGWSMD----HLKKMINFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYINGQHNRTHLPSFEELSFNAADMLLKNISINSSYTSRLMATRHVNELPSQIGNKTECALLGFVNGSLKRDYADLRTQWPEEKLIKVYTFNSERKSMSTIIED-EGKLLLLTKGASEMILNKCSFILGKNGKIQPFTTEDVEALVKNVIEPMASDGLRTIGLAYKEFVKKPDHDYQGLYNEKLDLENEHTLIKDLTLIGIVGIEDPVRPEVPPAIKKCQKAGITVRMVTGDNINTARSIAIKCGILKPGEDFLVMEGKEFNNRVRDPISGKIKQELIDQVWPKLRVLARSSPQDKYTLVTGIIDSHLTRSREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFLGACFITDSPLKAVQMLWVNLIMDTLASLALATEMPTEELLDRAPYGRTKPIISRRMIKNIMGQSIYQLAVTFYLLLHGNVLLDVENGRGLTERGINKPTQHFTAIFNTFVMMTLFNEFNSRKIHGQKNVFDGLQRNVLFIIIWVTTFVGQIVIVQYGGYALHTEALELDHWLWCMLFGIGVLLWAQLINCIPTTVIPKHMPWSKKKLPTAENQALNQYKSVDSGNESEDEDYDDIGDLARQNNDEDDDDIKNSGQILWIRGLSRLQTQQNTCN 3995
            KEL  LM LR  E +  I+E YGDV  +C RLK+S   GL    + I NR+  +G N IPPK PKTF +L+WEALQD+TLI+L  AA+ISL L+ Y       +  G + G   DE E +AGWIEG AIL +V+ VVLVTAFNDW KE+QFRGLQ +IE   K  V+RGG   +I V ++VVGDI QVKYGDLLPADG++IQ ND+K+DESSLTGE DHVKK +D DPM+LSGTHVMEGS KMLVTAVG+NSQ GIIF LLGA + E+ D  + ++  ++  +     K +  +   E+       +   + +D+  +       +   +  +  +G VK  KK   PKK+ SVLQ KL KLA  IG+ G  ++++TV IL++ F ++T+  +   W  D    +++  + F IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLT NRMTVVQ Y+  +H R  +P  + +     D+L+  IS+N +YT+++M       LP Q+GNKTECALLGF +  L++DY  +R ++PEEK  KVYTFNS RKSMST++ + +G   + +KGASE++L KC  IL  NG+   F   D + L+K VIEPMAS+GLRTI LAY++F          +   + D +NE  ++  LT I +VGIEDPVRPEVP AI+KCQ+AGITVRMVTGDNINTAR+IA KCGIL PG+DFL +EGKEFN R+R+ + G+I+QE ID++WPKLRVLARSSP DK+TLV GIIDS +   R+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNF+SIVKAVMWGRNVYDSI+KFLQFQLTVNVVAVIVAF GAC   DSPLKAVQMLWVNLIMDT ASLALATE PTE LL R PYGR KP+ISR M+KNI+G +IYQL + F LL  G  + D+++GR         P++H+T +FNTFVMM LFNE N+RKIHG++NVFDG+  N++F  I   TF+ QIVIVQ+GG       L ++ WLWC+  G G LLW QLI  IPT+ +        K L TA +      K     +E E+ D D+I        D  + +++  GQ+LW RGL R+QTQ    N
Sbjct:   26 KELRSLMELRGPEGLQRIQECYGDVQGLCSRLKSSCTEGLSGHSDDIANRKDVYGKNFIPPKKPKTFLQLVWEALQDVTLIILEVAAIISLGLSFYRPPDAERENCGKAAGGVEDEGEAEAGWIEGAAILLSVVCVVLVTAFNDWSKEKQFRGLQSRIEQEQKFTVVRGGQIIQIPVAELVVGDIAQVKYGDLLPADGVLIQGNDLKIDESSLTGESDHVKKTMDKDPMLLSGTHVMEGSGKMLVTAVGVNSQTGIIFTLLGAGD-EDGDNEDEKEEKDRKKREKEEKKKEKERKKKEKKGKKSKKQ---DGSDKNKSKDGGGVDTEPLSSEDGIDGDVK--KKTNLPKKEKSVLQGKLTKLAVQIGKAGLFMSAITVIILVVLFLVDTFWVQGLPWIKDCTPVYIQFFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTMNRMTVVQVYVGDRHYR-KVPEPDLIPGKIMDLLVTGISVNCAYTTKIMPPEREGGLPRQVGNKTECALLGF-SLDLRKDYQIIRNEYPEEKFFKVYTFNSVRKSMSTVLRNYDGSYRMFSKGASEILLKKCCKILTANGEPIYFKPRDRDDLMKMVIEPMASEGLRTICLAYRDF---------PVSEGEPDWDNETDILTGLTCICVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARAIATKCGILHPGDDFLCLEGKEFNRRIRNEL-GEIEQERIDRIWPKLRVLARSSPTDKHTLVKGIIDSTVVEQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTESLLLRKPYGRNKPLISRTMMKNILGHAIYQLTIIFTLLFAGEQIFDIDSGRNAPLHA--PPSEHYTIVFNTFVMMQLFNEINARKIHGERNVFDGIFNNLIFCSIVFGTFLIQIVIVQFGGKPFSCVGLSIEQWLWCVFLGFGCLLWGQLITTIPTSRL--------KFLMTAGH---GTQKEEIPEDELEEMDMDEI--------DHAEMELRR-GQVLWCRGLQRIQTQIRVVN 1135          
BLAST of Calcium-transporting ATPase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007912.1 (pep scaffold:Pmarinus_7.0:GL490738:3481:17315:-1 gene:ENSPMAG00000007146.1 transcript:ENSPMAT00000007912.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 450.284 bits (1157), Expect = 2.739e-144
Identity = 230/410 (56.10%), Postives = 298/410 (72.68%), Query Frame = 3
Query: 1578 KQEKKVRAPKKKGSVLQLKLNKLASSIGQIGTIVASLTVTILIIKFCINTYVFEKEGWSMD----HLKKMINFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYINGQHNRTHLPSFEELSFNAADMLLKNISINSSYTSRLMATRHVNELPSQIGNKTECALLGFVNGSLKRDYADLRTQWPEEKLIKVYTFNSERKSMSTIIED-EGKLLLLTKGASEMILNKCSFILGKNGKIQPFTTEDVEALVKNVIEPMASDGLRTIGLAYKEFVKKPDHDYQGLYNEKLDLENEHTLIKDLTLIGIVGIEDPVRPEVPPAIKKCQKAGITVRMVTGDNINTARSIAIKCGILKPGEDFLVMEGKEFNNRVRD 2792
            K++K+    KK+ SVLQ KL KLA  IG+ G +++++TV IL++ F I T+  +   W  +    +++  + F IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQ+Y+   H    +PS + L+    D+L   I++N +YT++++       LP Q+GNKTECALLG +   ++RDY  +R + PEE+L KVYTFNS RKSMST++ + +G   L +KGASE++L KCS ILG  G+ + F   D + +V+ VIEPMA DGLRTI LAY++F    +  +          ++E+ ++ +LT + +VGIEDPVRPEVP AIK CQ+AGITVRMVTGDNINTAR+IA KCGIL P EDFL +EGKEFN R+R+
Sbjct:   26 KEKKRSNVTKKEKSVLQGKLTKLAVQIGKAGLVMSAITVVILVLYFVIETFWVQGMPWLPECTPIYVQFFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAYVGDVH-YCSVPSPDALAPAIMDVLTTGIAVNCAYTTKILPPEKEGGLPRQVGNKTECALLGLL-AEMRRDYQAVRDELPEERLYKVYTFNSVRKSMSTVLHNADGGFRLYSKGASEILLKKCSRILGATGETRGFRLRDRDEMVRKVIEPMACDGLRTICLAYRDFPIGSEPKW----------DDENAIVNELTCVTVVGIEDPVRPEVPNAIKMCQRAGITVRMVTGDNINTARAIASKCGILHPNEDFLCIEGKEFNRRIRN 423          
BLAST of Calcium-transporting ATPase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007505.1 (pep scaffold:Pmarinus_7.0:GL487901:1873:6828:1 gene:ENSPMAG00000006781.1 transcript:ENSPMAT00000007505.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 265.774 bits (678), Expect = 2.031e-82
Identity = 131/154 (85.06%), Postives = 137/154 (88.96%), Query Frame = 3
Query: 2949 DGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFLGACFITDSPLKAVQMLWVNLIMDTLASLALATEMPTEELLDRAPYGRTKPIISRRMIKNIMGQSIYQLAVTFYLLLHG 3410
            DGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNF+SIVKAVMWGRNVYDSI+KFLQFQLTVNVVAVIVAF GAC   DSPLKAVQMLWVNLIMDTLASLALATE PTE LL R PYGR KP++SR M KNI+G +IYQL V F LL  G
Sbjct:    1 DGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTLASLALATEPPTEALLLRRPYGRNKPLVSRTMTKNILGHAIYQLTVIFTLLFAG 154          
BLAST of Calcium-transporting ATPase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002775.1 (pep scaffold:Pmarinus_7.0:GL486089:3809:7949:1 gene:ENSPMAG00000002528.1 transcript:ENSPMAT00000002775.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 243.047 bits (619), Expect = 3.775e-73
Identity = 141/233 (60.52%), Postives = 171/233 (73.39%), Query Frame = 3
Query:  702 GLIDDEESIGNRRREFGSNIIPPKPPKTFFRLMWEALQDLTLIVLMGAAVISLALALY-------SKFSGSSHG--DETEGDAGWIEXXXXXXXXXXXXXXTAFNDWQKERQFRGLQDQIEGNHKIAVIRGGVAKEXXXXXXXXXXXCQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDIDPMMLSGTHVMEGSAKMLVTAVGLNSQAGIIFALLGAANTEEKDK 1373
            GL  D E +  RR+ FG N IPPK PK+F  L+W ALQD+TLI+L  AAV+SL L+ Y       ++  G S G  +E   D GWIEG AIL  V+VVVLVTAFNDW KERQFRGLQ +IE   K +VIRGG   E+ V ++VVGD+ QVKYGDLLPADG+++Q N++ VDESSLTGE DH+ K  D DPM+LSGTHVMEGS +M+VTAVG+NSQ+GIIF LLGA + E  DK
Sbjct:    1 GLSGDPEDLEWRRKTFGRNHIPPKKPKSFVALVWHALQDVTLIILEVAAVVSLGLSFYRPPEGENTELCGQSSGSIEEAGSDTGWIEGTAILLTVVVVVLVTAFNDWSKERQFRGLQSRIEQEQKFSVIRGGQLVEVHVAELVVGDVAQVKYGDLLPADGVLLQGNELSVDESSLTGESDHLSKSPDCDPMLLSGTHVMEGSGRMVVTAVGINSQSGIIFTLLGATSGESSDK 233          
BLAST of Calcium-transporting ATPase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001468.1 (pep scaffold:Pmarinus_7.0:GL477283:10882:33618:1 gene:ENSPMAG00000001326.1 transcript:ENSPMAT00000001468.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 232.261 bits (591), Expect = 4.151e-69
Identity = 139/238 (58.40%), Postives = 165/238 (69.33%), Query Frame = 3
Query:  573 YEMNTKELTDLMMLRQQEAILEIKEKYGDVYEICRRLKTSPQSGLIDDEESIGNRRREFGSNIIPPKPPKTFFRLMWEALQDLTLIVLMGAAVISLALALY------SKFSGSSHG---DETEGDAGWIEXXXXXXXXXXXXXXTAFNDWQKERQFRGLQDQIEGNHKIAVIRGGVAKEXXXXXXXXXXXCQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDIDPMMLSG 1259
            + ++  EL  LM LR  EAI  ++E YG    +CRRL TSP  GL      +  RR  FG N IPPK PKTF  L+WEALQD+TLI+L  AA++SL L+ Y      S   GS  G   DE E  AGWIEG AIL +V  VVLVTAFNDW KERQFRGLQ +IE   + +VIRGG   ++ V DIVVGDI QVKYGDLLPADG++IQSND+K+DESSLTGE DHV+K +D DPM+LSG
Sbjct:   26 FGLSVDELRALMELRGPEAIAMVQEAYGGKEGVCRRLHTSPNDGLPGTAADLEKRRLVFGQNFIPPKKPKTFLELVWEALQDVTLIILEIAAIVSLGLSFYQPPGQNSDMCGSVSGGAEDEGESAAGWIEGAAILLSVACVVLVTAFNDWSKERQFRGLQSRIEQEQRFSVIRGGQLLQLPVADIVVGDIAQVKYGDLLPADGMLIQSNDLKIDESSLTGESDHVRKSIDRDPMLLSG 263          
BLAST of Calcium-transporting ATPase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010087.1 (pep scaffold:Pmarinus_7.0:GL482626:10460:17067:1 gene:ENSPMAG00000009128.1 transcript:ENSPMAT00000010087.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 220.705 bits (561), Expect = 3.899e-65
Identity = 137/235 (58.30%), Postives = 167/235 (71.06%), Query Frame = 3
Query:  591 ELTDLMMLRQQEAILEIKEKYGDVYEICRRLKTSPQSGLIDDEESIGNRRREFGSNIIPPKPPKTFFRLMWEALQDLTLIVLMGAAVISLALALYSKFSGSSHGDET------------EGDAGWIEXXXXXXXXXXXXXXTAFNDWQKERQFRGLQDQIEGNHKIAVIRGGVAKEXXXXXXXXXXXCQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDIDPMMLSG 1259
            EL  LM LR + A+ +I++KY DV  +CRRLKTSP  GL D    +  RR+ FG N+IPP+  K+F  L+WEALQD+TLI+L  AA++SL L+ Y     SS  DE             E +AGWIEGVAIL +V VVVLVTAFNDW KERQFRGLQ++IE   K AV+R G   +I V +I VGD+ QVKYGDLLPADG++IQSND+K+DESSLTGE DHVKK  D DPM+LSG
Sbjct:   28 ELRSLMELRGETALHDIQQKYTDVPGLCRRLKTSPTDGLSDSVSDLERRRQAFGRNVIPPQKAKSFLELVWEALQDVTLIILEIAAIVSLGLSFYRPPEESS--DECGMLAGGGGGDDGEAEAGWIEGVAILFSVAVVVLVTAFNDWSKERQFRGLQNRIEQEQKFAVVRNGQVVQIPVAEISVGDVAQVKYGDLLPADGVLIQSNDLKIDESSLTGESDHVKKSADRDPMLLSG 260          
BLAST of Calcium-transporting ATPase vs. Ensembl Yeast
Match: PMC1 (Vacuolar Ca2+ ATPase involved in depleting cytosol of Ca2+ ions; prevents growth inhibition by activation of calcineurin in the presence of elevated concentrations of calcium; similar to mammalian PMCA1a [Source:SGD;Acc:S000002974])

HSP 1 Score: 418.313 bits (1074), Expect = 3.473e-124
Identity = 306/827 (37.00%), Postives = 425/827 (51.39%), Query Frame = 3
Query: 1623 LQLKLNKLASSIGQIGTIVASLTVTILIIKFCINTYVFEKEGWSMD-----HLKKMINFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYINGQH--NRTHLPSFEELSFNA-----------------ADMLL--------------------KNISINSSY----TSRLMATRHVNELPSQ---------------IGNKTECALLGFVNGSLKRDYADL---RTQWPE----EKLIKVYTFNSERKSMSTIIE-DEGK-----LLLLTKGASEMILNKCSFILGKNGKIQPFTTEDVEALVKNVIEPMASDGLRTIGLAYKEFVK----KP----DHDYQGLYNEKLDLENEHTLIKDLTLIGIVGIEDPVRPEVPPAIKKCQKAGITVRMVTGDNINTARSIAIKCGILK---PGEDFLVMEGKEF-----NNRVRDPISGKIKQELIDQVWPKLRVLARSSPQDKYTLVTGIIDSHLTRSREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFLGACFITD--SPLKAVQMLWVNLIMDTLASLALATEMPTEELLDRAPYGRTKPIISRRMIKNIMGQSIYQLAVTFYLLLHGNVLLDVENGRGLTERGINKPTQHFTAIFNTFVMMTLFNEFNSRKIH--------------GQKNVFDGLQRNVLFIIIWVTTFVGQIVIVQYGGYALHTEALELDHWLWCMLFGIGVLLWAQLINCIPTTVIPKHMP 3779
            LQL L++LA +I   G + A +   +L  ++    Y+  ++G   D        K +N  I  +TV+VVAVPEGLPLAVT++LA++  +M KD NLVR L +CETMG+ATA+CSDKTGTLT N MTVV+ +       +   LP  E+   N+                 A+++L                    KN+S N S+     SRL   +  N    +               IG+KTE ALL     SL     +L   R Q  E    EK+++   F S RK    +++  EGK          KGA+E++   CS+    +  ++    ED +    + I+ +ASD LR I +A+K+F +     P    D D   +    L   ++  LI D    G++GI+DP+R  V  ++++CQ+AG+TVRMVTGDNI TA++IA  C IL      E +  MEG EF     N R+R              + P LRVLARSSP+DK  LV       L    +VVAVTGDGTND PALK ADVGF+MGI+GT+VA+EASDIIL  D+F++IV A+ WGR V  SI KF+QFQL VN+ AVI+ F+ +   +D  S L AVQ+LW+NLIMDTLA+LALAT+ P   ++DR P GR+  +IS    K I+ Q+  QL VTF L  +G  L   ++   +T    ++  Q     FNTFV +  F    SRK+                  N F  L RN  F+ I       Q++I+ +GG            W+  +L G+  L+   L+   P  V  K  P
Sbjct:  333 LQLHLSQLADNISVYGCVSAIILFLVLFTRYLF--YIIPEDGRFHDLDPAQKGSKFMNIFITSITVIVVAVPEGLPLAVTLALAFATTRMTKDGNLVRVLRSCETMGSATAVCSDKTGTLTENVMTVVRGFPGNSKFDDSKSLPVSEQRKLNSKKVFEENCSSSLRNDLLANIVLNSTAFENRDYKKNDKNTNGSKNMSKNLSFLDKCKSRLSFFKKGNREDDEDQLFKNVNKGRQEPFIGSKTETALLSLARLSLGLQPGELQYLRDQPMEKFNIEKVVQTIPFESSRKWAGLVVKYKEGKNKKPFYRFFIKGAAEIVSKNCSYKRNSDDTLEEIN-EDNKKETDDEIKNLASDALRAISVAHKDFCECDSWPPEQLRDKDSPNIAALDLLFNSQKGLILD----GLLGIQDPLRAGVRESVQQCQRAGVTVRMVTGDNILTAKAIARNCAILSTDISSEAYSAMEGTEFRKLTKNERIR--------------ILPNLRVLARSSPEDKRLLV-----ETLKGMGDVVAVTGDGTNDAPALKLADVGFSMGISGTEVAREASDIILMTDDFSAIVNAIKWGRCVSVSIKKFIQFQLIVNITAVILTFVSSVASSDETSVLTAVQLLWINLIMDTLAALALATDKPDPNIMDRKPRGRSTSLISVSTWKMILSQATLQLIVTFILHFYGPELFFKKHEDEITS---HQQQQLNAMTFNTFVWLQFFTMLVSRKLDEGDGISNWRGRISAANLNFFQDLGRNYYFLTIMAIIGSCQVLIMFFGGAPFSIARQTKSMWITAVLCGMLSLIMGVLVRICPDEVAVKVFP 1130          

HSP 2 Score: 97.0561 bits (240), Expect = 1.417e-20
Identity = 101/305 (33.11%), Postives = 157/305 (51.48%), Query Frame = 3
Query:  567 ETYEMNTKELTDLMMLRQQEAILEIKEKYGDVYE---ICRRLKTSPQSGLIDDEES---IGNRRREFGSNIIPPKPPKTFFRLMWEALQDLTLIVLMGAAVISLALALYSKFSGSSHGDETEGD----AGWIEXXXXXXXXXXXXXXTAFNDWQKERQFRGLQDQIEGNHKIAVIRGGVAKEXXXXXXXXXXXCQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVK-----------------------KGVDI-----------DPMMLSGTHVMEGSAKMLVTAVGLNSQAGIIFALLGA 1349
            + ++++  +L+DL      ++I      +G  YE   + + LKT   +G+   E S     NR + +G N +P + PK+F +L+W A  D T+ +L  AAV+S  L LY  +      D  EG+      WIEGVAI+ AV VVVLV+A ND+QKE QF  L  + E N KI VIR      I +  ++VGD+  ++ GD++PAD ++I S   + DESS+TGE + ++                       K +DI           D M++SG+ ++ G  + ++T+VG+NS  G     L A
Sbjct:   30 DNFKLSKSQLSDL---HNPKSIRSFVRLFG--YESNSLFKYLKTDKNAGISLPEISNYRKTNRYKNYGDNSLPERIPKSFLQLVWAAFNDKTMQLLTVAAVVSFVLGLYELWMQPPQYD-PEGNKIKQVDWIEGVAIMIAVFVVVLVSAANDYQKELQFAKLNKKKE-NRKIIVIRNDQEILISIHHVLVGDVISLQTGDVVPADCVMI-SGKCEADESSITGESNTIQKFPVDNSLRDFKKFNSIDSHNHSKPLDIGDVNEDGNKIADCMLISGSRILSGLGRGVITSVGINSVYGQTMTSLNA 326          
BLAST of Calcium-transporting ATPase vs. Ensembl Yeast
Match: PMR1 (High affinity Ca2+/Mn2+ P-type ATPase; required for Ca2+ and Mn2+ transport into Golgi; involved in Ca2+ dependent protein sorting, processing; D53A mutant (Mn2+ transporting) is rapamycin sensitive, Q783A mutant (Ca2+ transporting) is rapamycin resistant; Mn2+ transport into Golgi lumen required for rapamycin sensitivity; mutations in human homolog ATP2C1 cause acantholytic skin condition Hailey-Hailey disease; human ATP2C1 can complement yeast null mutant [Source:SGD;Acc:S000003135])

HSP 1 Score: 288.5 bits (737), Expect = 1.894e-81
Identity = 218/702 (31.05%), Postives = 353/702 (50.28%), Query Frame = 3
Query: 1605 KKKGSVLQLKLNKLASSIGQIGTIVASLTVTILIIKFCINTYVFEKEGWSMDHLKKMINFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSY-INGQHNRTHLPSFEE--------------LSFNAADML-LKNISINSSYTSRLMATRHVNELPSQIGNKTECALLGFVNGSLKRDYADLRTQWPEEKLIKVYTFNSERKSMSTIIED--EGKLLLLTKGASEMILNKCSFILGKNGKIQPFTTEDVEALVKNVIEPMASDGLRTIGLAYKEFVKKPDHDYQGLYNEKLDLENEHT-----LIKDLTLIGIVGIEDPVRPEVPPAIKKCQKAGITVRMVTGDNINTARSIAIKCGILKPGEDFLVMEGKEFNNRVRDPISGKIKQELIDQVWPKLRVLARSSPQDKYTLVTGIIDSHLTRSREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFLGACFITDSPLKAVQMLWVNLIMDTLASLALATEMPTEELLDRAPYGRTKPIISRRMIKNIMGQSIYQLAVTFYLLLHGNVLLDVENGRGLTERGINKPTQHFTAIFNTFVMMTLFNEFNSRKIHGQKNVFD-GLQRNVLFIIIWVTTFVGQIVIV 3638
            +K  + LQL ++KL   +  +  IV  +   + II         +   W        +    I V++ V A+PEGLP+ VT++LA  V +M K   +VR L + ET+G+   ICSDKTGTLT+N MTV + + ++   N+ ++ S ++              L+ +  + L + N+  N+S++          E    +GN T+ ALL  +      +  D+R    +   ++   FNS+RK M+T I +  + K  +  KGA E IL   +  L   GK     TE  +A +      MAS+GLR  G A                  KL L +  T     LIKDLT  G++G+ DP RP V  AI++  + G+ + M+TGD+ NTA +IA + GI        V+ G + +    D ++      +ID V     + AR++P+ K  +V       L +  +VVA+TGDG ND PALK +D+G +MG  GTDVAKEASD++LTDD+F++I+ A+  G+ ++++I  FL FQL+ +V A+ +  L   F   +PL A+Q+LW+N++MD   + +L  E    E++ + P  RT  I++  ++K ++  +   +  T Y+ +        E+G+ +T R         T  F  FV   +FN    R  H  K++F+ G   N +F      + +GQ+  +
Sbjct:  273 EKPKTPLQLTMDKLGKDLSLVSFIVIGMICLVGII---------QGRSW--------LEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKLWCLDSMSNKLNVLSLDKNKKTKNSNGNLKNYLTEDVRETLTIGNLCNNASFS---------QEHAIFLGNPTDVALLEQLANF---EMPDIRNTVQK---VQELPFNSKRKLMATKILNPVDNKCTVYVKGAFERILEYSTSYLKSKGKKTEKLTEAQKATINECANSMASEGLRVFGFA------------------KLTLSDSSTPLTEDLIKDLTFTGLIGMNDPPRPNVKFAIEQLLQGGVHIIMITGDSENTAVNIAKQIGIPVIDPKLSVLSGDKLDEMSDDQLAN-----VIDHV----NIFARATPEHKLNIVRA-----LRKRGDVVAMTGDGVNDAPALKLSDIGVSMGRIGTDVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQNFLTFQLSTSVAALSLVALSTAFKLPNPLNAMQILWINILMDGPPAQSLGVEPVDHEVMKKPPRKRTDKILTHDVMKRLLTTAACIIVGTVYIFVKEM----AEDGK-VTARDT-------TMTFTCFVFFDMFNALACR--HNTKSIFEIGFFTNKMFNYAVGLSLLGQMCAI 896          
BLAST of Calcium-transporting ATPase vs. Ensembl Yeast
Match: ENA2 (P-type ATPase sodium pump; involved in Na+ efflux to allow salt tolerance; likely not involved in Li+ efflux [Source:SGD;Acc:S000002446])

HSP 1 Score: 214.157 bits (544), Expect = 1.023e-56
Identity = 142/390 (36.41%), Postives = 208/390 (53.33%), Query Frame = 3
Query: 2250 IKVYTFNSERKSMSTIIEDEGK--LLLLTKGASEMILNKCSFILGKNG-KIQPFTTEDVEALVKNVIEPMASDGLRTIGLAYKEFVKKPDHDYQGLYNEKLDLENEHTLIKDLTLIGIVGIEDPVRPEVPPAIKKCQKAGITVRMVTGDNINTARSIAIKCGILKPG--------EDFLVMEGKEFNNRVRDPISGKIKQELIDQVWPKLRVLARSSPQDKYTLVTGIIDSHLTRSREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFLGACFITDS-----PLKAVQMLWVNLIMDTLASLALATEMPTEELLDRAPYGRTKPIISRRMIKNIMGQSI 3371
            I  + F+S  K MS++  +       +  KGA E I++ CS   GK+G KI P T  DVE + KNV   ++++GLR +G A K F K   +D Q     K    N  T   DL  +G++GI DP R E   A+KK  +AGI V M+TGD + TA++IA + GIL            D +VM G +F+          + +E +D +     V+AR SPQ K  ++       L R ++  A+TGDG ND P+LK A+VG AMGI G+DV+KEASDI+L+DDNF SI+ AV  GR + D+I KF+   L  NV   +   +G  F  ++     PL  V++LW+ ++     ++ L  E    +L+DR P+     I +  +I +     I
Sbjct:  532 IAEFPFDSTVKRMSSVYYNNHNETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDVETIRKNVYS-LSNEGLRVLGFASKSFTKDQVNDDQ----LKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNLYHYSQEIVDSMVMTGSQFDG---------LSEEEVDDLPVLPLVIARCSPQTKVRMIEA-----LHRRKKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVLSDDNFASILNAVEEGRRMTDNIQKFVLQLLAENVAQALYLIIGLVFRDENGKSVFPLSPVEVLWIIVVTSCFPAMGLGLEKAAPDLMDRPPHDSEVGIFTWEVIIDTFAYGI 902          

HSP 2 Score: 66.2402 bits (160), Expect = 3.790e-11
Identity = 93/320 (29.06%), Postives = 139/320 (43.44%), Query Frame = 3
Query: 1056 VIRGGVAKEXXXXXXXXXXXCQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDIDPMMLSGTHVMEGSAKMLVTAVG--LNSQAGIIFALLGAANTEEKDKAETEKPNNQVHKTNSNSKNKGCKNVDEEVELMKLTETHPEDADRCSNHKPNNYASGDANKSEIKNGKVKQEKKVRA--PKKKGSVLQLKLNKLASSIGQIGTIVASLTVTILIIKFCINTYVFEKEGWSMDHLKKMINFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYI 2003
            VIR G ++ I   D+V GDIC VK GD +PAD  +I++ +   DES LTGE   V K    D  ++ G        K   T+VG  LN       A   +A  + + K         V KT  NS            E+ K+ ++   D+   S          D +KS ++N  +  +K   A      G+ L  KL+KLA  +  I  + A   + +   KF ++  V                  I  + V +  +P  L + +TI+++     M+  N +VR LD+ E +G    ICSDKTGTLT  +M   Q +I
Sbjct:  132 VIRNGKSETINSKDVVPGDICLVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSK----DANLVFG--------KEEETSVGDRLN------LAFSSSAVVKGRAKG-------IVIKTALNS------------EIGKIAKSLQGDSGLISR---------DPSKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFA--IIVMASQKFDVDKRV-----------------AIYAICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTGTLTQGKMLARQIWI 386          
BLAST of Calcium-transporting ATPase vs. Ensembl Yeast
Match: ENA5 (Protein with similarity to P-type ATPase sodium pumps; member of the Na+ efflux ATPase family [Source:SGD;Acc:S000002445])

HSP 1 Score: 212.231 bits (539), Expect = 3.327e-56
Identity = 139/369 (37.67%), Postives = 201/369 (54.47%), Query Frame = 3
Query: 2250 IKVYTFNSERKSMSTIIEDEGK--LLLLTKGASEMILNKCSFILGKNG-KIQPFTTEDVEALVKNVIEPMASDGLRTIGLAYKEFVKKPDHDYQGLYNEKLDLENEHTLIKDLTLIGIVGIEDPVRPEVPPAIKKCQKAGITVRMVTGDNINTARSIAIKCGILKPG--------EDFLVMEGKEFNNRVRDPISGKIKQELIDQVWPKLRVLARSSPQDKYTLVTGIIDSHLTRSREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFLGACFITDS-----PLKAVQMLWVNLIMDTLASLALATEMPTEELLDRAP 3308
            I  + F+S  K MS++  +       +  KGA E I++ CS   GK+G KI P T  DVE + KNV   ++++GLR +G A K F K   +D Q     K    N  T   DL  +G++GI DP R E   A+KK  +AGI V M+TGD + TA++IA + GIL            D +VM G +F+          + +E +D +     V+AR SPQ K  ++       L R ++  A+TGDG ND P+LK A+VG AMGI G+DV+KEASDI+L+DDNF SI+ AV  GR + D+I KF+   L  NV   +   +G  F  ++     PL  V++LW+ ++     ++ L  E    +L+DR P
Sbjct:  532 IAEFPFDSTVKRMSSVYYNNHNETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDVETIRKNVYS-LSNEGLRVLGFASKSFTKDQVNDDQ----LKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNLYHYSQEIVDSMVMTGSQFDG---------LSEEEVDDLPVLPLVIARCSPQTKVRMIEA-----LHRRKKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVLSDDNFASILNAVEEGRRMTDNIQKFVLQLLAENVAQALYLIIGLVFRDENGKSVFPLSPVEVLWIIVVTSCFPAMGLGLEKAAPDLMDRPP 881          

HSP 2 Score: 66.2402 bits (160), Expect = 4.451e-11
Identity = 93/320 (29.06%), Postives = 139/320 (43.44%), Query Frame = 3
Query: 1056 VIRGGVAKEXXXXXXXXXXXCQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDIDPMMLSGTHVMEGSAKMLVTAVG--LNSQAGIIFALLGAANTEEKDKAETEKPNNQVHKTNSNSKNKGCKNVDEEVELMKLTETHPEDADRCSNHKPNNYASGDANKSEIKNGKVKQEKKVRA--PKKKGSVLQLKLNKLASSIGQIGTIVASLTVTILIIKFCINTYVFEKEGWSMDHLKKMINFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYI 2003
            VIR G ++ I   D+V GDIC VK GD +PAD  +I++ +   DES LTGE   V K    D  ++ G        K   T+VG  LN       A   +A  + + K         V KT  NS            E+ K+ ++   D+   S          D +KS ++N  +  +K   A      G+ L  KL+KLA  +  I  + A   + +   KF ++  V                  I  + V +  +P  L + +TI+++     M+  N +VR LD+ E +G    ICSDKTGTLT  +M   Q +I
Sbjct:  132 VIRNGKSETINSKDVVPGDICLVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSK----DANLVFG--------KEEETSVGDRLN------LAFSSSAVVKGRAKG-------IVIKTALNS------------EIGKIAKSLQGDSGLISR---------DPSKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFA--IIVMASQKFDVDKRV-----------------AIYAICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTGTLTQGKMLARQIWI 386          
BLAST of Calcium-transporting ATPase vs. Ensembl Yeast
Match: ENA1 (P-type ATPase sodium pump; involved in Na+ and Li+ efflux to allow salt tolerance [Source:SGD;Acc:S000002447])

HSP 1 Score: 212.231 bits (539), Expect = 4.032e-56
Identity = 141/390 (36.15%), Postives = 207/390 (53.08%), Query Frame = 3
Query: 2250 IKVYTFNSERKSMSTIIEDEGK--LLLLTKGASEMILNKCSFILGKNG-KIQPFTTEDVEALVKNVIEPMASDGLRTIGLAYKEFVKKPDHDYQGLYNEKLDLENEHTLIKDLTLIGIVGIEDPVRPEVPPAIKKCQKAGITVRMVTGDNINTARSIAIKCGILKPG--------EDFLVMEGKEFNNRVRDPISGKIKQELIDQVWPKLRVLARSSPQDKYTLVTGIIDSHLTRSREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFLGACFITDS-----PLKAVQMLWVNLIMDTLASLALATEMPTEELLDRAPYGRTKPIISRRMIKNIMGQSI 3371
            I  + F+S  K MS++  +       +  KGA E I++ CS   GK+G KI P T  DVE + KNV   ++++GLR +G A K F K   +D Q     K    N  T   DL  +G++GI DP R E   A+KK  +AGI V M+TGD + TA++IA + GIL            D +VM G +F+          + +E +D +     V+AR SPQ K  ++       L R ++   +TGDG ND P+LK A+VG AMGI G+DV+KEASDI+L+DDNF SI+ AV  GR + D+I KF+   L  NV   +   +G  F  ++     PL  V++LW+ ++     ++ L  E    +L+DR P+     I +  +I +     I
Sbjct:  532 IAEFPFDSTVKRMSSVYYNNHNETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDVETIRKNVYS-LSNEGLRVLGFASKSFTKDQVNDDQ----LKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNLYHYSQEIVDSMVMTGSQFDG---------LSEEEVDDLPVLPLVIARCSPQTKVRMIEA-----LHRRKKFCTMTGDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVLSDDNFASILNAVEEGRRMTDNIQKFVLQLLAENVAQALYLIIGLVFRDENGKSVFPLSPVEVLWIIVVTSCFPAMGLGLEKAAPDLMDRPPHDSEVGIFTWEVIIDTFAYGI 902          

HSP 2 Score: 66.2402 bits (160), Expect = 4.488e-11
Identity = 93/320 (29.06%), Postives = 139/320 (43.44%), Query Frame = 3
Query: 1056 VIRGGVAKEXXXXXXXXXXXCQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDIDPMMLSGTHVMEGSAKMLVTAVG--LNSQAGIIFALLGAANTEEKDKAETEKPNNQVHKTNSNSKNKGCKNVDEEVELMKLTETHPEDADRCSNHKPNNYASGDANKSEIKNGKVKQEKKVRA--PKKKGSVLQLKLNKLASSIGQIGTIVASLTVTILIIKFCINTYVFEKEGWSMDHLKKMINFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYI 2003
            VIR G ++ I   D+V GDIC VK GD +PAD  +I++ +   DES LTGE   V K    D  ++ G        K   T+VG  LN       A   +A  + + K         V KT  NS            E+ K+ ++   D+   S          D +KS ++N  +  +K   A      G+ L  KL+KLA  +  I  + A   + +   KF ++  V                  I  + V +  +P  L + +TI+++     M+  N +VR LD+ E +G    ICSDKTGTLT  +M   Q +I
Sbjct:  132 VIRNGKSETINSKDVVPGDICLVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSK----DANLVFG--------KEEETSVGDRLN------LAFSSSAVVKGRAKG-------IVIKTALNS------------EIGKIAKSLQGDSGLISR---------DPSKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFA--IIVMASQKFDVDKRV-----------------AIYAICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTGTLTQGKMLARQIWI 386          
BLAST of Calcium-transporting ATPase vs. Ensembl Nematostella
Match: EDO41775 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3I0])

HSP 1 Score: 1109.36 bits (2868), Expect = 0.000e+0
Identity = 609/1143 (53.28%), Postives = 771/1143 (67.45%), Query Frame = 3
Query:  576 EMNTKELTDLMMLRQQEAILEIKEKYGDVYEICRRLKTSPQSGLIDDEESIGNRRREFGSNIIPPKPPKTFFRLMWEALQDLTLIVLMGAAVISLALALYSKFSGSSHGDETEGDAGWIEXXXXXXXXXXXXXXTAFNDWQKERQFRGLQDQIEGNHKIAVIRGGVAKEXXXXXXXXXXXCQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDIDPMMLSGTHVMEGSAKMLVTAVGLNSQAGIIFALLGAANTEEKDKAETEKPNNQVHKTNSNSKNKGCKNVD-EEVELMKLTETHPEDADRCSNHKPNNYASGDANKSEIKNGKVKQEKKVRAPKKKGSVLQLKLNKLASSIGQIGTIVASLTVTILIIKFCINTYVFEKEGWSMDHLKKMINFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYINGQHNRTHLPSFEELSFNAADMLLKNISINSSYTSRLMATRHVNELPSQIGNKTECALLGFVNGSLKRDYADLRTQWPEEKLIKVYTFNSERKSMSTIIE-DEGKLLLLTKGASEMILNKCSFILGKNGKIQPFTTEDVEALVKNVIEPMASDGLRTIGLAYKEFVKK-PDHDYQGLYNEKLDLENEHTLIKDLTLIGIVGIEDPVRPEVPPAIKKCQKAGITVRMVTGDNINTARSIAIKCGILKPGEDFLVMEGKEFNNRVRDPISGKIKQELIDQVWPKLRVLARSSPQDKYTLVTGIIDSHLTRSREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFLGACFITDSPLKAVQMLWVNLIMDTLASLALATEMPTEELLDRAPYGRTKPIISRRMIKNIMGQSIYQLAVTFYLLLHGNVLLDVENGRGLTERGINKPTQHFTAIFNTFVMMTLFNEFNSRKIHGQKNVFDGLQRNVLFIIIWVTTFVGQIVIVQYGGYALHTEALELDHWLWCMLFGIGVLLWAQLINCIPTTVIPKHMPWSKKKLPTAENQALNQYKSVDSGNESEDEDYDDIGDLARQNNDEDDDDIKNSGQILWIRGLSRLQTQQNTCN 3995
            +++  +L  LM  R  EA   +    G ++ + R+L TS + G+    E I NR+R FG N+IPPKPPKTF+  + +A +D TLI+L  AAV+SL L +++          +E + GWI+G AIL AV +V LVTA ND+QKE+QFRGLQ +IE  HK  VIR G AKEI+  +IVVGD+CQ+KYGDLLPADG+++QSND+KVDESSLTGE D VKKG + DP+ L+GTH+MEGS KM+VTAVGLNSQ+GIIF LLGA + ++ D  +   P +           KG    D E+V L                         D ++   +NGK +++K+ +      SVLQ KL KLA +IG  G   A LT+ ++ ++F I  YV EK  W   HL   +N  I G+TVLVVAVPEGLPLAVTISLAYSVKKM+ DNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQ Y  GQH++T   + +E S    ++L K I++NSSY S  +       LP Q+GNKTECALLG +   L   Y D R   PE   +KVYTFNS RKSMST I   +G   L +KGASE++L++C+ I+G+NG+ +PF+++D  +LV++VIEPMASDGLRTI +AY++F     DHD     +   D ++E  ++ ++T I I GIEDPVR EVP AIKKCQ+AGI VRMVTGDN+NTARSIA KCGIL+P +DFLV++GKEFN  +RD  +G++ Q+  D++WP+LRVLARSSP+DKYTLV GIIDS L  +RE+VAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNF SIV AVMWGRNVYDSI+KFLQFQLTVN+VA+++AF+GAC +  SPL   Q+LWVNLIMD+ ASLALATE PTEELL R PYGRTKP+I+R MI+NI+G  +YQ+ V F L+  G    D+E+  G  E    KPTQH   IFNTFV+M LFNE NSR +HG++NVF G+ RN +F+ I   TF+ QI+I++  G A H   L  + W+WC+  G   LLW QL+  IP    PK   +  + +P A                                  E D    +  ++LWIRGL+RLQ Q    N
Sbjct:   29 DISVGDLKQLMKCRGLEAKDHLAST-GGLHGLVRKLHTSTEKGISGFPEDIENRKRVFGPNVIPPKPPKTFWEFLVDACKDTTLIILTVAAVVSLLLGIFA----PEECGGSEANTGWIDGFAILIAVCIVALVTAVNDYQKEQQFRGLQSKIELEHKFTVIRNGDAKEILNSEIVVGDLCQIKYGDLLPADGVVVQSNDLKVDESSLTGESDMVKKG-EKDPLFLAGTHIMEGSGKMIVTAVGLNSQSGIIFTLLGATHPDKIDSGDDAPPQSPAI--------KGAPGDDFEDVNL-------------------------DDDQESSENGKERKDKQEK------SVLQAKLTKLAVTIGWFGVAAALLTIIVMALQFSIRKYVKEKASWQNTHLNAYVNAFITGLTVLVVAVPEGLPLAVTISLAYSVKKMLDDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQLYTMGQHHKTIPENPKEFSPELLEILCKGIALNSSYASNCVVNGGREILPMQVGNKTECALLG-LVLDLGDTYQDYRDNNPESTFVKVYTFNSSRKSMSTAIRMPDGGYRLFSKGASEILLSRCTSIIGRNGQPEPFSSQDCLSLVQSVIEPMASDGLRTICMAYRDFPPTGKDHD-----DTPPDWDDEAGILSEMTAIAIAGIEDPVRQEVPAAIKKCQQAGIVVRMVTGDNVNTARSIAGKCGILEPDKDFLVLDGKEFNKLIRDS-NGRVSQKKFDEIWPRLRVLARSSPEDKYTLVKGIIDSKLNPAREIVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFRSIVMAVMWGRNVYDSISKFLQFQLTVNLVAIVIAFVGACVVEVSPLTGTQLLWVNLIMDSFASLALATEPPTEELLTRKPYGRTKPLITRTMIRNILGHGVYQIIVLFVLVFKGAEFFDIED--GFLEETRCKPTQHSAVIFNTFVLMQLFNEINSRMVHGERNVFKGIFRNPIFVGIMGGTFIVQILIIELTGKAFHVVGLNWEQWMWCIFLGFTELLWGQLVLTIPKESFPKLCRFGTEGVPIA-------------------------------TIIEPDGARDSRARLLWIRGLTRLQHQIRVVN 1086          
BLAST of Calcium-transporting ATPase vs. Ensembl Nematostella
Match: EDO41774 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3H9])

HSP 1 Score: 724.931 bits (1870), Expect = 0.000e+0
Identity = 417/1069 (39.01%), Postives = 642/1069 (60.06%), Query Frame = 3
Query:  588 KELTDLMMLRQQEAILEIKEKYGDVYEICRRLKTSPQSGLIDDEESIGNRRREFGSNIIPPKPPKTFFRLMWEALQDLTLIVLMGAAVISLALALYSKFSGSSHGDETEGDAGWIEXXXXXXXXXXXXXXTAFNDWQKERQFRGLQDQIEGNHKIAVIR-GGVAKEXXXXXXXXXXXCQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDIDPMMLSGTHVMEGSAKMLVTAVGLNSQAGIIFALLGAANTEEKDKAETEKPNNQVHKTNSNSKNKGCKNVDEEVELMKLTETHPEDADRCSNHKPNNYASGDANKSEIKNGKVKQEKKVRAPKKKGSVLQLKLNKLASSIGQIGTIVASLTVTILIIKFCINTYVFEKEGWSMDHLKKMINFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYINGQH-------NRTHLPSFEELSFNAADMLLKNISINSSYTSRLMATRHVNELPSQIGNKTECALLGFVNGSLKRDYADLRTQWPEEKLIKVYTFNSERKSMSTIIEDEGK-LLLLTKGASEMILNKCSFILGKNGKIQPFTTEDVEALVKNVIEPMASDGLRTIGLAYKEFVKKPDHDYQGLYNEKLDLENEHTLIKDLTLIGIVGIEDPVRPEVPPAIKKCQKAGITVRMVTGDNINTARSIAIKCGILKPGEDFLVMEGKEFNNRVRDPISGKIKQELIDQVWPKLRVLARSSPQDKYTLVTGIIDSHLTRSREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFLGACFITDSPLKAVQMLWVNLIMDTLASLALATEMPTEELLDRAPYGRTKPIISRRMIKNIMGQSIYQLAVTFYLLLHGNVLLDVENGRGLTERGINKPTQHFTAIFNTFVMMTLFNEFNSRKIHGQKNVFDGLQRNVLFIIIWVTTFVGQIVIVQYGGYALHTEALELDHWLWCMLFGIGVLLWAQLINCIPTTVIP 3767
            ++L ++M  + + A   I + +  +  + R L+TS   GL    +++ +RR+ +GSN +P    ++ F  +  +++D  LIVL+  A+ISL L L   +  S  G    G+  W EGV IL  V++++L++A +D+ ++  FR  Q ++    ++ VIR  G  K+I+  ++VVGD+C +K G L+ ADG+++QS+D+ VDE+  +    H  K V +DP++ +GTHV++G+ K +V AVG ++QA +   L   A+   + +     P N          NKG +N+ E                    HK  N                             + L+ K+N++A ++G IG  VA +T+ ++++ F +  Y   ++    + +   +   I+G+ VLVV+VPEGLPLAVT +LA+  K M    +LV+H+D  ETMGN + I  +KTG LT +RM V + +I  Q         +  +PS         D L K IS+N+SY+S++      + LP Q+GNKT+C+LL  +   +   Y   R   PE++ +KV+ F SERKSM+T++E E     + TKGA+E++L +C+  +  +GK++PFT ED E L K V+E M    L+ + LA +      D D +GL      LE+E  +++DLTL+ +VGIEDP+R +VP AI KC +AGI V MV+GD+I TAR++A + GILKP ED L+  G+EFN+ +RDP  GK+  +  + +WPKL+VLAR++ +DKYTLV  ++ S + R  E+VAVTG G +DGP L+KADVGF MG++G+DVAK+++D++L DDNF SIV A+ WGRNVY+++ KFL FQ TV   A IV  +GAC    SPL A Q+LWVNLIMD+LASLAL  + PT++LL   PYGR K +I R +I+N++G  I+QL V F L+   +  LD+++  G     I +P+QH + +F TFV M +FNE NSR +HG +N+F G+ RN++FI IW+     Q++IV+    A +T+ ++ + WLWC+  G+  L+WAQ+I   P T +P
Sbjct:   18 QKLEEVMTSQSEHAKQFIDQNFDGMQTLIRNLRTSAFKGLTGFADNLAHRRQVYGSNEMPLARRRSLFHFLLYSMKDWILIVLVIGAIISLVLGLV--YPESCKG-VINGEVAWYEGVGILVMVVLMILISALSDYLRDADFRCQQKRVHMEERVTVIRDSGAVKDILKSELVVGDLCLLKAGSLVAADGVVVQSSDLVVDETLFSRSERH--KSV-VDPLVFAGTHVVKGTGKFIVLAVGASTQAMMQLRLGDPASPGIELQPAPAGPIN----------NKGSQNLLE-----------------FKRHKEEN-----------------------------ATLEGKVNRVAVALGYIGIAVALITMIVIMVHFSVTNYYTNEKPAKPEDVNMYVRAFIMGMVVLVVSVPEGLPLAVTFALAFCTKMMYNKQSLVKHMDIIETMGNVSNIYCNKTGVLTEHRMRVDRMFIADQLLDGDPKVYKHKIPS------ELLDDLFKAISLNTSYSSQIQPAGR-DHLPVQVGNKTDCSLLQLML-EMGETYQYWRDDHPEDRFVKVFAFTSERKSMTTVLEKEKDGFYVYTKGAAEILLPRCTSTITTDGKMRPFTDEDRERLRKEVMEEMHKQALKILVLACRSL---SDSD-KGL------LEDEAKVLEDLTLMAVVGIEDPIREKVPEAIWKCDRAGIRVCMVSGDSIQTARAVAARVGILKPDEDILMYTGQEFNSYIRDP-DGKVNTDRFNSMWPKLKVLARATARDKYTLVKHVMGSGVNRQGEMVAVTGAGVHDGPVLRKADVGFTMGVSGSDVAKDSADVVLLDDNFGSIVWAIKWGRNVYNTVVKFLMFQFTVTWSAFIVVVIGACVTGRSPLGATQLLWVNLIMDSLASLALTRDFPTDDLLRHQPYGRHKALIGRTLIRNVVGHVIFQLVVMFVLIFKAHEWLDIKD--GFQTDTICQPSQHSSLVFTTFVFMQVFNEINSRSVHG-RNMFKGIHRNIVFICIWIAQVSIQVLIVEVFTRAFNTKGMDAEQWLWCIFLGLSELIWAQVIYTFPKTWLP 1002          
BLAST of Calcium-transporting ATPase vs. Ensembl Nematostella
Match: EDO44517 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVV7])

HSP 1 Score: 452.21 bits (1162), Expect = 3.438e-137
Identity = 254/708 (35.88%), Postives = 409/708 (57.77%), Query Frame = 3
Query: 1713 FCINTYVFEKEGWSMDHLKKMINFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMT-----VVQSYINGQHNRTHLPSFE-ELSFNAADMLLKNISINSSYTSRLMATRHV--NELPSQIGNKTECALLGFVNGSLKRDYADLRTQWPEEKLIKVYTFNSERKSMSTIIEDEGKLLLLTKGASEMILNKCSFILGKNGKIQPFTTEDVEALVKNVIEPMASDG-LRTIGLAYKEFV---KKPDHDYQGLYNEKLDLENEHTLIKDLTLIGIVGIEDPVRPEVPPAIKKCQKAGITVRMVTGDNINTARSIAIKCGILKPGEDFLVME-------GKEFNNRVRDPISGKIKQELIDQVWPKLRVLARSSPQDKYTLVTGIIDSHLTRSREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFLGACFITDSPLKAVQMLWVNLIMDTLASLALATEMPTEELLDRAPYGRTKPIISRRMIKNIMGQSIYQLAVTFYLLLHGNVLLDVENGR-GLTERGINKPTQHFTAIFNTFVMMTLFNEFNSRKIHGQKNVFDGLQRNVLFIIIWVTTFVGQIVIVQYGGYALHTEALELDHWLWCMLFGIGVLLWAQLINCIPTTVIPKHM 3776
            F + TY  +   +   H  ++I   II V +++VA PEGL +AVTI+L+ S++ M   +  VR+ D  ETMG+ T +C +KTG LT          V + ++ G+H R     ++ +++      + K I+IN+SY S +     +  +   +Q+G+ TECALL F    L   Y  +R   P E+  KV+ F+ E +SM+T++++     +  KG+ E++L +C  +L  + + +    + ++  V ++I  M     L+ + LAY       +  D   +   +++ + + E+ ++ D+  +G VG+E+ VR EV  AI +C++AG+ + MVTG ++ TA S A  CGIL P + +  +E        K  N  + D  SGKI Q   D++WP +RV++R +P+ K + +  I  S + R  EVVAV   G +D   L+ ADVG +MG  GTD+A+EASDI+L  D F+S++  + WGR++Y+++ KFLQFQLT   V +IV  +GA     S   A Q+LW+NLIMD LASLAL  + PT+++L   PYGR KP+ISR +++N++G +IYQ+AV F ++    ++ D  + R G +   + +PTQH T +F TF++M LFNE N R++   +NVF G   + +F+I+ +     QI+IVQ+   +   E L+   WLWC  FG   L+W Q+I  +P  VIP+  
Sbjct:  314 FLVKTYEIDNIPYDASHWNEIIKTFIIAVVIIIVAEPEGLSMAVTITLSRSLRNMCAQDIFVRNADVLETMGSVTTLCCNKTGVLTAVSKIPLYEEVAECFVGGKHFRGDTSHYKSDIAVKVVHEVAKGIAINTSYNSNIQVRTQLVSSSERNQVGDITECALLQF-TADLGVYYPFIREANPCEEFSKVFPFSPETRSMTTVVKENATYKVYCKGSPEVVLPRCVRLLNMDEQEETLDADRLKK-VNDIITAMQEKSQLKVMCLAYGTTPFKGRSRDVCMEPRLSKEPNWDEENRILSDMHFVGFVGMEESVRGEVSEAILRCRRAGLMITMVTGASLQTAGSFAQNCGILTPNKYWPAVEKTIIGYDSKLLNEEISDD-SGKISQVEFDKLWPDVRVVSRCTPEGKRSFMQAIRRSRVRREGEVVAVVASGVHDANFLRDADVGLSMGATGTDIAQEASDIVLKGDKFSSVLDTIKWGRHIYETVLKFLQFQLTATWVTMIVLIIGAILFQKSIFSAAQLLWLNLIMDALASLALTGDHPTDDILRHKPYGRNKPLISRAVLRNVIGHAIYQIAVVFIVIY---LIADFTDTRFGYSAESLCRPTQHSTMVFTTFILMQLFNEVNCRRV-SSRNVFSG-PFDWVFLIVLLLCIGVQIIIVQFFTNSFRVEPLDWQQWLWCFFFGFSELIWGQIIFSVPKGVIPRFF 1013          

HSP 2 Score: 125.561 bits (314), Expect = 7.123e-29
Identity = 89/258 (34.50%), Postives = 149/258 (57.75%), Query Frame = 3
Query:  564 EETYEMNTKELTDLMMLRQQEAILEIKEKYGDVYEICRRLKTSPQSGLIDDEESIGNRRREFGSNIIPPKPPKT-FFRLMWEALQDLTLIVLMGAAVISLALALYSK-FSGSSHGDETEGDAGWIEXXXXXXXXXXXXXXTAFNDWQKERQFRGLQDQIEGNHKIAVIRGGVAKEXXXXXXXXXXXCQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDIDPMMLSGTHVMEGSAKMLVTAVGLNSQAGII 1331
            EE   + TK L +++  +  + +  + + +G V  I  RL+TS + G++D  +++  R + FGSN I  +  +  FFR +  ++ D+ LI+L+   + S+ L  Y +      +  ++E +A W+EG  ILG   V+VL++  +D+ +E+ F  LQ +IE   K  V+RGG  KEI   D+ VGD+C +  G ++PADGI++++ ++  DESSL  E    K     DP + + THV EGS KM++ AVG ++Q   I
Sbjct:    9 EEPGRLKTK-LVEILTQKDGKGLQMLDDDFGGVRGIIHRLQTSSKKGILDTSDALARRTKSFGSNRISGQAKRRGFFRALLYSMTDIVLILLVLGGIASVILGYYYREVCKGKYIPDSEKNA-WMEGAGILGTAAVIVLLSTLSDYLREKSFYRLQKRIESERKTRVMRGGEMKEICYQDVKVGDLCVIGPGSIIPADGILVENTELTTDESSLNKESRASKTSR--DPFVFASTHVTEGSGKMIILAVGDSTQIAAI 262          
BLAST of Calcium-transporting ATPase vs. Ensembl Nematostella
Match: EDO47465 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RM93])

HSP 1 Score: 263.848 bits (673), Expect = 1.450e-72
Identity = 244/858 (28.44%), Postives = 391/858 (45.57%), Query Frame = 3
Query: 1452 EEVELMKLTETHPEDADRCSNH-KPN------NYASGDANKSEIKNGKVKQEKKVR----APKKKGSVLQLKLNKLASSIGQIGTIVASLTVTILIIKFCINTYVFEKEGWSMDHLKKMINFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYI--NGQHNRTHLPSFE-----------------ELSFNAADMLLKNISINSSYTSRLMATRHVNELPSQIGNKTECALLGFVN----------GSLKRDYADLRTQWPEEKLIKVYT--FNSERKSMSTIIEDE---------GKLLLLTKGASEMILNKCSFILGKNGKIQPFTTEDVEALVKNVIEPMAS--DGLRTIGLAYKEFVKKPDHDYQGLYNEKLDLENEHTLI---KDLTLIGIVGIEDPVRPEVPPAIKKCQKAGITVRMVTGDNINTARSIAIKCGILKPGEDFLVMEGKEFNNRVRDPISGKIKQELIDQVWPKLRVLARSSPQDKYTLVTGIIDSHLTRSREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFLGACFITDSPLKAVQMLWVNLIMDTLASLALATEMPTEELLDRAPYGRTKPIISRRMIKNIMGQSIY------------------QLAVTFYLLLHGNVLLDVENGRGLTERGINKPTQHFTAIFNTFVMMTLFNEFNSRKIHGQKNVFDGLQRNVLFIIIWVTTFVGQIVIVQYG--GYALHTEALELDHWLWCMLFGIGVLLWAQLINCIPTTVIPKHMPWSKKKL 3797
            E + ++K T+  P++  R  N  K N      N ASG  +   +  G   Q  K+R        + + LQ KL++    + ++ TI       I I  + IN   F         LK  I +  I V + V A+PEGLP  VTI LA   ++M K N +VR L + ET+G  + ICSDKTGTLTTN+M+V + ++  +    R     FE                  ++ +  ++L +  +I S      +   +V +   ++G  TE AL+  V           G  K   A +  +  +    K +T  F+ +RKSMS     +         GK  +  KGA E IL++C F+   N K  P T + ++A + ++I+   +  D LR + LA    V  P      +   K+DLE     +     +T +G+ G+ DP RPEV  AIK C KAGI V ++TGDN  TA +I  +  +    ED     G  ++ R  D ++   ++E       + R+ +R  P  K  +VT     +L    E+ A+TGDG ND PALKKA++G AMG +GT VAK AS++IL DDNF++IV AV  GR++YD+  +F+++ ++ N+  V+  FL A       L  VQ+LWVNL+ D   + AL+   P  +++ + P    +P+IS  +    +   +Y                     V++Y L H ++    +   GL +  +       T   +  V + +FN  NS     +  +     RN   +     +F+   +I+ +           L    W+  + F   V+L  +++  I  T +    P  K K+
Sbjct:  183 ESISVVKHTDAIPDE--RAVNQDKTNMLFSGTNIASGKCSGVVVGTGLSTQIGKIRDQMIPSDDERTPLQQKLDEFGEQLSKVITI-------ICIAVWAINIGHFNDPIHGGSWLKGAIYYFKIAVALAVAAIPEGLPAVVTICLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVHKFFVMKDISRGRAEFHEFEVEGTTYDPVGDITKDGRNVTTSDYEVLPEFATICSLCNDSSVDYNNVRDSYEKVGESTETALIVLVEKLNVLNVDLEGKTKAQLATICNESIKNHFNKEFTLEFSRDRKSMSVYCVPQKDGPNSFLDGKPKMFVKGAPEGILDRCDFVRVGNKK-HPMTPK-MKAQILDLIKAYGTGADTLRCLALAT---VDDP------IAPSKMDLEASEKFVNYESHMTFVGVAGMLDPPRPEVTDAIKLCAKAGIRVIVITGDNKATAEAICRRIEVFGQDED---TTGLSYSGREFDDLTPSEQRE----ACLRARLFSRVEPSHKSKIVT-----YLQEEGEISAMTGDGVNDAPALKKAEIGVAMG-SGTAVAKTASEMILADDNFSTIVAAVEEGRSIYDNTKQFIRYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNLMTDGPPATALSFNPPDSDIMSKPPRSPRQPLISGWLFFRYLAIGVYVGCATVGASAWWFMFYENGPKVSYYQLTH-HMQCGTDPSFGL-DCAVFGDLHPMTMALSVLVTIEMFNALNSLA-ENESLLTMPPWRNPSLLTAIAASFLMHFLILYFPITNTIFRITPLNWVEWMAVLKFSFPVILLDEVLKFISRTFVVHSAPLHKHKV 1004          
BLAST of Calcium-transporting ATPase vs. Ensembl Nematostella
Match: EDO35616 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SL15])

HSP 1 Score: 259.996 bits (663), Expect = 8.399e-72
Identity = 204/705 (28.94%), Postives = 339/705 (48.09%), Query Frame = 3
Query: 1746 GWSMDHLKKMINFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYI-NGQHNRTHLPSFEELSFNAADMLLKNISINSSYTSRLMATRHVNELPSQ--------IGNKTECALLGFVNGS----LKRDYA--DLRTQWPEEKLIKVYTFNSERKSMSTIIEDEGKLLLLTKGASEMILNKCSFILGKNGKIQPFTTEDVEALVKNVIEPMASDGLRTIGLAYKEFVKKPDHDYQGLYNEKLDLENEHTLIKDLTLIGIVGIEDPVRPEVPPAIKKCQKAGITVRMVTGDNINTARSIAIKCGILKPGEDFLVMEGKEFNNRVRDPISGKIKQELIDQVWPKLRVLARSSPQDKYTLVTGIIDSHLTRSREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFLGACFITDSPLKAVQMLWVNLIMDTLASLALATEMPTEELLDRAPYGRTKPIISRRMIKNIMGQSIYQLAVTFYLL---LHGNVLLDVENGRGLTERGINKPTQHFTAIFNTFVMMTLFNEFNSRKIHGQKNVFD-GLQRNVLFIIIWVTTFVGQIVIVQYGGY--ALHTEALELDHWLWCMLFGIGVLLWAQLINCIPTTVIPKHMPWSKKKL 3797
            GW     + ++    IGV++ V A+PEGLP+ VT++LA  V +M K N +V+ L   ET+G ++ ICSDKTGTLT N MTV Q +  +G +       +  L     +++L    I  +  S +  T     L +          G  TE A++     +       D+   D R    E+KL+ V      RK  S+ + +  + +   KGA E ++ +C+    KNG   P T +DVE  + + +  M+S GLR I  A+ E                 DL+        LT +GI+G+ DP R  V  A++    +G+ V+M+TGD+  TA +IA   GI   G   L   G+E      + + G     +IDQV     V  R SP+ K  +V       L +   VVA+TGDG ND  ALK+AD+G AMG +GTDV+KEA+++IL DD+F +I+ A+  G+ ++ +I  F++FQL+ ++ A+ +  +       +PL A+Q+LW+N+IMD   + +L  E    +++ R P     P+I++ +I  ++  ++  +  T ++    +  N++   +                 T  F  FV   +FN  + R    +K++F  G   N +F+     + +GQ +++ +        TEAL +   L  +     V +  ++   I   V  +    +K+K 
Sbjct:  270 GWIQK--RAILEMFTIGVSLAVAAIPEGLPIVVTVTLALGVMRMAKRNAIVKKLPIVETLGCSSVICSDKTGTLTKNEMTVSQIFTADGFYAEATGVGYSPL----GEVILNEDPITYTSNSSIAKTVEAGYLCNNASIRNGVLYGQPTEGAIVTVAQKASTFTCGIDFVRVDERPFSSEKKLMAV---KCRRKHRSSAMAEIARDIYYVKGAPENVMRQCTSYY-KNGSAVPMTAKDVER-IGDAVLAMSSRGLRVIAFAHGE-----------------DLQQ-------LTYLGIMGLLDPPRNGVREAVRTLLDSGVQVKMITGDSRETAITIAELLGIHFKGRPTL--SGEEL-----EALDGLQLSTIIDQV----SVFYRVSPRHKVAIVKA-----LQQHGHVVAMTGDGVNDAVALKRADIGIAMGKSGTDVSKEAAEMILVDDDFNTIMAAIEEGKGIFYNIKNFVRFQLSTSIAAISLITISTFLKLPNPLNAMQILWINIIMDGPPAQSLGVEPVDSDVMRRPPRNVKSPMITKTLIAKVISAALLIVCGTLWVFWREMRDNIITPRDT----------------TMTFTCFVFFDMFNALSCRS--QEKSIFQVGFLTNRMFLYAVGGSLIGQFLVIYFAPLQAVFQTEALHITDILLLLAVSSSVFIVDEIRKFITYRVSKRRRQAAKEKF 905          
BLAST of Calcium-transporting ATPase vs. Ensembl Medaka
Match: atp2b3b (ATPase plasma membrane Ca2+ transporting 3 [Source:NCBI gene;Acc:101161727])

HSP 1 Score: 1201.81 bits (3108), Expect = 0.000e+0
Identity = 656/1181 (55.55%), Postives = 815/1181 (69.01%), Query Frame = 3
Query:  573 YEMNTKELTDLMMLRQQEAILEIKEKYGDVYEICRRLKTSPQSGLIDDEESIGNRRREFGSNIIPPKPPKTFFRLMWEALQDLTLIVLMGAAVISLALALY------SKFSGSSHG---DETEGDAGWIEXXXXXXXXXXXXXXTAFNDWQKERQFRGLQDQIEGNHKIAVIRGGVAKEXXXXXXXXXXXCQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDIDPMMLSGTHVMEGSAKMLVTAVGLNSQAGIIFALLGAANTEEKDKAETEKPNNQVHKTNSNSKNKGCKNVDEEVELMKLTETHPEDADRCSNHKPNNYASGDANKSEIKNGKVKQEKKVRAPKKKGSVLQLKLNKLASSIGQIGTIVASLTVTILIIKFCINTYVFEKEGWSMD----HLKKMINFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYINGQHNRTHLPSFEELSFNAADMLLKNISINSSYTSRLMATRHVNELPSQIGNKTECALLGFVNGSLKRDYADLRTQWPEEKLIKVYTFNSERKSMSTIIE-DEGKLLLLTKGASEMILNKCSFILGKNGKIQPFTTEDVEALVKNVIEPMASDGLRTIGLAYKEFVKKPDHDYQGLYNEKLDLENEHTLIKDLTLIGIVGIEDPVRPEVPPAIKKCQKAGITVRMVTGDNINTARSIAIKCGILKPGEDFLVMEGKEFNNRVRDPISGKIKQELIDQVWPKLRVLARSSPQDKYTLVTGIIDSHLTRSREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFLGACFITDSPLKAVQMLWVNLIMDTLASLALATEMPTEELLDRAPYGRTKPIISRRMIKNIMGQSIYQLAVTFYLLLHGNVLLDVENGRGLTERGINKPTQHFTAIFNTFVMMTLFNEFNSRKIHGQKNVFDGLQRNVLFIIIWVTTFVGQIVIVQYGGYALHTEALELDHWLWCMLFGIGVLLWAQLINCIPTTVIP--KHMPWSKKKLPTAENQALNQYKSVDSGNESEDEDYDDIGDLARQNNDEDDDDIKNSGQILWIRGLSRLQTQQNTCNPNLDNRNDVVYGGVRRFT--LSQV 4061
            + +  KEL +LM LR  +A+ +I+E YGD   +C+RL+++   GL  D   +  R + +G N IPPK PKTF  L+WEALQD+TLI+L  AA+ISL L+ Y      S   G S G   DE E DAGWIEG AIL +V+ VV VTAFNDW KE+QFRGLQ +IE   K  V+R G   +I V D+VVGDI QVKYGDLLPADGI+IQ ND+K+DESSLTGE DHV+K VD DPM+LSGTHVMEGS +MLVTAVG+NSQ GIIF LLGA   EE  K   EK   Q   T  N++NK  K                +D       +P   A G     E+++   +++KK   PKK+ SVLQ KL KLA  IG+ G +++++TV IL++ F INT+V ++  W  +    +++  + F IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQ++I   H+R  +P    +S    D+L+  I+INS+YTS+++       LP Q+GNKTEC LLGF+   L++DY  +R Q PEEKL KVYTFNS RKSM+T+I+  +G   L +KGASE++L KCS+IL  NG+ + F   D + +VK VIEPMA +GLRTI +AY++    P+ D+          ENE  ++ +LT I +VGIEDPVRPEVP AI+KCQ+AGITVRMVTGDNINTAR+IA KCGI+ PG+DF+ +EGKEFN R+R+   G+I+QE ID++WPKLRVLARSSP DK+TLV GIIDS +   R+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNF+SIVKAVMWGRNVYDSI+KFLQFQLTVNVVAVIVAF GAC   DSPLKAVQMLWVNLIMDT ASLALATE PTE LL R PYGR  P+IS  M+KNI+G  +YQL + F LL  G  + ++++GR       + P++H+T IFNTFV+M LFNE N+RKIHG++NVFDG+  N +F  I + TF  QIVIVQ+GG       L ++ WLWC+  G+G LLW Q+I+ +PT  +P  K      +       +     + +D              +L R             GQILW RGL+R+QTQ    +     R+    G VRR +  LSQ+
Sbjct:   41 FGVTVKELRELMELRSTDALQKIQESYGDTKGLCQRLQSNVTDGLSGDPADLERRGQIYGQNFIPPKKPKTFLELVWEALQDVTLIILEAAAIISLGLSFYQPPNQESAICGESTGGAEDEGEADAGWIEGAAILLSVVCVVFVTAFNDWSKEKQFRGLQSRIEQEQKFTVVRKGNVIQIPVADMVVGDIAQVKYGDLLPADGILIQGNDLKIDESSLTGESDHVRKSVDKDPMLLSGTHVMEGSGRMLVTAVGVNSQTGIIFTLLGAGEIEEDVK---EKKGKQPDGTVENNQNKAKK----------------QDGGVAMEMQPLKSAEG----GEVED---REKKKTNVPKKEKSVLQGKLTKLAVQIGKAGLVMSAITVIILMLFFVINTFVVKERSWLAECTPIYIQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFIGDVHHRV-VPDPGLISPRTLDVLVHAIAINSAYTSKILPPDVEGGLPKQVGNKTECGLLGFIL-DLQQDYVPVREQIPEEKLYKVYTFNSARKSMTTVIKLPDGTFRLYSKGASEIMLKKCSYILDANGEPRIFRPRDRDEMVKQVIEPMACEGLRTICIAYRDLSPNPEPDW----------ENEAEIVTELTCISLVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARAIAAKCGIIHPGDDFICLEGKEFNRRIRNE-KGEIEQERIDRIWPKLRVLARSSPTDKHTLVKGIIDSTVLEQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTEALLLRKPYGRNNPLISLTMMKNILGHGVYQLVIIFTLLFIGERIFNIDSGRHAPLH--SPPSEHYTIIFNTFVLMQLFNEINARKIHGERNVFDGIFANPIFCSIVLGTFAVQIVIVQWGGKPFSCAPLNMEQWLWCLFVGVGELLWGQVISAVPTERLPCLKEAGLGLEPGEEEGEELAEDEEEIDCAER----------ELRR-------------GQILWFRGLNRIQTQMEVVSTF--KRSGSFQGAVRRRSSVLSQL 1155          
BLAST of Calcium-transporting ATPase vs. Ensembl Medaka
Match: ENSORLT00000046870.1 (ATPase plasma membrane Ca2+ transporting 1 [Source:NCBI gene;Acc:101166674])

HSP 1 Score: 1192.95 bits (3085), Expect = 0.000e+0
Identity = 677/1221 (55.45%), Postives = 835/1221 (68.39%), Query Frame = 3
Query:  588 KELTDLMMLRQQEAILEIKEKYGDVYEICRRLKTSPQSGLIDDEESIGNRRREFGSNIIPPKPPKTFFRLMWEALQDLTLIVLMGAAVISLALALYS------KFSGSSHG---DETEGDAGWIEXXXXXXXXXXXXXXTAFNDWQKERQFRGLQDQIEGNHKIAVIRGGVAKEXXXXXXXXXXXCQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDIDPMMLSGTHVMEGSAKMLVTAVGLNSQAGIIFALLGAANTEEKDKAETEKPNNQVHKTNSNSKNKGCKNVDEEVELMKLTETHPEDADRCSNHKPNNYASGDANKSEIKNGKVKQEKKVRAPKKKGSVLQLKLNKLASSIGQIGTIVASLTVTILIIKFCINTYVFEKEGWSMD----HLKKMINFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYINGQHNRTHLPSFEELSFNAADMLLKNISINSSYTSRLMATRHVNELPSQIGNKTECALLGFVNGSLKRDYADLRTQWPEEKLIKVYTFNSERKSMSTIIE-DEGKLLLLTKGASEMILNKCSFILGKNGKIQPFTTEDVEALVKNVIEPMASDGLRTIGLAYKEFVK---KPDHDYQGLYNEKLDLENEHTLIKDLTLIGIVGIEDPVRPEVPPAIKKCQKAGITVRMVTGDNINTARSIAIKCGILKPGEDFLVMEGKEFNNRVRDPISGKIKQELIDQVWPKLRVLARSSPQDKYTLVTGIIDSHLTRSREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFLGACFITDSPLKAVQMLWVNLIMDTLASLALATEMPTEELLDRAPYGRTKPIISRRMIKNIMGQSIYQLAVTFYLLLHGNVLLDVENGRGLTERGINKPTQHFTAIFNTFVMMTLFNEFNSRKIHGQKNVFDGLQRNVLFIIIWVTTFVGQIVIVQYGGYALHTEALELDHWLWCMLFGIGVLLWAQLINCIPTTVIPKHMPWSKKKLPTAENQALNQYKSVDSGNESEDEDYDDIGDLARQNNDEDDDDIKNSGQILWIRGLSRLQTQQNTCNPNLDNRNDVVYGGVRRFTLSQVGGVQPLLAARRQSSYSNNEQ----NINLSTNQTESIIIPTATKSGS 4187
            KEL  LM LR  EAI ++ E YGD   +C RLKTSP  GL      +  R+  FG N+IPPK PKTF +L+WEALQD+TLI+L  AA++SL L+ Y       +  G + G   DE E +AGWIEG AIL +VI VVLVTAFNDW KE+QFRGLQ +IE   K  V+RGG   +I V +IVVGD+ Q+KYGDLLPADG++IQ ND+K+DESSLTGE DHVKK  + DPM+LSGTHVMEGS KM+VTAVG+NSQ GIIF LLGA   E++D+ E +K   +  K   + K  G       +E  K  + H  D         N+    DA          +++KK   PKK+ SVLQ KL KLA  IG+ G +++++TV IL++ F ++T+  +   W  +    +++  + F IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLT NRMTVVQ+YI  +H +  +P  E +  NA ++L+  I++N +YTS++M+      LP Q+GNKTECALLGF N  LKRDY  +R + PEEKL KVYTFNS RKSMST+++  +G   + +KGASE++L KC  IL  NG+ + F   D + +VK VIEPMAS+GLRTI L Y++F     +PD D            NE+ ++  LT I +VGIEDPVRPEVP AIKKCQ+AGITVRMVTGDNINTAR+IA KCGIL PG+DF+ +EGKEFN R+R+   G+I+QE ID++WPKLRVLARSSP DK+TLV GIIDS +   R+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNF+SIVKAVMWGRNVYDSI+KFLQFQLTVNVVAVIVAF GAC   DSPLKAVQMLWVNLIMDT ASLALATE PTE LL R PYGR KP+ISR M+KNI+G  +YQL + F LL  G  L D++NGR         P++H+T +FNTFV+M LFNE N+RKIHG++NVFDG+  N++F  I   TFV QIVIVQ+GG      AL +D WLWC  FG   LLW Q+I+ IPT+ +        K L TA +    +        E  DE+ D++ D+   ++ E +      GQILW RGL+R+QTQ +                V  F      G     A RRQ+S S+ +Q    N++  T+   S   PTA  + S
Sbjct:   27 KELRSLMELRGAEAISKLGESYGDTQGLCNRLKTSPADGLSGQPADLEKRKTTFGENLIPPKKPKTFLQLVWEALQDVTLIILEVAAIVSLGLSFYRPPEAERENCGKAAGGVEDEHESEAGWIEGAAILLSVICVVLVTAFNDWSKEKQFRGLQSRIEQEQKFTVVRGGQVIQIPVAEIVVGDVAQIKYGDLLPADGVLIQGNDLKIDESSLTGESDHVKKTQEKDPMLLSGTHVMEGSGKMVVTAVGVNSQTGIIFTLLGANEDEDEDEDEKKKEKEEKKKQRKSKKQDG------SLENRKKAKAH--DGAAMEMQPLNSDEGADA----------EEKKKSNLPKKEKSVLQGKLTKLAVQIGKAGLVMSAITVIILVVLFVVDTFWIQNLYWVKECTPIYIQFFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTMNRMTVVQAYIAEKHYK-KVPEAENIPSNALELLILGIAVNCAYTSKIMSPEKEGGLPRQVGNKTECALLGFCN-DLKRDYQTIRNEIPEEKLYKVYTFNSVRKSMSTVLKMADGSFRMFSKGASEILLKKCYKILTANGEPKVFRPRDRDDVVKKVIEPMASEGLRTICLGYRDFPATEGEPDWD------------NENDILSGLTCISVVGIEDPVRPEVPDAIKKCQRAGITVRMVTGDNINTARAIATKCGILLPGDDFICLEGKEFNRRIRNE-KGEIEQERIDKIWPKLRVLARSSPTDKHTLVKGIIDSTVAEQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTESLLLRRPYGRNKPLISRTMMKNILGHGVYQLIIIFSLLFAGEQLFDIDNGRNAPLNA--PPSEHYTIVFNTFVLMQLFNEINARKIHGERNVFDGIFNNLIFCSIVFGTFVIQIVIVQFGGKPFSCVALTIDQWLWCTFFGFSSLLWGQVISSIPTSRL--------KFLKTAGHGTQKE--------EIPDEELDELDDMEEIDHAERE---LRRGQILWFRGLNRIQTQMDV---------------VSAFQ----SGTSFQGALRRQASNSSQQQHDVTNVSSPTHVAFSTTTPTAVSTAS 1174          
BLAST of Calcium-transporting ATPase vs. Ensembl Medaka
Match: atp2b2 (ATPase plasma membrane Ca2+ transporting 2 [Source:NCBI gene;Acc:101156400])

HSP 1 Score: 1192.18 bits (3083), Expect = 0.000e+0
Identity = 657/1223 (53.72%), Postives = 828/1223 (67.70%), Query Frame = 3
Query:  573 YEMNTKELTDLMMLRQQEAILEIKEKYGDVYEICRRLKTSPQSGLIDDEESIGNRRREFGSNIIPPKPPKTFFRLMWEALQDLTLIVLMGAAVISLALALY-------SKFSGSSHG---DETEGDAGWIEXXXXXXXXXXXXXXTAFNDWQKERQFRGLQDQIEGNHKIAVIRGGVAKEXXXXXXXXXXXCQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDIDPMMLSGTHVMEGSAKMLVTAVGLNSQAGIIFALLGAA-----------NTEEKDKAETEKPNNQVHKTNSNSKNKGCKNVDEEVELMKLTETHPEDADRCSNHKPNNYASGDA-------NKSEIKNGKVKQEKKVRAPKKKGSVLQLKLNKLASSIGQIGTIVASLTVTILIIKFCINTYVFEKEGWSMD----HLKKMINFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYINGQHNRTHLPSFEELSFNAADMLLKNISINSSYTSRLMATRHVNELPSQIGNKTECALLGFVNGSLKRDYADLRTQWPEEKLIKVYTFNSERKSMSTIIE-DEGKLLLLTKGASEMILNKCSFILGKNGKIQPFTTEDVEALVKNVIEPMASDGLRTIGLAYKEFVKKPDHDYQGLYNEKLDLENEHTLIKDLTLIGIVGIEDPVRPEVPPAIKKCQKAGITVRMVTGDNINTARSIAIKCGILKPGEDFLVMEGKEFNNRVRDPISGKIKQELIDQVWPKLRVLARSSPQDKYTLVTGIIDSHLTRSREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFLGACFITDSPLKAVQMLWVNLIMDTLASLALATEMPTEELLDRAPYGRTKPIISRRMIKNIMGQSIYQLAVTFYLLLHGNVLLDVENGRGLTERGINKPTQHFTAIFNTFVMMTLFNEFNSRKIHGQKNVFDGLQRNVLFIIIWVTTFVGQIVIVQYGGYALHTEALELDHWLWCMLFGIGVLLWAQLINCIPTTVIPKHMPWSKKKLPTAENQALNQYKSVDSGNESEDEDYDDIGDLARQNNDEDDDDIKNSGQILWIRGLSRLQTQQNTCNPNLDNRNDVVYGGVRRFTLSQVGGVQPLLAARRQSSYSNNEQNI-NLST 4139
            +  +  +L  LM LR  E +++++E YG V  +C+RLKTSP  GL+  +  +  R+  FG N+IPPK PKTF +L+WEALQD+TLI+L  AA+ISL L+ Y        +  GS+ G   DE E DAGWIEG AIL +V+ VV+VTAFNDW KE+QFRGLQ +IE   K  V+RG    ++ V DI+VGDI Q+KYGDLLPADG++IQ ND+K+DESSLTGE DHVKK  D DPM+LSGTHVMEGS +M+VTAVG+NSQ GIIF LLGA               E     T+  +  +H   + + + G   ++       L     +D +  SN        G A         +E      K++KKV APKK+ SVLQ KL KLA  IG  G +++S+TVTIL++ F I+ +V +K  W  +    +++  + F IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMT VQ YI   H +  +P    L   + D+L+  I+INS+YT++++       LP Q+GNKTEC LLG +   LKRDY  +R Q PEEKL KVYTFNS RKSMST+I+  +G   + +KGASE++L KCS IL + G+++ F   D + +VK VIEPMA +GLRTI +AY++F   P+ ++          ++E+ ++ DLT I +VGIEDPVRPEVP AI+KCQ+AGITVRMVTGDNINTAR+IAIKCGI+ PGEDFL ++GKEFN R+R+   G+++QE ID+VWPKLRVLARSSP DK+TLV GIIDS +   R+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNF+SIVKAVMWGRNVYDSI+KFLQFQLTVNVVAVIVAF GAC   DSPLKAVQMLWVNLIMDT ASLALATE P E LL R PYGR KP+IS  M KNI+G ++YQL + F LL  G  + D+++GR       + P++H+T IFNTFVMM LFNE N+RKIHG++NVFDG+ RN +F  I   TFV QIVIVQ+GG     + L L+ W+WC+  G+G L+W Q+I  IP           K +      Q  ++           DE  ++  +   +  D  + +++  GQILW RGL+R+QTQ    N                 T       Q   A RRQSS ++  Q++ N+S+
Sbjct:   24 FGCSVMDLRSLMELRGTEGVVKLQEDYGGVEGLCKRLKTSPTEGLLGVQADLDKRKEIFGKNLIPPKKPKTFLQLVWEALQDVTLIILELAALISLGLSFYHPPGESGGEMCGSAAGGVEDEGEADAGWIEGAAILLSVVCVVIVTAFNDWSKEKQFRGLQSRIEQEQKFQVVRGSQVIQLPVADILVGDIAQIKYGDLLPADGVLIQGNDLKIDESSLTGESDHVKKAADKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGVEEEEKKEKKGGAVEDGHQNTDCSHPPIHPIATITTD-GAAGINATGS-ANLINGKMQDGNMESNQIKVKKQDGAAAMEMQPLKSAEGGEADEKEKKKVSAPKKEKSVLQGKLTKLAVQIGYAGLVMSSITVTILVLYFSIDNFVMKKRPWMAECTPIYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTAVQCYIGDVHYK-KIPDPGVLPPKSLDLLINAIAINSAYTTKILPPDKEGGLPKQVGNKTECGLLGLIL-ELKRDYQPIRNQIPEEKLYKVYTFNSVRKSMSTVIKLPDGSFRMYSKGASEIVLKKCSHILNEVGELRVFRPRDKDEMVKKVIEPMACEGLRTICVAYRDFSNDPEPNW----------DDENNILNDLTAICVVGIEDPVRPEVPDAIQKCQRAGITVRMVTGDNINTARAIAIKCGIIHPGEDFLCIDGKEFNRRIRNE-KGEVEQERIDKVWPKLRVLARSSPTDKHTLVKGIIDSTMADQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPNESLLKRKPYGRNKPLISSTMTKNILGHAVYQLVIIFTLLFVGEQIFDIDSGRDAPLH--SPPSEHYTLIFNTFVMMQLFNEINARKIHGERNVFDGIFRNPIFCSIVFGTFVVQIVIVQFGGKPFSCQPLNLEKWMWCVFLGLGELVWGQVIATIPNL---------KLRFLRRAGQLTHK-----------DELPEEDVNEENEEIDHAERELRR-GQILWFRGLNRIQTQIEVVN-----------------TFKSGTSFQGAGALRRQSSTTSQTQDVTNVSS 1191          
BLAST of Calcium-transporting ATPase vs. Ensembl Medaka
Match: atp2b2 (ATPase plasma membrane Ca2+ transporting 2 [Source:NCBI gene;Acc:101156400])

HSP 1 Score: 1191.79 bits (3082), Expect = 0.000e+0
Identity = 657/1223 (53.72%), Postives = 828/1223 (67.70%), Query Frame = 3
Query:  573 YEMNTKELTDLMMLRQQEAILEIKEKYGDVYEICRRLKTSPQSGLIDDEESIGNRRREFGSNIIPPKPPKTFFRLMWEALQDLTLIVLMGAAVISLALALY-------SKFSGSSHG---DETEGDAGWIEXXXXXXXXXXXXXXTAFNDWQKERQFRGLQDQIEGNHKIAVIRGGVAKEXXXXXXXXXXXCQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDIDPMMLSGTHVMEGSAKMLVTAVGLNSQAGIIFALLGAA-----------NTEEKDKAETEKPNNQVHKTNSNSKNKGCKNVDEEVELMKLTETHPEDADRCSNHKPNNYASGDA-------NKSEIKNGKVKQEKKVRAPKKKGSVLQLKLNKLASSIGQIGTIVASLTVTILIIKFCINTYVFEKEGWSMD----HLKKMINFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYINGQHNRTHLPSFEELSFNAADMLLKNISINSSYTSRLMATRHVNELPSQIGNKTECALLGFVNGSLKRDYADLRTQWPEEKLIKVYTFNSERKSMSTIIE-DEGKLLLLTKGASEMILNKCSFILGKNGKIQPFTTEDVEALVKNVIEPMASDGLRTIGLAYKEFVKKPDHDYQGLYNEKLDLENEHTLIKDLTLIGIVGIEDPVRPEVPPAIKKCQKAGITVRMVTGDNINTARSIAIKCGILKPGEDFLVMEGKEFNNRVRDPISGKIKQELIDQVWPKLRVLARSSPQDKYTLVTGIIDSHLTRSREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFLGACFITDSPLKAVQMLWVNLIMDTLASLALATEMPTEELLDRAPYGRTKPIISRRMIKNIMGQSIYQLAVTFYLLLHGNVLLDVENGRGLTERGINKPTQHFTAIFNTFVMMTLFNEFNSRKIHGQKNVFDGLQRNVLFIIIWVTTFVGQIVIVQYGGYALHTEALELDHWLWCMLFGIGVLLWAQLINCIPTTVIPKHMPWSKKKLPTAENQALNQYKSVDSGNESEDEDYDDIGDLARQNNDEDDDDIKNSGQILWIRGLSRLQTQQNTCNPNLDNRNDVVYGGVRRFTLSQVGGVQPLLAARRQSSYSNNEQNI-NLST 4139
            +  +  +L  LM LR  E +++++E YG V  +C+RLKTSP  GL+  +  +  R+  FG N+IPPK PKTF +L+WEALQD+TLI+L  AA+ISL L+ Y        +  GS+ G   DE E DAGWIEG AIL +V+ VV+VTAFNDW KE+QFRGLQ +IE   K  V+RG    ++ V DI+VGDI Q+KYGDLLPADG++IQ ND+K+DESSLTGE DHVKK  D DPM+LSGTHVMEGS +M+VTAVG+NSQ GIIF LLGA               E     T+  +  +H   + + + G   ++       L     +D +  SN        G A         +E      K++KKV APKK+ SVLQ KL KLA  IG  G +++S+TVTIL++ F I+ +V +K  W  +    +++  + F IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMT VQ YI   H +  +P    L   + D+L+  I+INS+YT++++       LP Q+GNKTEC LLG +   LKRDY  +R Q PEEKL KVYTFNS RKSMST+I+  +G   + +KGASE++L KCS IL + G+++ F   D + +VK VIEPMA +GLRTI +AY++F   P+ ++          ++E+ ++ DLT I +VGIEDPVRPEVP AI+KCQ+AGITVRMVTGDNINTAR+IAIKCGI+ PGEDFL ++GKEFN R+R+   G+++QE ID+VWPKLRVLARSSP DK+TLV GIIDS +   R+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNF+SIVKAVMWGRNVYDSI+KFLQFQLTVNVVAVIVAF GAC   DSPLKAVQMLWVNLIMDT ASLALATE P E LL R PYGR KP+IS  M KNI+G ++YQL + F LL  G  + D+++GR       + P++H+T IFNTFVMM LFNE N+RKIHG++NVFDG+ RN +F  I   TFV QIVIVQ+GG     + L L+ W+WC+  G+G L+W Q+I  IP           K +      Q  ++           DE  ++  +   +  D  + +++  GQILW RGL+R+QTQ    N                 T       Q   A RRQSS ++  Q++ N+S+
Sbjct:   24 FGCSVMDLRSLMELRGTEGVVKLQEDYGGVEGLCKRLKTSPTEGLLGVQADLDKRKEIFGKNLIPPKKPKTFLQLVWEALQDVTLIILELAALISLGLSFYHPPGESGGEMCGSAAGGVEDEGEADAGWIEGAAILLSVVCVVIVTAFNDWSKEKQFRGLQSRIEQEQKFQVVRGSQVIQLPVADILVGDIAQIKYGDLLPADGVLIQGNDLKIDESSLTGESDHVKKAADKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGVEEEEKKEKKGGAVEDGHQNTDCSHPPIHPIATITTD-GAAGINATGS-ANLINGKMQDGNMESNQIKVKKQDGAAAMEMQPLKSAEGGEADEKEKKKVSAPKKEKSVLQGKLTKLAVQIGYAGLVMSSITVTILVLYFSIDNFVMKKRPWMAECTPIYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTAVQCYIGDVHYK-KIPDPGVLPPKSLDLLINAIAINSAYTTKILPPDKEGGLPKQVGNKTECGLLGLIL-ELKRDYQPIRNQIPEEKLYKVYTFNSVRKSMSTVIKLPDGSFRMYSKGASEIVLKKCSHILNEVGELRVFRPRDKDEMVKKVIEPMACEGLRTICVAYRDFSNDPEPNW----------DDENNILNDLTAICVVGIEDPVRPEVPDAIQKCQRAGITVRMVTGDNINTARAIAIKCGIIHPGEDFLCIDGKEFNRRIRNE-KGEVEQERIDKVWPKLRVLARSSPTDKHTLVKGIIDSTMADQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPNESLLKRKPYGRNKPLISSTMTKNILGHAVYQLVIIFTLLFVGEQIFDIDSGRDAPLH--SPPSEHYTLIFNTFVMMQLFNEINARKIHGERNVFDGIFRNPIFCSIVFGTFVVQIVIVQFGGKPFSCQPLNLEKWMWCVFLGLGELVWGQVIATIPNL---------KLRFLRRAGQLTHK-----------DELPEEDVNEENEEIDHAERELRR-GQILWFRGLNRIQTQIEVVN-----------------TFKSGTSFQGAGALRRQSSTTSQTQDVTNVSS 1191          
BLAST of Calcium-transporting ATPase vs. Ensembl Medaka
Match: atp2b2 (ATPase plasma membrane Ca2+ transporting 2 [Source:NCBI gene;Acc:101156400])

HSP 1 Score: 1191.02 bits (3080), Expect = 0.000e+0
Identity = 644/1156 (55.71%), Postives = 811/1156 (70.16%), Query Frame = 3
Query:  573 YEMNTKELTDLMMLRQQEAILEIKEKYGDVYEICRRLKTSPQSGLIDDEESIGNRRREFGSNIIPPKPPKTFFRLMWEALQDLTLIVLMGAAVISLALALY-------SKFSGSSHG---DETEGDAGWIEXXXXXXXXXXXXXXTAFNDWQKERQFRGLQDQIEGNHKIAVIRGGVAKEXXXXXXXXXXXCQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDIDPMMLSGTHVMEGSAKMLVTAVGLNSQAGIIFALLGAANTEEKDKAETEKPNNQVHKTNSNSKNKGCKNVDEEVELMKLTETHPEDADRCSNHKPNNYASGDANKSEIKNGKVKQEKKVRAPKKKGSVLQLKLNKLASSIGQIGTIVASLTVTILIIKFCINTYVFEKEGWSMD----HLKKMINFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYINGQHNRTHLPSFEELSFNAADMLLKNISINSSYTSRLMATRHVNELPSQIGNKTECALLGFVNGSLKRDYADLRTQWPEEKLIKVYTFNSERKSMSTIIE-DEGKLLLLTKGASEMILNKCSFILGKNGKIQPFTTEDVEALVKNVIEPMASDGLRTIGLAYKEFVKKPDHDYQGLYNEKLDLENEHTLIKDLTLIGIVGIEDPVRPEVPPAIKKCQKAGITVRMVTGDNINTARSIAIKCGILKPGEDFLVMEGKEFNNRVRDPISGKIKQELIDQVWPKLRVLARSSPQDKYTLVTGIIDSHLTRSREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFLGACFITDSPLKAVQMLWVNLIMDTLASLALATEMPTEELLDRAPYGRTKPIISRRMIKNIMGQSIYQLAVTFYLLLHGNVLLDVENGRGLTERGINKPTQHFTAIFNTFVMMTLFNEFNSRKIHGQKNVFDGLQRNVLFIIIWVTTFVGQIVIVQYGGYALHTEALELDHWLWCMLFGIGVLLWAQLINCIPTTVIPKHMPWSKKKLPTAENQALNQYKSVDSGNESEDEDYDDIGDLARQNNDEDDDDIKNSGQILWIRGLSRLQTQQNTCN 3995
            +  +  +L  LM LR  E +++++E YG V  +C+RLKTSP  GL+  +  +  R+  FG N+IPPK PKTF +L+WEALQD+TLI+L  AA+ISL L+ Y        +  GS+ G   DE E DAGWIEG AIL +V+ VV+VTAFNDW KE+QFRGLQ +IE   K  V+RG    ++ V DI+VGDI Q+KYGDLLPADG++IQ ND+K+DESSLTGE DHVKK  D DPM+LSGTHVMEGS +M+VTAVG+NSQ GIIF LLGA   EE+ K +        H+     ++   ++   ++++ K      +D       +P   A G            K++KKV APKK+ SVLQ KL KLA  IG  G +++S+TVTIL++ F I+ +V +K  W  +    +++  + F IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMT VQ YI   H +  +P    L   + D+L+  I+INS+YT++++       LP Q+GNKTEC LLG +   LKRDY  +R Q PEEKL KVYTFNS RKSMST+I+  +G   + +KGASE++L KCS IL + G+++ F   D + +VK VIEPMA +GLRTI +AY++F   P+ ++          ++E+ ++ DLT I +VGIEDPVRPEVP AI+KCQ+AGITVRMVTGDNINTAR+IAIKCGI+ PGEDFL ++GKEFN R+R+   G+++QE ID+VWPKLRVLARSSP DK+TLV GIIDS +   R+VVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNF+SIVKAVMWGRNVYDSI+KFLQFQLTVNVVAVIVAF GAC   DSPLKAVQMLWVNLIMDT ASLALATE P E LL R PYGR KP+IS  M KNI+G ++YQL + F LL  G  + D+++GR       + P++H+T IFNTFVMM LFNE N+RKIHG++NVFDG+ RN +F  I   TFV QIVIVQ+GG     + L L+ W+WC+  G+G L+W Q+I  IP           K +      Q  ++           DE  ++  +   +  D  + +++  GQILW RGL+R+QTQ    N
Sbjct:   24 FGCSVMDLRSLMELRGTEGVVKLQEDYGGVEGLCKRLKTSPTEGLLGVQADLDKRKEIFGKNLIPPKKPKTFLQLVWEALQDVTLIILELAALISLGLSFYHPPGESGGEMCGSAAGGVEDEGEADAGWIEGAAILLSVVCVVIVTAFNDWSKEKQFRGLQSRIEQEQKFQVVRGSQVIQLPVADILVGDIAQIKYGDLLPADGVLIQGNDLKIDESSLTGESDHVKKAADKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGVEEEEKKEKKGGAVEDGHQNTGKMQDGNMES--NQIKVKK------QDGAAAMEMQPLKSAEGGEADE-------KEKKKVSAPKKEKSVLQGKLTKLAVQIGYAGLVMSSITVTILVLYFSIDNFVMKKRPWMAECTPIYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTAVQCYIGDVHYK-KIPDPGVLPPKSLDLLINAIAINSAYTTKILPPDKEGGLPKQVGNKTECGLLGLIL-ELKRDYQPIRNQIPEEKLYKVYTFNSVRKSMSTVIKLPDGSFRMYSKGASEIVLKKCSHILNEVGELRVFRPRDKDEMVKKVIEPMACEGLRTICVAYRDFSNDPEPNW----------DDENNILNDLTAICVVGIEDPVRPEVPDAIQKCQRAGITVRMVTGDNINTARAIAIKCGIIHPGEDFLCIDGKEFNRRIRNE-KGEVEQERIDKVWPKLRVLARSSPTDKHTLVKGIIDSTMADQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPNESLLKRKPYGRNKPLISSTMTKNILGHAVYQLVIIFTLLFVGEQIFDIDSGRDAPLH--SPPSEHYTLIFNTFVMMQLFNEINARKIHGERNVFDGIFRNPIFCSIVFGTFVVQIVIVQFGGKPFSCQPLNLEKWMWCVFLGLGELVWGQVIATIPNL---------KLRFLRRAGQLTHK-----------DELPEEDVNEENEEIDHAERELRR-GQILWFRGLNRIQTQIRVVN 1128          
BLAST of Calcium-transporting ATPase vs. Planmine SMEST
Match: SMESG000063816.1 (SMESG000063816.1)

HSP 1 Score: 2303.09 bits (5967), Expect = 0.000e+0
Identity = 1144/1156 (98.96%), Postives = 1147/1156 (99.22%), Query Frame = 3
Query:  558 MTEETYEMNTKELTDLMMLRQQEAILEIKEKYGDVYEICRRLKTSPQSGLIDDEESIGNRRREFGSNIIPPKPPKTFFRLMWEALQDLTLIVLMGAAVISLALALYSKFSGSSHGDETEGDAGWIEXXXXXXXXXXXXXXTAFNDWQKERQFRGLQDQIEGNHKIAVIRGGVAKEXXXXXXXXXXXCQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDIDPMMLSGTHVMEGSAKMLVTAVGLNSQAGIIFALLGAANTEEKDKAETEKPNNQVHKTNSNSKNKGCKNVDEEVELMKLTETHPEDADRCSNHKPNNYASGDANKSEIKNGKVKQEKKVRAPKKKGSVLQLKLNKLASSIGQIGTIVASLTVTILIIKFCINTYVFEKEGWSMDHLKKMINFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYINGQHNRTHLPSFEELSFNAADMLLKNISINSSYTSRLMATRHVNELPSQIGNKTECALLGFVNGSLKRDYADLRTQWPEEKLIKVYTFNSERKSMSTIIEDEGKLLLLTKGASEMILNKCSFILGKNGKIQPFTTEDVEALVKNVIEPMASDGLRTIGLAYKEFVKKPDHDYQGLYNEKLDLENEHTLIKDLTLIGIVGIEDPVRPEVPPAIKKCQKAGITVRMVTGDNINTARSIAIKCGILKPGEDFLVMEGKEFNNRVRDPISGKIKQELIDQVWPKLRVLARSSPQDKYTLVTGIIDSHLTRSREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFLGACFITDSPLKAVQMLWVNLIMDTLASLALATEMPTEELLDRAPYGRTKPIISRRMIKNIMGQSIYQLAVTFYLLLHGNVLLDVENGRGLTERGINKPTQHFTAIFNTFVMMTLFNEFNSRKIHGQKNVFDGLQRNVLFIIIWVTTFVGQIVIVQYGGYALHTEALELDHWLWCMLFGIGVLLWAQLINCIPTTVIPKHMPWSKKKLPTAENQALNQYKSVDSGNESEDEDYDDIGDLARQNNDEDDDDIKNSGQILWIRGLSRLQTQQNTCNP---NLDNRN 4016
            MTEETYEMNTKELTDLMMLRQQEAILEIKEKYGDVYEICRRLKTSPQSGLIDDEESIGNRRREFGSNIIPPKPPKTFFRLMWEALQDLTLIVLMGAAVISLALALYSKFSGSSHGDETEGDAGWIEGVAILGAVIVVVLVTAFNDWQKERQFRGLQDQIEGNHKIAVIRGGVAKEIIVGDIVVGDICQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDIDPMMLSGTHVMEGSAKMLVTAVGLNSQAGIIFALLGAANTEEKDKAETEKPNNQVHKTNSNSKNKGCKNVDEEVELMKLTETHPEDADRCSNHKPNNYASGDANKSEIKNGKVKQEKKVRAPKKKGSVLQLKLNKLASSIGQIGTIVASLTVTILIIKFCINTYVFEKEGWSMDHLKKMINFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYINGQHNRTHLPSFEELSFNAADML+KNISINSSYTSRLMATRHVNELPSQIGNKTECALLGFVNGSLKRDYADLRTQWPEEKLIKVYTFNSERKSMSTIIEDEGKLLLLTKGASEMILNKCSFILGKNGKIQPFTTEDVEALVKNVIEPMASDGLRTIGLAYKEFVKKPDHDYQGLYNEKLDLENEHTLIKDLTLIGIVGIEDPVRPEVPPAIKKCQKAGITVRMVTGDNINTARSIAIKCGILKPGEDFLVMEGKEFNNRVRDPISGKIKQELIDQVWPKLRVLARSSPQDKYTLVTGIIDSHLTRSREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFLGACFITDSPLKAVQMLWVNLIMDTLASLALATEMPTEELLDRAPYGRTKPIISRRMIKNIMGQSIYQLAVTFYLLLHGNVLLDVENGRGLTERGINKPTQHFTAIFNTFVMMTLFNEFNSRKIHGQKNVFDGLQRNVLFIIIWVTTFVGQIVIVQYGGYALHTEALELDHWLWCMLFGIGVLLWAQLINCIPTTVIPKHMPWSKKKLPTAENQALNQYKSVDSGNESEDEDYDDIGDLARQNNDEDDDDIKNSGQILWIRGLSRLQTQ    N    +LD R+
Sbjct:    1 MTEETYEMNTKELTDLMMLRQQEAILEIKEKYGDVYEICRRLKTSPQSGLIDDEESIGNRRREFGSNIIPPKPPKTFFRLMWEALQDLTLIVLMGAAVISLALALYSKFSGSSHGDETEGDAGWIEGVAILGAVIVVVLVTAFNDWQKERQFRGLQDQIEGNHKIAVIRGGVAKEIIVGDIVVGDICQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDIDPMMLSGTHVMEGSAKMLVTAVGLNSQAGIIFALLGAANTEEKDKAETEKPNNQVHKTNSNSKNKGCKNVDEEVELMKLTETHPEDADRCSNHKPNNYASGDANKSEIKNGKVKQEKKVRAPKKKGSVLQLKLNKLASSIGQIGTIVASLTVTILIIKFCINTYVFEKEGWSMDHLKKMINFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYINGQHNRTHLPSFEELSFNAADMLVKNISINSSYTSRLMATRHVNELPSQIGNKTECALLGFVNGSLKRDYADLRTQWPEEKLIKVYTFNSERKSMSTIIEDEGKLLLLTKGASEMILNKCSFILGKNGKIQPFTTEDVEALVKNVIEPMASDGLRTIGLAYKEFVKKPDHDYQGLYNEKLDLENEHTLIKDLTLIGIVGIEDPVRPEVPPAIKKCQKAGITVRMVTGDNINTARSIAIKCGILKPGEDFLVMEGKEFNNRVRDPISGKIKQELIDQVWPKLRVLARSSPQDKYTLVTGIIDSHLTRSREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFLGACFITDSPLKAVQMLWVNLIMDTLASLALATEMPTEELLDRAPYGRTKPIISRRMIKNIMGQSIYQLAVTFYLLLHGNVLLDVENGRGLTERGINKPTQHFTAIFNTFVMMTLFNEFNSRKIHGQKNVFDGLQRNVLFIIIWVTTFVGQIVIVQYGGYALHTEALELDHWLWCMLFGIGVLLWAQLINCIPTTVIPKHMPWSKKKLPTAENQALNQYKSVDSGNESEDEDYDDIGDLARQNNDEDDDDIKNSGQILWIRGLSRLQTQMRVVNAFRSSLDPRS 1156          
BLAST of Calcium-transporting ATPase vs. Planmine SMEST
Match: SMESG000063816.1 (SMESG000063816.1)

HSP 1 Score: 2286.53 bits (5924), Expect = 0.000e+0
Identity = 1137/1149 (98.96%), Postives = 1140/1149 (99.22%), Query Frame = 3
Query:  579 MNTKELTDLMMLRQQEAILEIKEKYGDVYEICRRLKTSPQSGLIDDEESIGNRRREFGSNIIPPKPPKTFFRLMWEALQDLTLIVLMGAAVISLALALYSKFSGSSHGDETEGDAGWIEXXXXXXXXXXXXXXTAFNDWQKERQFRGLQDQIEGNHKIAVIRGGVAKEXXXXXXXXXXXCQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDIDPMMLSGTHVMEGSAKMLVTAVGLNSQAGIIFALLGAANTEEKDKAETEKPNNQVHKTNSNSKNKGCKNVDEEVELMKLTETHPEDADRCSNHKPNNYASGDANKSEIKNGKVKQEKKVRAPKKKGSVLQLKLNKLASSIGQIGTIVASLTVTILIIKFCINTYVFEKEGWSMDHLKKMINFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYINGQHNRTHLPSFEELSFNAADMLLKNISINSSYTSRLMATRHVNELPSQIGNKTECALLGFVNGSLKRDYADLRTQWPEEKLIKVYTFNSERKSMSTIIEDEGKLLLLTKGASEMILNKCSFILGKNGKIQPFTTEDVEALVKNVIEPMASDGLRTIGLAYKEFVKKPDHDYQGLYNEKLDLENEHTLIKDLTLIGIVGIEDPVRPEVPPAIKKCQKAGITVRMVTGDNINTARSIAIKCGILKPGEDFLVMEGKEFNNRVRDPISGKIKQELIDQVWPKLRVLARSSPQDKYTLVTGIIDSHLTRSREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFLGACFITDSPLKAVQMLWVNLIMDTLASLALATEMPTEELLDRAPYGRTKPIISRRMIKNIMGQSIYQLAVTFYLLLHGNVLLDVENGRGLTERGINKPTQHFTAIFNTFVMMTLFNEFNSRKIHGQKNVFDGLQRNVLFIIIWVTTFVGQIVIVQYGGYALHTEALELDHWLWCMLFGIGVLLWAQLINCIPTTVIPKHMPWSKKKLPTAENQALNQYKSVDSGNESEDEDYDDIGDLARQNNDEDDDDIKNSGQILWIRGLSRLQTQQNTCNP---NLDNRN 4016
            MNTKELTDLMMLRQQEAILEIKEKYGDVYEICRRLKTSPQSGLIDDEESIGNRRREFGSNIIPPKPPKTFFRLMWEALQDLTLIVLMGAAVISLALALYSKFSGSSHGDETEGDAGWIEGVAILGAVIVVVLVTAFNDWQKERQFRGLQDQIEGNHKIAVIRGGVAKEIIVGDIVVGDICQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDIDPMMLSGTHVMEGSAKMLVTAVGLNSQAGIIFALLGAANTEEKDKAETEKPNNQVHKTNSNSKNKGCKNVDEEVELMKLTETHPEDADRCSNHKPNNYASGDANKSEIKNGKVKQEKKVRAPKKKGSVLQLKLNKLASSIGQIGTIVASLTVTILIIKFCINTYVFEKEGWSMDHLKKMINFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYINGQHNRTHLPSFEELSFNAADML+KNISINSSYTSRLMATRHVNELPSQIGNKTECALLGFVNGSLKRDYADLRTQWPEEKLIKVYTFNSERKSMSTIIEDEGKLLLLTKGASEMILNKCSFILGKNGKIQPFTTEDVEALVKNVIEPMASDGLRTIGLAYKEFVKKPDHDYQGLYNEKLDLENEHTLIKDLTLIGIVGIEDPVRPEVPPAIKKCQKAGITVRMVTGDNINTARSIAIKCGILKPGEDFLVMEGKEFNNRVRDPISGKIKQELIDQVWPKLRVLARSSPQDKYTLVTGIIDSHLTRSREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFLGACFITDSPLKAVQMLWVNLIMDTLASLALATEMPTEELLDRAPYGRTKPIISRRMIKNIMGQSIYQLAVTFYLLLHGNVLLDVENGRGLTERGINKPTQHFTAIFNTFVMMTLFNEFNSRKIHGQKNVFDGLQRNVLFIIIWVTTFVGQIVIVQYGGYALHTEALELDHWLWCMLFGIGVLLWAQLINCIPTTVIPKHMPWSKKKLPTAENQALNQYKSVDSGNESEDEDYDDIGDLARQNNDEDDDDIKNSGQILWIRGLSRLQTQ    N    +LD R+
Sbjct:    1 MNTKELTDLMMLRQQEAILEIKEKYGDVYEICRRLKTSPQSGLIDDEESIGNRRREFGSNIIPPKPPKTFFRLMWEALQDLTLIVLMGAAVISLALALYSKFSGSSHGDETEGDAGWIEGVAILGAVIVVVLVTAFNDWQKERQFRGLQDQIEGNHKIAVIRGGVAKEIIVGDIVVGDICQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDIDPMMLSGTHVMEGSAKMLVTAVGLNSQAGIIFALLGAANTEEKDKAETEKPNNQVHKTNSNSKNKGCKNVDEEVELMKLTETHPEDADRCSNHKPNNYASGDANKSEIKNGKVKQEKKVRAPKKKGSVLQLKLNKLASSIGQIGTIVASLTVTILIIKFCINTYVFEKEGWSMDHLKKMINFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYINGQHNRTHLPSFEELSFNAADMLVKNISINSSYTSRLMATRHVNELPSQIGNKTECALLGFVNGSLKRDYADLRTQWPEEKLIKVYTFNSERKSMSTIIEDEGKLLLLTKGASEMILNKCSFILGKNGKIQPFTTEDVEALVKNVIEPMASDGLRTIGLAYKEFVKKPDHDYQGLYNEKLDLENEHTLIKDLTLIGIVGIEDPVRPEVPPAIKKCQKAGITVRMVTGDNINTARSIAIKCGILKPGEDFLVMEGKEFNNRVRDPISGKIKQELIDQVWPKLRVLARSSPQDKYTLVTGIIDSHLTRSREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFLGACFITDSPLKAVQMLWVNLIMDTLASLALATEMPTEELLDRAPYGRTKPIISRRMIKNIMGQSIYQLAVTFYLLLHGNVLLDVENGRGLTERGINKPTQHFTAIFNTFVMMTLFNEFNSRKIHGQKNVFDGLQRNVLFIIIWVTTFVGQIVIVQYGGYALHTEALELDHWLWCMLFGIGVLLWAQLINCIPTTVIPKHMPWSKKKLPTAENQALNQYKSVDSGNESEDEDYDDIGDLARQNNDEDDDDIKNSGQILWIRGLSRLQTQMRVVNAFRSSLDPRS 1149          
BLAST of Calcium-transporting ATPase vs. Planmine SMEST
Match: SMESG000038461.1 (SMESG000038461.1)

HSP 1 Score: 1562.74 bits (4045), Expect = 0.000e+0
Identity = 834/1228 (67.92%), Postives = 968/1228 (78.83%), Query Frame = 3
Query:  561 TEETYEMNTKELTDLMMLRQQEAILEIKEKYGDVYEICRRLKTSPQSGLIDDEESIGNRRREFGSNIIPPKPPKTFFRLMWEALQDLTLIVLMGAAVISLALALYSKFSGSSHGDETEGDAGWIEXXXXXXXXXXXXXXTAFNDWQKERQFRGLQDQIEGNHKIAVIRGGVAKEXXXXXXXXXXXCQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDIDPMMLSGTHVMEGSAKMLVTAVGLNSQAGIIFALLGAANTEEKDKAETEKPNNQVHKTNSNSKNKGCKNVDEEVELMKLTETHPEDADRCSNHKPNNYASGDANKSEIKNGKVKQEKKVRAPKKKGSVLQLKLNKLASSIGQIGTIVASLTVTILIIKFCINTYVFEKEGWSMDHLKKMINFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYINGQHNRTHLPSFEELSFNAADMLLKNISINSSYTSRLMATRHVNELPSQIGNKTECALLGFVNGSLKRDYADLRTQWPEEKLIKVYTFNSERKSMSTIIEDEGKLLLLTKGASEMILNKCSFILGKNGKIQPFTTEDVEALVKNVIEPMASDGLRTIGLAYKEFVKKPDHDYQG--LYNEKLDLENEHTLIKDLTLIGIVGIEDPVRPEVPPAIKKCQKAGITVRMVTGDNINTARSIAIKCGILKPGEDFLVMEGKEFNNRVRDPISGKIKQELIDQVWPKLRVLARSSPQDKYTLVTGIIDSHLTRSREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFLGACFITDSPLKAVQMLWVNLIMDTLASLALATEMPTEELLDRAPYGRTKPIISRRMIKNIMGQSIYQLAVTFYLLLHGNVLLDVENGRGLTERGINKPTQHFTAIFNTFVMMTLFNEFNSRKIHGQKNVFDGLQRNVLFIIIWVTTFVGQIVIVQYGGYALHTEALELDHWLWCMLFGIGVLLWAQLINCIPTTVIPKHMPWSKKKLPTAENQALNQYKSVDSGNESEDEDYDDIGDLARQNNDEDDDDIKNSGQILWIRGLSRLQTQQNTCNPNLDNRNDVVYGGVRRFTLSQVGGVQPLLAARRQSSYSNNEQNINLSTNQTESIIIPTATKSGSVDSNLSTHRNRRKKLKT 4238
            ++  + +  KELT+LM  RQ EAI EIK KY D+  +C +LKTSP  GL   ++ I  RR  FGSN+IPPKPPKTF RLM+EALQD+TLIVLMGAAVISL LALYSK+SG    D +E DAGWIEGVAILGAV+VVV+VTAFNDWQKE+QFRGLQD+IEGNHKIAVIR G   EI+VGDIVVGDICQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVD DPM+LSGTHVMEGS KM+VTAVGL+SQAGIIFALLGAA   EK   E  +        +            + VEL KLT       D   NH  ++    D  K E       ++KK ++ KKKGSVLQ KLNKLA+ IG++GT++A LTV ILII+FCI TY  +   W MDHLKKMI+FLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQ++ NG++ R +LP + +L  N  D LLKNI++NSSYTSRL+  +   EL +QIGNKTEC+LLGF+NG++ +DYA+LR+ W E+KLIK+YTFNS RKSMSTII+D+  +LLLTKGASEM+L+KCSFI+GK+G IQ FT  D   L+K+VIEPMA DGLRTIGLAYKEFV       +G  +Y   +DLE+EH +IKDLT IGIVGIEDPVRPEVPPAIKKCQ AGITVRMVTGDN+NTARSIAIKCGILKP +DF+VMEGKEFNN++RD  +GKIKQ  IDQ+WP+LRVLARSSPQDKYTLVTGIIDSHL+ +REVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAV+WGRNVYDSI+KFLQFQLTVNVVAVIVAF+GAC +TDSPLKAVQMLWVNLIMDTLASLALATE+PTEELLDRAPYGRTK IISRRM+KNI+GQS+YQL VTFYL+ HG +LLDV+N RG+T RG  KP++HFTA+FNTFV+MTLFNE NSRKIHGQ+NVF G+ RN++FIIIW+TTFVGQIVI+Q+GGYAL T  L+++HW+WCM FG G LLWAQL+N +PT+++PK     KK++P  E       +  D    S                 E +D++K+ GQ LWIRGLSRLQTQQ+  N  LDNR D VYGGVRR+TLSQV G+ P+L  R+ S      ++ N              + S   DS+L  H  R K + T
Sbjct:    3 SDSKFSIGVKELTELMGFRQFEAIEEIKNKYQDINNLCAKLKTSPNDGLSATDDLI-LRREVFGSNVIPPKPPKTFLRLMFEALQDVTLIVLMGAAVISLGLALYSKYSGEETSDSSESDAGWIEGVAILGAVVVVVMVTAFNDWQKEKQFRGLQDKIEGNHKIAVIRSGRIGEILVGDIVVGDICQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDTDPMLLSGTHVMEGSGKMVVTAVGLSSQAGIIFALLGAAELNEKSTKEPTETKKTKKNKS------------DSVELEKLT-------DNTENHYLSDKQKDDTTKEE------AKKKKKKSFKKKGSVLQTKLNKLAALIGKVGTVIAVLTVVILIIRFCIETYHIKSMLWHMDHLKKMIHFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFFNGKYYRQNLPQYNDLPENLTDKLLKNIALNSSYTSRLLPGKSQGELLTQIGNKTECSLLGFMNGAIGKDYAELRSIWTEDKLIKIYTFNSVRKSMSTIIKDK-NVLLLTKGASEMVLSKCSFIVGKDGSIQNFTKNDANELIKSVIEPMAKDGLRTIGLAYKEFVDDGSEPQKGQDIYLPNIDLEDEHNIIKDLTCIGIVGIEDPVRPEVPPAIKKCQNAGITVRMVTGDNVNTARSIAIKCGILKPEDDFIVMEGKEFNNKIRDSKTGKIKQSKIDQIWPRLRVLARSSPQDKYTLVTGIIDSHLSTAREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVLWGRNVYDSISKFLQFQLTVNVVAVIVAFVGACVLTDSPLKAVQMLWVNLIMDTLASLALATELPTEELLDRAPYGRTKSIISRRMVKNILGQSLYQLIVTFYLIWHGEILLDVDNARGMTARGNTKPSEHFTAVFNTFVIMTLFNEINSRKIHGQRNVFIGINRNIIFIIIWITTFVGQIVIIQFGGYALSTAPLDIEHWMWCMFFGFGSLLWAQLVNSVPTSIVPKR---KKKEIPQPEKDESESDEEFDELGTSTPY-------------GESEDELKSPGQKLWIRGLSRLQTQQSKRNSILDNRTDGVYGGVRRYTLSQVAGIVPMLGGRQISCPVGRLKSAN--------------SVSSEYDSDLDKHTERNKLIST 1173          
BLAST of Calcium-transporting ATPase vs. Planmine SMEST
Match: SMESG000038461.1 (SMESG000038461.1)

HSP 1 Score: 1509.97 bits (3908), Expect = 0.000e+0
Identity = 801/1142 (70.14%), Postives = 925/1142 (81.00%), Query Frame = 3
Query:  561 TEETYEMNTKELTDLMMLRQQEAILEIKEKYGDVYEICRRLKTSPQSGLIDDEESIGNRRREFGSNIIPPKPPKTFFRLMWEALQDLTLIVLMGAAVISLALALYSKFSGSSHGDETEGDAGWIEXXXXXXXXXXXXXXTAFNDWQKERQFRGLQDQIEGNHKIAVIRGGVAKEXXXXXXXXXXXCQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDIDPMMLSGTHVMEGSAKMLVTAVGLNSQAGIIFALLGAANTEEKDKAETEKPNNQVHKTNSNSKNKGCKNVDEEVELMKLTETHPEDADRCSNHKPNNYASGDANKSEIKNGKVKQEKKVRAPKKKGSVLQLKLNKLASSIGQIGTIVASLTVTILIIKFCINTYVFEKEGWSMDHLKKMINFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYINGQHNRTHLPSFEELSFNAADMLLKNISINSSYTSRLMATRHVNELPSQIGNKTECALLGFVNGSLKRDYADLRTQWPEEKLIKVYTFNSERKSMSTIIEDEGKLLLLTKGASEMILNKCSFILGKNGKIQPFTTEDVEALVKNVIEPMASDGLRTIGLAYKEFVKKPDHDYQG--LYNEKLDLENEHTLIKDLTLIGIVGIEDPVRPEVPPAIKKCQKAGITVRMVTGDNINTARSIAIKCGILKPGEDFLVMEGKEFNNRVRDPISGKIKQELIDQVWPKLRVLARSSPQDKYTLVTGIIDSHLTRSREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFLGACFITDSPLKAVQMLWVNLIMDTLASLALATEMPTEELLDRAPYGRTKPIISRRMIKNIMGQSIYQLAVTFYLLLHGNVLLDVENGRGLTERGINKPTQHFTAIFNTFVMMTLFNEFNSRKIHGQKNVFDGLQRNVLFIIIWVTTFVGQIVIVQYGGYALHTEALELDHWLWCMLFGIGVLLWAQLINCIPTTVIPKHMPWSKKKLPTAENQALNQYKSVDSGNESEDEDYDDIGDLARQNNDEDDDDIKNSGQILWIRGLSRLQTQ 3980
            ++  + +  KELT+LM  RQ EAI EIK KY D+  +C +LKTSP  GL   ++ I  RR  FGSN+IPPKPPKTF RLM+EALQD+TLIVLMGAAVISL LALYSK+SG    D +E DAGWIEGVAILGAV+VVV+VTAFNDWQKE+QFRGLQD+IEGNHKIAVIR G   EI+VGDIVVGDICQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVD DPM+LSGTHVMEGS KM+VTAVGL+SQAGIIFALLGAA   EK   E  +        +            + VEL KLT       D   NH  ++    D  K E       ++KK ++ KKKGSVLQ KLNKLA+ IG++GT++A LTV ILII+FCI TY  +   W MDHLKKMI+FLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQ++ NG++ R +LP + +L  N  D LLKNI++NSSYTSRL+  +   EL +QIGNKTEC+LLGF+NG++ +DYA+LR+ W E+KLIK+YTFNS RKSMSTII+D+  +LLLTKGASEM+L+KCSFI+GK+G IQ FT  D   L+K+VIEPMA DGLRTIGLAYKEFV       +G  +Y   +DLE+EH +IKDLT IGIVGIEDPVRPEVPPAIKKCQ AGITVRMVTGDN+NTARSIAIKCGILKP +DF+VMEGKEFNN++RD  +GKIKQ  IDQ+WP+LRVLARSSPQDKYTLVTGIIDSHL+ +REVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAV+WGRNVYDSI+KFLQFQLTVNVVAVIVAF+GAC +TDSPLKAVQMLWVNLIMDTLASLALATE+PTEELLDRAPYGRTK IISRRM+KNI+GQS+YQL VTFYL+ HG +LLDV+N RG+T RG  KP++HFTA+FNTFV+MTLFNE NSRKIHGQ+NVF G+ RN++FIIIW+TTFVGQIVI+Q+GGYAL T  L+++HW+WCM FG G LLWAQL+N +PT+++PK     KK++P  E       +  D    S                 E +D++K+ GQ LWIRGLSRLQTQ
Sbjct:    3 SDSKFSIGVKELTELMGFRQFEAIEEIKNKYQDINNLCAKLKTSPNDGLSATDDLI-LRREVFGSNVIPPKPPKTFLRLMFEALQDVTLIVLMGAAVISLGLALYSKYSGEETSDSSESDAGWIEGVAILGAVVVVVMVTAFNDWQKEKQFRGLQDKIEGNHKIAVIRSGRIGEILVGDIVVGDICQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDTDPMLLSGTHVMEGSGKMVVTAVGLSSQAGIIFALLGAAELNEKSTKEPTETKKTKKNKS------------DSVELEKLT-------DNTENHYLSDKQKDDTTKEE------AKKKKKKSFKKKGSVLQTKLNKLAALIGKVGTVIAVLTVVILIIRFCIETYHIKSMLWHMDHLKKMIHFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFFNGKYYRQNLPQYNDLPENLTDKLLKNIALNSSYTSRLLPGKSQGELLTQIGNKTECSLLGFMNGAIGKDYAELRSIWTEDKLIKIYTFNSVRKSMSTIIKDK-NVLLLTKGASEMVLSKCSFIVGKDGSIQNFTKNDANELIKSVIEPMAKDGLRTIGLAYKEFVDDGSEPQKGQDIYLPNIDLEDEHNIIKDLTCIGIVGIEDPVRPEVPPAIKKCQNAGITVRMVTGDNVNTARSIAIKCGILKPEDDFIVMEGKEFNNKIRDSKTGKIKQSKIDQIWPRLRVLARSSPQDKYTLVTGIIDSHLSTAREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVLWGRNVYDSISKFLQFQLTVNVVAVIVAFVGACVLTDSPLKAVQMLWVNLIMDTLASLALATELPTEELLDRAPYGRTKSIISRRMVKNILGQSLYQLIVTFYLIWHGEILLDVDNARGMTARGNTKPSEHFTAVFNTFVIMTLFNEINSRKIHGQRNVFIGINRNIIFIIIWITTFVGQIVIIQFGGYALSTAPLDIEHWMWCMFFGFGSLLWAQLVNSVPTSIVPKR---KKKEIPQPEKDESESDEEFDELGTSTPY-------------GESEDELKSPGQKLWIRGLSRLQTQ 1101          
BLAST of Calcium-transporting ATPase vs. Planmine SMEST
Match: SMESG000014734.1 (SMESG000014734.1)

HSP 1 Score: 1411.74 bits (3653), Expect = 0.000e+0
Identity = 743/1170 (63.50%), Postives = 904/1170 (77.26%), Query Frame = 3
Query:  573 YEMNTKELTDLMMLRQQEAILEIKEKYGDVYEICRRLKTSPQSGLIDDEESIGNRRRE-FGSNIIPPKPPKTFFRLMWEALQDLTLIVLMGAAVISLALALYSKFSGSSHGDETEGDAGWIEXXXXXXXXXXXXXXTAFNDWQKERQFRGLQDQIEGNHKIAVIRGGVAKEXXXXXXXXXXXCQVKYGDLLPADGIIIQSNDIKVDESSLTGEPDHVKKGVDIDPMMLSGTHVMEGSAKMLVTAVGLNSQAGIIFALLGAANTEEKDKAETEKPNNQVHKTNSNSKNKGCKNVDEEVELMKLTETHPEDADRCSNHKPNNYASGDANKSEIKNGKVKQEKKVRAPKKKGSVLQLKLNKLASSIGQIGTIVASLTVTILIIKFCINTYVFEKEGWSMD-HLKKMINFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYINGQHNRTHLPSFEELSFNAADMLLKNISINSSYTSRLMATRHVNELPSQIGNKTECALLGFVNGSLKRDYADLRTQWPEEKLIKVYTFNSERKSMSTIIEDEGK--LLLLTKGASEMILNKCSFILGKNGKIQPFTTEDVEALVKNVIEPMASDGLRTIGLAYKEFVKKPDHDY-QGLYNEKLDLENEHTLIKDLTLIGIVGIEDPVRPEVPPAIKKCQKAGITVRMVTGDNINTARSIAIKCGILKPGEDFLVMEGKEFNNRVRDPISGKIKQELIDQVWPKLRVLARSSPQDKYTLVTGIIDSHLTRSREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSIAKFLQFQLTVNVVAVIVAFLGACFITDSPLKAVQMLWVNLIMDTLASLALATEMPTEELLDRAPYGRTKPIISRRMIKNIMGQSIYQLAVTFYLLLHGNVLLDVENGRGLTERGINKPTQHFTAIFNTFVMMTLFNEFNSRKIHGQKNVFDGLQRNVLFIIIWVTTFVGQIVIVQYGGYALHTEALELDHWLWCMLFGIGVLLWAQLINCIPTTVIPKHMPWSKKK---LPTAENQALNQYKSVDSGNESEDEDYDDIGDLARQNNDEDDDDIKNSGQILWIRGLSRLQTQQNTCNPNLDNRNDVVYGGVRRFTLSQ 4058
            ++++ KEL D+M LR  EAI  I  KY  +  +C  L+TSP  GL  D+     RR E +GSN+IPPKPPKTFF+L++EA+QDLTLIVL+ AA+ISL L++Y+ + G    DE E   GWIEGVAIL AV++VV V AFNDWQKERQFRGLQ++IE  HK  VIR   ++EI VGDI+VGDICQ+KYGDLLPADG+IIQSND+K+DESSLTGE D VKKG + DP++LSGTHVMEGS K+L+TAVG+NSQAGIIFALLGAA+ E +D+     PN Q ++ N+ + +   KN    ++L    E   ED ++ S          DA  S  ++ K K++K +R   K+ SVLQLKL KLA  IG IGTIVA +TV ILIIKFC   +  + E W    HL+++INF IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQ++I G  N T LP + ELS     +L+  ISINS YTS+LM  R  NELP+Q+GNKTECALLGFV       Y ++R +W E+KL KVYTFNS RKSMST+I  E +    + TKGASE++++KCS+I+  NG+I PF+  D E +V+ VIEPMAS+GLRTIG+AYK  +     D  + +  E+ D ENE  ++ DLT + IVGIEDPVRPEVP AI KCQKAGITVRMVTGDN+NTARSIA KCGILKPG+DFLV+EGKEFN R+R P +G+++Q+LID+VWP LRVLARSSPQDKYTLV+GII SHL  +REVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSI+KFLQFQLTVN+VA++VAF+GACFITDSPLKAVQMLWVNLIMDTLASLALATE+P EELLDRAPYGRTKP+I+R MIK I+GQ IYQL V  YLL+ G  LLDV++GR L ++GI+KPT+HFT IFNTFVMMTLFNE N+RKIHGQ+N+F+GLQRNV+F+ IW+ T + QIVI+++GGYAL T AL+ DHWLWC+ FG+G L+W Q++  IP TV+PK +PW KKK   +  +  + + +  + ++ N S+++D + +  L  +     DDDI  SGQILWIRGLSRLQTQ+     NLD R  +    VRR+TL +
Sbjct:   16 FKLSVKELQDIMELRGHEAINHINNKYNGISGLCAGLRTSPAEGLQCDDFP---RRIEIYGSNVIPPKPPKTFFQLVFEAIQDLTLIVLIIAALISLGLSIYTMYFGDHKDDEAE--VGWIEGVAILAAVVLVVFVIAFNDWQKERQFRGLQNKIESEHKFQVIRNKQSQEIAVGDILVGDICQIKYGDLLPADGLIIQSNDLKLDESSLTGESDFVKKGENFDPIVLSGTHVMEGSGKILITAVGVNSQAGIIFALLGAASHELEDR-----PNAQENQNNNKTASNQLKN---GIDLTVKVEVTSEDGEKLS------MIENDAYNSTRESPKKKKDKSIRV--KEMSVLQLKLTKLAIQIGYIGTIVAMVTVAILIIKFCFVRFYKDGEQWKTGVHLQQIINFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAFIEGS-NFTKLPKYSELSSKFRALLVDAISINSGYTSQLMVPRTKNELPTQVGNKTECALLGFVLELGGPTYQEIRNKWTEDKLRKVYTFNSVRKSMSTVIPLESRKGYTIFTKGASEIVMSKCSYIVSTNGQIMPFSKSDQEKIVQTVIEPMASNGLRTIGIAYKNVIFNSRGDINETVITEEPDFENEAQIVSDLTCLAIVGIEDPVRPEVPNAIMKCQKAGITVRMVTGDNVNTARSIATKCGILKPGDDFLVLEGKEFNQRIRSPKTGEVRQDLIDKVWPSLRVLARSSPQDKYTLVSGIIASHLNPTREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNLVAIVVAFVGACFITDSPLKAVQMLWVNLIMDTLASLALATELPGEELLDRAPYGRTKPLITRPMIKYIVGQGIYQLIVIIYLLIAGENLLDVDSGRALADKGISKPTEHFTTIFNTFVMMTLFNEINARKIHGQRNIFEGLQRNVIFVFIWIATILSQIVIIEFGGYALSTSALDADHWLWCVFFGLGTLVWGQVLISIPNTVVPKRLPWVKKKKIPMSMSRRKDMAEGANYENMNNSDEKDEEPVSPLPYE-----DDDIVRSGQILWIRGLSRLQTQRQQQTTNLD-RQGLRMTSVRRYTLRR 1157          
The following BLAST results are available for this feature:
BLAST of Calcium-transporting ATPase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ATP2B30.000e+056.01ATPase plasma membrane Ca2+ transporting 3 [Source... [more]
ATP2B30.000e+057.43ATPase plasma membrane Ca2+ transporting 3 [Source... [more]
ATP2B30.000e+057.43ATPase plasma membrane Ca2+ transporting 3 [Source... [more]
ATP2B30.000e+055.63ATPase plasma membrane Ca2+ transporting 3 [Source... [more]
ATP2B30.000e+055.68ATPase plasma membrane Ca2+ transporting 3 [Source... [more]
back to top
BLAST of Calcium-transporting ATPase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mca-30.000e+057.72Calcium-transporting ATPase [Source:UniProtKB/TrE... [more]
mca-30.000e+057.72Calcium-transporting ATPase [Source:UniProtKB/TrE... [more]
mca-30.000e+057.72Calcium-transporting ATPase [Source:UniProtKB/TrE... [more]
mca-30.000e+057.72Calcium-transporting ATPase [Source:UniProtKB/TrE... [more]
mca-30.000e+057.72Calcium-transporting ATPase [Source:UniProtKB/TrE... [more]
back to top
BLAST of Calcium-transporting ATPase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PMCA0.000e+057.76gene:FBgn0259214 transcript:FBtr0300556[more]
PMCA0.000e+057.58gene:FBgn0259214 transcript:FBtr0304048[more]
PMCA0.000e+059.79gene:FBgn0259214 transcript:FBtr0300554[more]
PMCA0.000e+059.79gene:FBgn0259214 transcript:FBtr0300557[more]
PMCA0.000e+059.79gene:FBgn0259214 transcript:FBtr0304046[more]
back to top
BLAST of Calcium-transporting ATPase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp2b3b0.000e+054.29ATPase plasma membrane Ca2+ transporting 3b [Sourc... [more]
atp2b3b0.000e+055.76ATPase plasma membrane Ca2+ transporting 3b [Sourc... [more]
atp2b3b0.000e+055.76ATPase plasma membrane Ca2+ transporting 3b [Sourc... [more]
atp2b3a0.000e+055.58ATPase plasma membrane Ca2+ transporting 3a [Sourc... [more]
atp2b3a0.000e+056.35ATPase plasma membrane Ca2+ transporting 3a [Sourc... [more]
back to top
BLAST of Calcium-transporting ATPase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp2b10.000e+057.24Xenopus tropicalis ATPase, Ca++ transporting, plas... [more]
fam149a0.000e+055.65family with sequence similarity 149 member A [Sour... [more]
fam149a0.000e+056.11family with sequence similarity 149 member A [Sour... [more]
fam149a0.000e+056.01family with sequence similarity 149 member A [Sour... [more]
fam149a0.000e+055.85family with sequence similarity 149 member A [Sour... [more]
back to top
BLAST of Calcium-transporting ATPase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Atp2b30.000e+055.83ATPase, Ca++ transporting, plasma membrane 3 [Sour... [more]
Atp2b30.000e+057.24ATPase, Ca++ transporting, plasma membrane 3 [Sour... [more]
Atp2b30.000e+056.82ATPase, Ca++ transporting, plasma membrane 3 [Sour... [more]
Atp2b20.000e+054.75ATPase, Ca++ transporting, plasma membrane 2 [Sour... [more]
Atp2b20.000e+056.31ATPase, Ca++ transporting, plasma membrane 2 [Sour... [more]
back to top
BLAST of Calcium-transporting ATPase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q16720|AT2B3_HUMAN0.000e+057.43Plasma membrane calcium-transporting ATPase 3 OS=H... [more]
sp|Q64568|AT2B3_RAT0.000e+056.31Plasma membrane calcium-transporting ATPase 3 OS=R... [more]
sp|Q64542|AT2B4_RAT0.000e+054.67Plasma membrane calcium-transporting ATPase 4 OS=R... [more]
sp|P58165|AT2B2_OREMO0.000e+058.54Plasma membrane calcium-transporting ATPase 2 (Fra... [more]
sp|P11506|AT2B2_RAT0.000e+055.88Plasma membrane calcium-transporting ATPase 2 OS=R... [more]
back to top
BLAST of Calcium-transporting ATPase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2LFL90.000e+060.85Calcium-transporting ATPase OS=Opisthorchis feline... [more]
A0A068YDN30.000e+060.92Calcium-transporting ATPase OS=Echinococcus multil... [more]
A0A0X3P0950.000e+061.30Calcium-transporting ATPase OS=Schistocephalus sol... [more]
A0A0X3PBV00.000e+061.30Calcium-transporting ATPase OS=Schistocephalus sol... [more]
A0A4S2LG800.000e+060.43Calcium-transporting ATPase OS=Opisthorchis feline... [more]
back to top
BLAST of Calcium-transporting ATPase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000014864.20.000e+056.56pep primary_assembly:Astyanax_mexicanus-2.0:7:3530... [more]
atp2b1b0.000e+056.43plasma membrane calcium-transporting ATPase 1-like... [more]
atp2b1b0.000e+056.43plasma membrane calcium-transporting ATPase 1-like... [more]
atp2b1b0.000e+056.43plasma membrane calcium-transporting ATPase 1-like... [more]
atp2b1b0.000e+056.43plasma membrane calcium-transporting ATPase 1-like... [more]
back to top
BLAST of Calcium-transporting ATPase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000007912.12.739e-14456.10pep scaffold:Pmarinus_7.0:GL490738:3481:17315:-1 g... [more]
ENSPMAT00000007505.12.031e-8285.06pep scaffold:Pmarinus_7.0:GL487901:1873:6828:1 gen... [more]
ENSPMAT00000002775.13.775e-7360.52pep scaffold:Pmarinus_7.0:GL486089:3809:7949:1 gen... [more]
ENSPMAT00000001468.14.151e-6958.40pep scaffold:Pmarinus_7.0:GL477283:10882:33618:1 g... [more]
ENSPMAT00000010087.13.899e-6558.30pep scaffold:Pmarinus_7.0:GL482626:10460:17067:1 g... [more]
back to top
BLAST of Calcium-transporting ATPase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
PMC13.473e-12437.00Vacuolar Ca2+ ATPase involved in depleting cytosol... [more]
PMR11.894e-8131.05High affinity Ca2+/Mn2+ P-type ATPase; required fo... [more]
ENA21.023e-5636.41P-type ATPase sodium pump; involved in Na+ efflux ... [more]
ENA53.327e-5637.67Protein with similarity to P-type ATPase sodium pu... [more]
ENA14.032e-5636.15P-type ATPase sodium pump; involved in Na+ and Li+... [more]
back to top
BLAST of Calcium-transporting ATPase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO417750.000e+053.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO417740.000e+039.01Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO445173.438e-13735.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO474651.450e-7228.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO356168.399e-7228.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Calcium-transporting ATPase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp2b3b0.000e+055.55ATPase plasma membrane Ca2+ transporting 3 [Source... [more]
ENSORLT00000046870.10.000e+055.45ATPase plasma membrane Ca2+ transporting 1 [Source... [more]
atp2b20.000e+053.72ATPase plasma membrane Ca2+ transporting 2 [Source... [more]
atp2b20.000e+053.72ATPase plasma membrane Ca2+ transporting 2 [Source... [more]
atp2b20.000e+055.71ATPase plasma membrane Ca2+ transporting 2 [Source... [more]
back to top
BLAST of Calcium-transporting ATPase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000063816.10.000e+098.96SMESG000063816.1[more]
SMESG000063816.10.000e+098.96SMESG000063816.1[more]
SMESG000038461.10.000e+067.92SMESG000038461.1[more]
SMESG000038461.10.000e+070.14SMESG000038461.1[more]
SMESG000014734.10.000e+063.50SMESG000014734.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012043 ID=SMED30012043|Name=Calcium-transporting ATPase|organism=Schmidtea mediterranea sexual|type=transcript|length=5094bp
CGTCAAGGTAGGGTCTGGCAAAATCAATTTCTTGGAGTGTCTGGTCAATA
TGACGCTGAAAAGATGTTGCTGCGTTTCATAAACCGAAAGGCATCAAGTT
CTCGAATAAACCGAACGGCGTTATTACAGTGGTTATAGGGATATCGAGGT
GGCAAGTGGGATCAAATGATACTCTTTTTTAAAATCTATTTTTAATAAAA
TGTTTTTGTCATGCAGACTATTGAGAATGTCAGTTATTAATGGCATTGGG
TATAGTCGTTGCACTATCTTAGGAAACCGTCACGTTTAGTCACAAAATGT
GACAATTGAAACCATACACAGAATCGTTGGTTAATTATTAAAGATTTTTC
CTCTGAAAATAATATACAGATAATTGTTAGGGCAATTATTTCCAGAATGC
GGGTTAGTTTTTCAACTCAAATTTAATTGGCAATGGCGAAATATTATTTA
AAGTTGCGTTTCCAACATGCGGTTGTTTATTTAATTTTATTTTCTTCAAT
CGGTGTATGAAATTTAATTGAACAAAAAATTGAAAATTAGAAGATAACAA
AATCACTATGACTGAAGAGACATACGAAATGAATACGAAAGAACTGACAG
ATCTAATGATGCTTCGACAGCAGGAAGCCATATTAGAAATCAAAGAAAAA
TATGGGGATGTATATGAGATTTGTAGGAGACTTAAAACCTCACCCCAATC
AGGTTTAATTGATGACGAAGAATCAATTGGTAATCGTCGCCGTGAGTTCG
GTTCAAACATAATTCCTCCGAAACCTCCGAAAACGTTTTTCAGATTGATG
TGGGAGGCATTACAAGATTTGACATTAATAGTTCTAATGGGTGCTGCTGT
GATATCTCTAGCTCTTGCTCTCTACTCAAAATTTAGTGGTTCTAGTCATG
GAGATGAAACAGAAGGTGATGCTGGTTGGATAGAAGGCGTCGCGATTCTC
GGTGCTGTCATAGTTGTAGTTTTAGTCACTGCGTTCAATGATTGGCAAAA
AGAACGCCAATTTCGGGGCCTTCAAGATCAAATCGAAGGAAATCACAAAA
TTGCCGTTATCCGCGGTGGTGTGGCAAAAGAAATTATTGTTGGAGACATT
GTGGTCGGAGATATTTGTCAAGTGAAATACGGTGATTTGTTGCCAGCTGA
TGGGATTATTATTCAAAGCAATGACATCAAAGTAGATGAAAGTTCATTAA
CTGGTGAACCGGATCATGTTAAAAAAGGTGTTGATATTGATCCAATGATG
TTGTCAGGCACCCATGTAATGGAAGGATCAGCAAAAATGCTTGTCACTGC
AGTCGGATTGAATTCTCAGGCGGGAATTATATTTGCACTGCTTGGTGCGG
CAAATACCGAAGAAAAAGACAAAGCTGAAACTGAAAAACCCAATAATCAG
GTACATAAAACAAATTCCAACTCAAAAAACAAAGGATGTAAAAATGTTGA
TGAAGAAGTCGAATTGATGAAATTAACTGAAACTCATCCGGAAGATGCAG
ATAGATGCTCAAATCACAAACCGAACAACTATGCAAGTGGTGACGCCAAT
AAATCGGAAATTAAAAATGGAAAAGTTAAACAAGAAAAGAAAGTACGTGC
CCCGAAAAAGAAAGGATCTGTGTTGCAGTTAAAGTTAAATAAATTGGCCA
GTAGTATTGGACAAATAGGAACTATTGTCGCTTCTTTGACTGTGACAATT
TTAATCATTAAATTCTGTATCAATACTTATGTTTTTGAAAAGGAAGGGTG
GAGTATGGATCATTTAAAGAAGATGATTAATTTTCTGATCATTGGTGTAA
CGGTTCTCGTTGTAGCAGTGCCTGAAGGACTACCATTGGCTGTGACAATT
TCATTGGCATATTCTGTGAAAAAAATGATGAAAGATAATAATTTAGTTCG
ACATTTGGATGCCTGTGAGACAATGGGCAATGCAACCGCCATTTGTTCCG
ATAAAACTGGTACTTTAACAACCAACAGAATGACTGTTGTGCAGTCGTAT
ATAAACGGACAGCACAATCGTACTCATCTTCCTTCTTTTGAAGAATTGTC
TTTCAATGCAGCTGACATGCTACTTAAAAATATTTCAATTAACAGTAGTT
ATACGTCTCGATTAATGGCAACCCGTCATGTCAATGAATTACCTTCTCAA
ATTGGAAACAAAACTGAATGTGCATTATTGGGATTTGTCAATGGATCGCT
GAAGCGTGACTACGCGGATTTACGAACACAGTGGCCAGAAGAAAAATTAA
TTAAAGTTTATACATTCAATTCTGAACGTAAATCAATGAGCACAATCATT
GAAGATGAAGGAAAATTGCTTTTATTGACTAAAGGTGCTTCGGAAATGAT
ACTAAATAAATGCTCATTTATACTCGGGAAAAATGGGAAAATTCAACCAT
TCACAACTGAAGATGTTGAGGCTTTAGTGAAGAATGTCATCGAACCAATG
GCCAGTGATGGATTACGAACTATTGGATTGGCTTATAAAGAATTCGTTAA
AAAGCCAGATCATGATTATCAAGGTTTATACAATGAGAAACTCGACCTAG
AAAACGAGCACACATTAATTAAAGATTTAACATTGATTGGTATTGTTGGA
ATCGAAGATCCTGTTCGTCCAGAAGTCCCTCCAGCCATTAAGAAGTGTCA
AAAAGCAGGAATTACTGTACGAATGGTCACAGGGGATAATATCAATACTG
CTAGGTCGATTGCTATCAAATGTGGAATCCTTAAACCTGGAGAAGATTTC
CTGGTCATGGAAGGCAAGGAATTCAATAATAGAGTTCGAGATCCTATTTC
TGGTAAAATCAAACAAGAATTAATTGATCAGGTATGGCCTAAATTGAGAG
TTCTCGCACGGTCTTCTCCACAAGACAAATACACTCTTGTTACGGGAATA
ATTGACAGTCACTTAACTAGAAGCAGGGAAGTTGTCGCTGTCACTGGTGA
CGGTACAAATGATGGGCCGGCCTTGAAAAAGGCTGATGTTGGCTTTGCTA
TGGGAATTGCTGGTACGGATGTGGCAAAAGAAGCTTCGGATATTATTTTA
ACGGATGATAATTTCACGAGTATCGTTAAAGCAGTTATGTGGGGCAGAAA
TGTATATGATTCAATCGCAAAATTTTTACAATTTCAATTGACTGTCAATG
TAGTGGCTGTTATTGTTGCTTTCCTTGGTGCTTGTTTCATTACGGATAGT
CCATTGAAAGCAGTTCAAATGTTATGGGTTAATTTGATAATGGACACATT
GGCTTCTCTAGCTTTGGCTACTGAAATGCCGACTGAAGAATTGCTGGATC
GAGCACCATATGGACGAACGAAACCAATTATCAGCAGGAGAATGATTAAA
AATATAATGGGCCAATCTATTTACCAATTAGCAGTGACATTCTATTTGCT
TTTGCATGGAAATGTGCTTCTCGATGTTGAAAATGGTCGAGGTTTAACTG
AAAGAGGTATCAATAAGCCTACTCAACATTTTACGGCTATTTTTAATACC
TTTGTCATGATGACTTTATTCAATGAATTTAATTCGAGAAAAATACACGG
GCAAAAGAATGTTTTTGATGGATTACAACGAAATGTGCTTTTCATTATTA
TTTGGGTTACCACATTTGTTGGCCAGATTGTTATTGTGCAATATGGTGGT
TATGCTCTTCACACTGAAGCTTTGGAATTAGATCATTGGTTGTGGTGTAT
GCTATTCGGTATTGGAGTACTTTTATGGGCTCAACTTATCAATTGCATAC
CGACTACAGTTATTCCAAAACATATGCCTTGGTCTAAGAAAAAGCTTCCG
ACCGCAGAAAATCAAGCACTAAACCAATACAAGAGCGTCGATTCCGGCAA
TGAATCGGAAGATGAAGACTATGATGATATTGGAGATTTAGCTCGCCAGA
ACAACGACGAGGATGACGATGACATAAAAAACAGTGGCCAAATTCTATGG
ATACGCGGCTTGTCCAGATTACAAACTCAGCAGAACACCTGCAATCCTAA
TTTGGATAACAGAAACGATGTTGTCTACGGTGGAGTTCGCAGATTTACTT
TGAGTCAAGTCGGTGGGGTGCAACCGTTATTGGCAGCTCGGCGTCAATCT
TCTTACAGTAACAATGAGCAAAATATTAACCTCTCTACCAATCAAACGGA
ATCTATCATTATCCCTACAGCAACTAAATCAGGAAGTGTCGATTCCAACT
TGTCTACTCATCGTAATCGACGAAAAAAACTCAAAACTAGTTATTCTCTT
CCAAATAATCGACAGTCTAATCTTAATTCTCAATCGAACTTTGCCGGTAG
CGGTGGAGCAATATACAGCTCTCAAAATATTGACGAAGAATCTGATGAAC
AAGAAAATGACTTCCATCCTTAAATTTTTTTAAACAATGCCAATAATCAT
TCTGATTAACTATCTCTAATCTATCTCTATTTCTATCTACCCATTACCGA
TCTGTAGATTTTACATTCTTATTTCTATAAGCGAGCGAATTTTTTGAAAA
ATACTCACTAATCTCACAAATCTCTTAATCTCTTTTATTAATATGCTTAC
AATCGATTATTATTTCACACGGAACCTTTGTGACCTTGTAACAATGTCAT
TTCCTTTTACAGACAAATAGATGATTATAATTATTATGGTTAATATTAAT
ATTATTATTACTATTGTTTATGGAACAAGATTATTATTACGATGATCATG
ATCAGGATCATGATGACCTTCAGTCGTTTAGAGACAACATATTTTACAGA
CATTTCTAATTTAGATTCAGCTCAAGTAGATTTTATTCTCTTTTTTACTT
ATCTTCATTATATATTAGAGTAGAATATTTGAGTGTTTTTCCTGTAATTG
AAATTGAAGTTTCAATATTTACTGCGTGATTTTTTTGAAAAATTAATTAA
TTAAATTAATTAATTGAGTAATTATTTTCTTATAAGTATGTACGAGTGTG
ATGATATACTGTGTGAGGTGAACGGATATTCATGTTTAATAACTCAATGA
AATGCAACTGTACACTGTAATATCTTTATATCTTTTTAGTGATTATGAAA
GTATAGATTTATGTGTTTTATTGCTCTGGCAGATTGTAATTGAG
back to top

protein sequence of SMED30012043-orf-1

>SMED30012043-orf-1 ID=SMED30012043-orf-1|Name=SMED30012043-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1272bp
MTEETYEMNTKELTDLMMLRQQEAILEIKEKYGDVYEICRRLKTSPQSGL
IDDEESIGNRRREFGSNIIPPKPPKTFFRLMWEALQDLTLIVLMGAAVIS
LALALYSKFSGSSHGDETEGDAGWIEGVAILGAVIVVVLVTAFNDWQKER
QFRGLQDQIEGNHKIAVIRGGVAKEIIVGDIVVGDICQVKYGDLLPADGI
IIQSNDIKVDESSLTGEPDHVKKGVDIDPMMLSGTHVMEGSAKMLVTAVG
LNSQAGIIFALLGAANTEEKDKAETEKPNNQVHKTNSNSKNKGCKNVDEE
VELMKLTETHPEDADRCSNHKPNNYASGDANKSEIKNGKVKQEKKVRAPK
KKGSVLQLKLNKLASSIGQIGTIVASLTVTILIIKFCINTYVFEKEGWSM
DHLKKMINFLIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHL
DACETMGNATAICSDKTGTLTTNRMTVVQSYINGQHNRTHLPSFEELSFN
AADMLLKNISINSSYTSRLMATRHVNELPSQIGNKTECALLGFVNGSLKR
DYADLRTQWPEEKLIKVYTFNSERKSMSTIIEDEGKLLLLTKGASEMILN
KCSFILGKNGKIQPFTTEDVEALVKNVIEPMASDGLRTIGLAYKEFVKKP
DHDYQGLYNEKLDLENEHTLIKDLTLIGIVGIEDPVRPEVPPAIKKCQKA
GITVRMVTGDNINTARSIAIKCGILKPGEDFLVMEGKEFNNRVRDPISGK
IKQELIDQVWPKLRVLARSSPQDKYTLVTGIIDSHLTRSREVVAVTGDGT
NDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVY
DSIAKFLQFQLTVNVVAVIVAFLGACFITDSPLKAVQMLWVNLIMDTLAS
LALATEMPTEELLDRAPYGRTKPIISRRMIKNIMGQSIYQLAVTFYLLLH
GNVLLDVENGRGLTERGINKPTQHFTAIFNTFVMMTLFNEFNSRKIHGQK
NVFDGLQRNVLFIIIWVTTFVGQIVIVQYGGYALHTEALELDHWLWCMLF
GIGVLLWAQLINCIPTTVIPKHMPWSKKKLPTAENQALNQYKSVDSGNES
EDEDYDDIGDLARQNNDEDDDDIKNSGQILWIRGLSRLQTQQNTCNPNLD
NRNDVVYGGVRRFTLSQVGGVQPLLAARRQSSYSNNEQNINLSTNQTESI
IIPTATKSGSVDSNLSTHRNRRKKLKTSYSLPNNRQSNLNSQSNFAGSGG
AIYSSQNIDEESDEQENDFHP*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR001757P_typ_ATPase
IPR006408P-type_ATPase_IIB
IPR030320ATP2B1
IPR036412HAD-like_sf
IPR004014ATPase_P-typ_cation-transptr_N
IPR023298ATPase_P-typ_TM_dom_sf
IPR006068ATPase_P-typ_cation-transptr_C
IPR023214HAD_sf
IPR008250ATPase_P-typ_transduc_dom_A_sf
IPR018303ATPase_P-typ_P_site
IPR023299ATPase_P-typ_cyto_dom_N
Vocabulary: molecular function
TermDefinition
GO:0046872metal ion binding
GO:0000166nucleotide binding
GO:0005388calcium-transporting ATPase activity
GO:0005524ATP binding
GO:0016787hydrolase activity
Vocabulary: biological process
TermDefinition
GO:0006810transport
GO:0006811ion transport
GO:0006816calcium ion transport
GO:0070588calcium ion transmembrane transport
GO:0099132ATP hydrolysis coupled cation transmembrane transport
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR00119CATATPASEcoord: 678..689
score: 48.73
coord: 700..710
score: 69.84
coord: 820..832
score: 61.82
coord: 210..224
score: 53.67
coord: 463..477
score: 80.68
coord: 796..815
score: 75.78
NoneNo IPR availablePRINTSPR00121NAKATPASEcoord: 456..477
score: 72.62
coord: 589..607
score: 54.35
NoneNo IPR availablePFAMPF00122E1-E2_ATPasecoord: 345..442
e-value: 7.5E-9
score: 35.4
coord: 163..270
e-value: 2.5E-24
score: 85.8
NoneNo IPR availableGENE3DG3DSA:1.20.1110.10coord: 336..485
e-value: 4.2E-38
score: 133.2
NoneNo IPR availableGENE3DG3DSA:1.20.1110.10coord: 807..1068
e-value: 1.8E-75
score: 256.1
NoneNo IPR availablePFAMPF13246Cation_ATPasecoord: 530..605
e-value: 2.3E-16
score: 59.6
NoneNo IPR availableGENE3DG3DSA:2.70.150.10coord: 141..263
e-value: 1.1E-25
score: 92.4
NoneNo IPR availablePFAMPF08282Hydrolase_3coord: 774..842
e-value: 3.4E-5
score: 23.7
NoneNo IPR availableSFLDSFLDS00003Haloacid_Dehalogenasecoord: 445..848
e-value: 0.0
score: 278.8
NoneNo IPR availableSFLDSFLDF00027p-type_atpasecoord: 445..848
e-value: 0.0
score: 278.8
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 270..296
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1209..1271
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 309..346
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1229..1258
NoneNo IPR availablePANTHERPTHR24093CATION TRANSPORTING ATPASEcoord: 3..1073
NoneNo IPR availableCDDcd02081P-type_ATPase_Ca_PMCA-likecoord: 59..929
e-value: 0.0
score: 1222.06
NoneNo IPR availableTMHMMTMhelixcoord: 937..954
NoneNo IPR availableTMHMMTMhelixcoord: 122..144
NoneNo IPR availableTMHMMTMhelixcoord: 974..991
NoneNo IPR availableTMHMMTMhelixcoord: 245..267
NoneNo IPR availableTMHMMTMhelixcoord: 88..107
NoneNo IPR availableTMHMMTMhelixcoord: 1047..1069
NoneNo IPR availableTMHMMTMhelixcoord: 366..388
NoneNo IPR availableTMHMMTMhelixcoord: 1010..1032
NoneNo IPR availableTMHMMTMhelixcoord: 409..431
NoneNo IPR availableTMHMMTMhelixcoord: 856..878
IPR004014Cation-transporting P-type ATPase, N-terminalSMARTSM00831Cation_ATPase_N_a_2coord: 29..105
e-value: 2.6E-8
score: 43.6
IPR004014Cation-transporting P-type ATPase, N-terminalPFAMPF00690Cation_ATPase_Ncoord: 32..100
e-value: 2.4E-14
score: 52.8
IPR006068Cation-transporting P-type ATPase, C-terminalPFAMPF00689Cation_ATPase_Ccoord: 881..1062
e-value: 1.6E-41
score: 142.0
IPR023299P-type ATPase, cytoplasmic domain NGENE3DG3DSA:3.40.1110.10coord: 505..688
e-value: 2.1E-21
score: 77.8
IPR023299P-type ATPase, cytoplasmic domain NSUPERFAMILYSSF81660Metal cation-transporting ATPase, ATP-binding domain Ncoord: 469..690
IPR001757P-type ATPaseTIGRFAMTIGR01494TIGR01494coord: 381..491
e-value: 9.4E-24
score: 81.6
coord: 762..878
e-value: 6.6E-30
score: 101.9
coord: 130..248
e-value: 4.0E-18
score: 63.0
IPR006408P-type ATPase, subfamily IIBTIGRFAMTIGR01517TIGR01517coord: 351..1066
e-value: 1.6E-244
score: 812.0
IPR030320Plasma membrane calcium-transporting ATPase 1PANTHERPTHR24093:SF245PLASMA MEMBRANE CALCIUM-TRANSPORTING ATPASE 1coord: 3..1073
IPR018303P-type ATPase, phosphorylation sitePROSITEPS00154ATPASE_E1_E2coord: 465..471
IPR023298P-type ATPase, transmembrane domain superfamilySUPERFAMILYSSF81665Calcium ATPase, transmembrane domain Mcoord: 29..1069
IPR008250P-type ATPase, A domain superfamilySUPERFAMILYSSF81653Calcium ATPase, transduction domain Acoord: 163..261
IPR036412HAD-like superfamilySUPERFAMILYSSF56784HAD-likecoord: 462..900