Ig-like domain-containing protein

Overview
NameIg-like domain-containing protein
Smed IDSMED30012041
Length (bp)2197
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ig-like domain-containing protein (SMED30012041) t-SNE clustered cells

Violin plots show distribution of expression levels for Ig-like domain-containing protein (SMED30012041) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ig-like domain-containing protein (SMED30012041) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ig-like domain-containing protein (SMED30012041) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012041

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
central nervous systemSMED30012041SMESG000058478.1 dd_Smed_v4_16092_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
posterior region of the whole animalSMED30012041SMESG000058478.1 dd_Smed_v4_16092_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
tail regionSMED30012041SMESG000058478.1 dd_Smed_v4_16092_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30012041SMESG000058478.1 SmedASXL_015579SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30012041SMESG000058478.1 dd_Smed_v4_16092_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30012041SMESG000058478.1 dd_Smed_v6_16092_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Match: LINGO4 (leucine rich repeat and Ig domain containing 4 [Source:HGNC Symbol;Acc:HGNC:31814])

HSP 1 Score: 65.855 bits (159), Expect = 1.981e-10
Identity = 78/314 (24.84%), Postives = 118/314 (37.58%), Query Frame = 2
Query:  458 EVKNQNIHSLTADQLVKVGWLEDLNLDSNK-----LSSIEFDAFNNVPKLKTLSLKSNFLILGGNSFPSAAXXXXXXXXXXXXXNNPLGFVPDFFFQPLKFLTKLILSRATNGFYLEPNSLVGLTSLEYLDISASHLTALDRQIHSALNNMQLTDFYFFGNQWTCDCNXXXXXXXXXXXXDVRIFKKFSRSNGQSALLQPQCFSPHKFQGYNIFEFSTEYDTIKPEQLNCPPKIFTKN--QQIQIDQGKNLTLMCEFEADPGGTVEWSKNGMRVQRHWKKTKWGQTSGMRFT--AWLSITRTDLEDNGLWRCIL 1372
            ++K   IH   + + +  G L  LNL S       LSS+ F A  ++  L+ L L                              NP+  +P     PL  L +L LS A     +  ++  GLT+   LD++ + L  L+     + +  +L      GN  TCDC L WL +             F  S        P C  PH  QG ++ EFS   D + P    C P +  K+  + +  ++G +    C  + DP  TV W    MR    W     G+   +R      L I    L D G + C++
Sbjct:  229 QLKELEIHLWPSLEALDPGSLVGLNLSSLAITRCNLSSVPFQALYHLSFLRVLDLS----------------------------QNPISAIPARRLSPLVRLQELRLSGACL-TSIAAHAFHGLTAFHLLDVADNALQTLEETAFPSPD--KLVTLRLSGNPLTCDCRLLWLLRLRRH-------LDFGMS-------PPACAGPHHVQGKSLKEFS---DILPPGHFTCKPALIRKSGPRWVIAEEGGHAVFSCSGDGDPAPTVSW----MRPHGAW----LGRAGRVRVLEDGTLEIRSVQLRDRGAYVCVV 486          
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Match: LINGO1 (leucine rich repeat and Ig domain containing 1 [Source:HGNC Symbol;Acc:HGNC:21205])

HSP 1 Score: 62.3882 bits (150), Expect = 2.048e-9
Identity = 51/172 (29.65%), Postives = 84/172 (48.84%), Query Frame = 2
Query:  380 KQCICSRLETKFTRIPHDLPDFVETLEVKNQNIHSLTADQLVKVGWLEDLNLDSNKLSSIEFDAFNNVPKLKTLSLKSNFLILGGNSFPSAAXXXXXXXXXXXXXNNPLGFVPDFFFQPLKFLTKLILSRATNGFYLEPNSLVGLTSLEYLDISASHLTALDRQIHSALNNM 895
            +  +C R   +F  +P  +P     L++    I +L  D+      LE+L L+ N +S++E  AFNN+  L+TL L+SN L L     P      L +L  LD+  N +  + D+ FQ L  L  L +    +  Y+   +  GL SLE L +   +LT++  +  S L+ +
Sbjct:   53 RAVLCHR--KRFVAVPEGIPTETRLLDLGKNRIKTLNQDEFASFPHLEELELNENIVSAVEPGAFNNLFNLRTLGLRSNRLKL----IPLGVFTGLSNLTKLDISENKIVILLDYMFQDLYNLKSLEVG-DNDLVYISHRAFSGLNSLEQLTLEKCNLTSIPTEALSHLHGL 217          

HSP 2 Score: 61.2326 bits (147), Expect = 5.515e-9
Identity = 56/225 (24.89%), Postives = 90/225 (40.00%), Query Frame = 2
Query:  788 LEPNSLVGLTSLEYLDISASHLTALDRQIHSALNNMQLTDFYFFGNQWTCDCNXXXXXXXXXXXXDVRIFKKFSRSNGQSALLQPQCFSPHKFQGYNIFEFSTEYDTIKPEQLNCPPKIFT--KNQQIQIDQGKNLTLMCEFEADPGGTVEWSKNGMRVQRHWKKTKWGQTSGMRFTAW----LSITRTDLEDNGLWRCILITDTQSANATYSLRVRPSFP--PH 1438
            +EP +  GL  L  L++S + LT L+  +  ++ N++        N   CDC L            + +F++  R N      QP C +P   QG    EF    D + P    C        K QQ+ +D+G  +  +C  + DP   + W    +  ++H    K    S  R T +    L +    ++DNG + CI      + +    L VR   P  PH
Sbjct:  326 VEPYAFRGLNYLRVLNVSGNQLTTLEESVFHSVGNLE--TLILDSNPLACDCRL------------LWVFRRRWRLNFNRQ--QPTCATPEFVQGK---EFKDFPDVLLPNYFTCRRARIRDRKAQQVFVDEGHTVQFVCRADGDPPPAILW----LSPRKHLVSAK----SNGRLTVFPDGTLEVRYAQVQDNGTYLCIAANAGGNDSMPAHLHVRSYSPDWPH 523          
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Match: LINGO1 (leucine rich repeat and Ig domain containing 1 [Source:HGNC Symbol;Acc:HGNC:21205])

HSP 1 Score: 62.3882 bits (150), Expect = 2.070e-9
Identity = 51/172 (29.65%), Postives = 84/172 (48.84%), Query Frame = 2
Query:  380 KQCICSRLETKFTRIPHDLPDFVETLEVKNQNIHSLTADQLVKVGWLEDLNLDSNKLSSIEFDAFNNVPKLKTLSLKSNFLILGGNSFPSAAXXXXXXXXXXXXXNNPLGFVPDFFFQPLKFLTKLILSRATNGFYLEPNSLVGLTSLEYLDISASHLTALDRQIHSALNNM 895
            +  +C R   +F  +P  +P     L++    I +L  D+      LE+L L+ N +S++E  AFNN+  L+TL L+SN L L     P      L +L  LD+  N +  + D+ FQ L  L  L +    +  Y+   +  GL SLE L +   +LT++  +  S L+ +
Sbjct:   47 RAVLCHR--KRFVAVPEGIPTETRLLDLGKNRIKTLNQDEFASFPHLEELELNENIVSAVEPGAFNNLFNLRTLGLRSNRLKL----IPLGVFTGLSNLTKLDISENKIVILLDYMFQDLYNLKSLEVG-DNDLVYISHRAFSGLNSLEQLTLEKCNLTSIPTEALSHLHGL 211          

HSP 2 Score: 61.2326 bits (147), Expect = 5.341e-9
Identity = 56/225 (24.89%), Postives = 90/225 (40.00%), Query Frame = 2
Query:  788 LEPNSLVGLTSLEYLDISASHLTALDRQIHSALNNMQLTDFYFFGNQWTCDCNXXXXXXXXXXXXDVRIFKKFSRSNGQSALLQPQCFSPHKFQGYNIFEFSTEYDTIKPEQLNCPPKIFT--KNQQIQIDQGKNLTLMCEFEADPGGTVEWSKNGMRVQRHWKKTKWGQTSGMRFTAW----LSITRTDLEDNGLWRCILITDTQSANATYSLRVRPSFP--PH 1438
            +EP +  GL  L  L++S + LT L+  +  ++ N++        N   CDC L            + +F++  R N      QP C +P   QG    EF    D + P    C        K QQ+ +D+G  +  +C  + DP   + W    +  ++H    K    S  R T +    L +    ++DNG + CI      + +    L VR   P  PH
Sbjct:  320 VEPYAFRGLNYLRVLNVSGNQLTTLEESVFHSVGNLE--TLILDSNPLACDCRL------------LWVFRRRWRLNFNRQ--QPTCATPEFVQGK---EFKDFPDVLLPNYFTCRRARIRDRKAQQVFVDEGHTVQFVCRADGDPPPAILW----LSPRKHLVSAK----SNGRLTVFPDGTLEVRYAQVQDNGTYLCIAANAGGNDSMPAHLHVRSYSPDWPH 517          
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Match: LINGO1 (leucine rich repeat and Ig domain containing 1 [Source:HGNC Symbol;Acc:HGNC:21205])

HSP 1 Score: 61.2326 bits (147), Expect = 2.387e-9
Identity = 51/172 (29.65%), Postives = 84/172 (48.84%), Query Frame = 2
Query:  380 KQCICSRLETKFTRIPHDLPDFVETLEVKNQNIHSLTADQLVKVGWLEDLNLDSNKLSSIEFDAFNNVPKLKTLSLKSNFLILGGNSFPSAAXXXXXXXXXXXXXNNPLGFVPDFFFQPLKFLTKLILSRATNGFYLEPNSLVGLTSLEYLDISASHLTALDRQIHSALNNM 895
            +  +C R   +F  +P  +P     L++    I +L  D+      LE+L L+ N +S++E  AFNN+  L+TL L+SN L L     P      L +L  LD+  N +  + D+ FQ L  L  L +    +  Y+   +  GL SLE L +   +LT++  +  S L+ +
Sbjct:   58 RAVLCHR--KRFVAVPEGIPTETRLLDLGKNRIKTLNQDEFASFPHLEELELNENIVSAVEPGAFNNLFNLRTLGLRSNRLKL----IPLGVFTGLSNLTKLDISENKIVILLDYMFQDLYNLKSLEVG-DNDLVYISHRAFSGLNSLEQLTLEKCNLTSIPTEALSHLHGL 222          
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Match: AP006333.1 (fibronectin leucine rich transmembrane protein 1 [Source:NCBI gene;Acc:23769])

HSP 1 Score: 58.151 bits (139), Expect = 5.272e-8
Identity = 77/283 (27.21%), Postives = 112/283 (39.58%), Query Frame = 2
Query:  404 ETKFTRIPHDLPDFVETLEVKNQNIHSLTADQLVKVGWLEDLNLDSNKLS--SIEFDAFNNVPKLKTLSLKSNFLILGGNSFPSAAXXXXXXXXXXXXXNNPLGFVPDFFFQPLKFLTKLIL---------------SRATN------------------------GFYLEPNS--------LVGLTSLEYLDISASHLTALDRQIHSALNNMQLTDFYFFGNQWTCDCNXXXXXXXXXXXXDVRIFKKFSRSNGQSALLQPQCFSPHKFQGYNIFEFSTEYD 1105
            E      P +LP  +  L +++ N+ ++  D L ++  LE L+LD N +S  SIE DAF +  +LK L L  N L    +S PS        L+ L LD+N +  +P   F+ L  L +L+L               SR  N                          YL+ N+        L  +  LE LD+S ++LT L R +   L N  L       N W C CNL WL+ W      V   +               C  P K +G  I + ++E D
Sbjct:  115 ENDLDEFPINLPRSLRELHLQDNNVRTIARDSLARIPLLEKLHLDDNSVSTVSIEEDAFADSKQLKLLFLSRNHL----SSIPSG---LPHTLEELRLDDNRISTIPLHAFKGLNSLRRLVLDGNLLANQRIADDTFSRLQNLTELSLVRNSLAAPPLNLPSAHLQKLYLQDNAISHIPYNTLAKMRELERLDLSNNNLTTLPRGLFDDLGN--LAQLLLRNNPWFCGCNLMWLRDWVKARAAVVNVRGL------------MCQGPEKVRGMAIKDITSEMD 376          
BLAST of Ig-like domain-containing protein vs. Ensembl Celegans
Match: slt-1 (Slit homolog 1 protein [Source:UniProtKB/Swiss-Prot;Acc:G5EFX6])

HSP 1 Score: 50.0618 bits (118), Expect = 7.638e-6
Identity = 57/239 (23.85%), Postives = 101/239 (42.26%), Query Frame = 2
Query:  383 QCIC-----SRLETKFTRIPHDLPDFVETLEVKNQNIHSLTADQLVKVGWLEDLNLDSNKLSSIEFDAFNNVPKLKTLSLKSNFLILGGNSFPSAAXXXXXXXXXXXXXNNPLGFVPDFFFQPLKFLTKLILSRATNGFYLEPNSLVGLTSLEYLDISASHLTALDRQIHSALNNMQLTDFYFFGNQWTCDCNXXXXXXXXXXXXDVRIFKK-FSRSNGQSALLQPQCFSPHKFQGYNI 1081
            +C+C     S +  + T +P ++P+    L++++  I  +  +    +  L+ L L  N++ +I   +F+++  L+ L L  N +       P         L  LDL  N +  V D   Q  +FL  L L +  + F LE N +    SLE L ++ + LT  +       +N +      F N W CDC              +R  +K   ++ GQ+  +   C +P   QG +I
Sbjct:   20 ECVCVDRTVSCVGQQLTEVPQNIPNDTIRLDLQDNEITKIGPNDFSSLMNLKALQLMDNQIVTIHNQSFSSLVFLQKLRLSRNRI----RHLPDNVFQNNLKLTHLDLSENDITVVSDAQLQGPEFLEVLNLDK-NHIFCLENNVISSWVSLEVLTLNGNRLTTFEEP-----SNARFRQLDLFNNPWNCDCR-------------LRWMRKWLEKAEGQNKTV---CATPLNLQGSSI 232          
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Match: kek2 (gene:FBgn0015400 transcript:FBtr0080252)

HSP 1 Score: 70.8626 bits (172), Expect = 3.154e-12
Identity = 79/358 (22.07%), Postives = 144/358 (40.22%), Query Frame = 2
Query:  410 KFTRIPHDLPDFVETLEVKNQNIHSLTADQLVKVGWL--EDLNLDSNKLSSIEFDAFNNVPKLKTLSLKSNFLILGGNSFPSAAXXXXXXXXXXXXXNNPLGFVPDFFFQPLKFLTKLILSRATNGFYLEPNSLVGLTSLEYLDISASHLTALDRQIHSALNNMQLTDFYFFGNQWTCDCNXXXXXXXXXXXXDVRIFKKFSRSNGQSALLQ-PQCFSPHKFQGYNIFEFSTEYDTIKPEQLNCPPKIFTKNQQIQIDQGKNLTLMCEFEADPGGTVEWSKNGMRVQR----------HWKKTKWGQTSGMRFTAWLSITRTDLEDNGLWRCILITDTQSANATYSLRVRPSFPPHID 1444
            + + +P  +    + L      +  L +++ +++  L  + + L  N+L  I   AF  +  L  L L  N L     + PS        L  L L  NP+  +    F+ L FLT L LS       +E  + VG+ +LE+L +  + +  +     + +    L       N+W CDC L           D+     F   N  + L + P+C  P + +G  I        +++ EQL C P++  ++   ++ +G+N+++ C   A P   V W  NG  +            ++     G +      + + I     EDNG + C+      +  + Y+LRV    PP ++
Sbjct:   42 QLSNLPEGMDPGTQVLNFSGNALQVLQSERFLRMDLLNLQKIYLSRNQLIRIHEKAFRGLTNLVELDLSENAL----QNVPSETFQDYSSLMRLSLSGNPIRELKTSAFRHLSFLTTLELSNCQVE-RIENEAFVGMDNLEWLRLDGNRIGFIQ---GTHILPKSLHGISLHSNRWNCDCRLL----------DIH----FWLVNYNTPLAEEPKCMEPARLKGQVI-------KSLQREQLACLPEVSPQSSYTEVSEGRNMSITCLVRAIPEPKVLWLFNGQVMSNDSLMDNLHMYYYIDETIGVSGAEEKRSEIFIYNVGAEDNGTFSCVGQNIAGTTFSNYTLRVIIKEPPVVN 370          
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Match: kek3 (gene:FBgn0028370 transcript:FBtr0300848)

HSP 1 Score: 67.0106 bits (162), Expect = 4.453e-11
Identity = 85/375 (22.67%), Postives = 143/375 (38.13%), Query Frame = 2
Query:  377 RKQCICSRLETKFTRIPHDLPDFVETLEVKNQNIHSLTADQLVKVGWL--EDLNLDSNKLSSIEFDAFNNVPKLKTLSLKSNFLILGGNSFPSAAXXXXXXXXXXXXXNNPLGFVPDFFFQPLKFLTKLILSRATNGFYLEPNSLVGL-TSLEYLDISASHLTALDRQIHSALNNMQLTDFYFFGNQWTCDCNXXXXXXXXXXXXDVRIFKKFSRSNGQSALLQPQCFSPHKFQGYNIFEFSTEYDTIKPEQLNCPPKIFTKNQQIQIDQGKNLTLMCEFEADPGGTVEW-----------------SKNGMRVQRHWKKTKWGQTSGMRFTAWLSITRTDLEDNGLWRCILITDTQSANATYSLRV--RPSFPP 1435
            ++  +C  L    T IP  L    + L++    I  +  D       L  + + L    L  IE  AF  +  L  L L  N L    ++ PS AL  +  L+ L L  NP+  VPD  F  +  L KL LS      ++   +  GL +SLE+L +  + L+ +     ++L ++         N W C C+             +R  + +       + + P C SP +  G         +D +  +   C P+I   +      +G+N+T+ C  E  P   V+W                 S +  R     +  K    + +R  + L+I   D++D G++ C          A+ +L V  RP   P
Sbjct:   91 KESVLC--LNANLTHIPQPLDAGTQLLDLSGNEIQLIPDDSFATAQLLNLQKVYLARCHLRLIERHAFRKLINLVELDLSQNLL----SAIPSLALYHVSELRELRLSGNPILRVPDDAFGHVPQLVKLELSDCRLS-HIAVRAFAGLESSLEWLKLDGNRLSEVRSGTITSLASLH--GLELARNTWNCSCS-------------LRPLRAWMLQQNIPSGIPPTCESPPRLSGR-------AWDKLDVDDFACVPQIVATDTTAHGVEGRNITMSCYVEGVPQPAVKWLLKNRLIANLSAGGDGDSDSEPRTAAATQGRKTYVVNMLRNASNLTILTADMQDAGIYTCAAENKAGKVEASVTLAVSRRPPEAP 436          
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Match: kek3 (gene:FBgn0028370 transcript:FBtr0080752)

HSP 1 Score: 67.0106 bits (162), Expect = 4.453e-11
Identity = 85/375 (22.67%), Postives = 143/375 (38.13%), Query Frame = 2
Query:  377 RKQCICSRLETKFTRIPHDLPDFVETLEVKNQNIHSLTADQLVKVGWL--EDLNLDSNKLSSIEFDAFNNVPKLKTLSLKSNFLILGGNSFPSAAXXXXXXXXXXXXXNNPLGFVPDFFFQPLKFLTKLILSRATNGFYLEPNSLVGL-TSLEYLDISASHLTALDRQIHSALNNMQLTDFYFFGNQWTCDCNXXXXXXXXXXXXDVRIFKKFSRSNGQSALLQPQCFSPHKFQGYNIFEFSTEYDTIKPEQLNCPPKIFTKNQQIQIDQGKNLTLMCEFEADPGGTVEW-----------------SKNGMRVQRHWKKTKWGQTSGMRFTAWLSITRTDLEDNGLWRCILITDTQSANATYSLRV--RPSFPP 1435
            ++  +C  L    T IP  L    + L++    I  +  D       L  + + L    L  IE  AF  +  L  L L  N L    ++ PS AL  +  L+ L L  NP+  VPD  F  +  L KL LS      ++   +  GL +SLE+L +  + L+ +     ++L ++         N W C C+             +R  + +       + + P C SP +  G         +D +  +   C P+I   +      +G+N+T+ C  E  P   V+W                 S +  R     +  K    + +R  + L+I   D++D G++ C          A+ +L V  RP   P
Sbjct:   91 KESVLC--LNANLTHIPQPLDAGTQLLDLSGNEIQLIPDDSFATAQLLNLQKVYLARCHLRLIERHAFRKLINLVELDLSQNLL----SAIPSLALYHVSELRELRLSGNPILRVPDDAFGHVPQLVKLELSDCRLS-HIAVRAFAGLESSLEWLKLDGNRLSEVRSGTITSLASLH--GLELARNTWNCSCS-------------LRPLRAWMLQQNIPSGIPPTCESPPRLSGR-------AWDKLDVDDFACVPQIVATDTTAHGVEGRNITMSCYVEGVPQPAVKWLLKNRLIANLSAGGDGDSDSEPRTAAATQGRKTYVVNMLRNASNLTILTADMQDAGIYTCAAENKAGKVEASVTLAVSRRPPEAP 436          
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Match: flrt1b (fibronectin leucine rich transmembrane protein 1b [Source:ZFIN;Acc:ZDB-GENE-080327-6])

HSP 1 Score: 63.1586 bits (152), Expect = 9.226e-10
Identity = 73/284 (25.70%), Postives = 116/284 (40.85%), Query Frame = 2
Query:  404 ETKFTRIPHDLPDFVETLEVKNQNIHSLTADQLVKVGWLEDLNLDSNKLS--SIEFDAFNNVPKLKTLSLKSNFLILGGNSFPSAAXXXXXXXXXXXXXNNPLGFVPDFFFQPLKFLTKLIL---------------SRATN------------------------GFYLEPN--------SLVGLTSLEYLDISASHLTALDRQIHSALNNMQLTDFYFFGNQWTCDCNXXXXXXXXXXXXDVRIFKKFSRSNGQSALLQP-QCFSPHKFQGYNIFEFSTEYD 1105
            + +    P  LP  +  L +++ NI +L    L ++  LE L++D N +S  SIE  AF N P+L+ L L  N L    +S PS        L+ L LD+N +  +P   F+ L  L +L L               SR +N                          YL+ N        SL G+  L+ LDIS ++LT L R +   L++  L+     GN W C CN             +R    +    G S  ++   C +P + +G  + + S++ +
Sbjct:  112 DNELDDFPTHLPPSLRELHLQDNNIRTLPRSALARLPLLEKLHMDDNSISTVSIEDKAFTNNPRLRLLFLSRNHL----SSIPSG---LPASLEELRLDDNRISTIPTHAFRGLSSLRRLFLDGNLLANQRIADDTFSRLSNLTELSLVRNSLQAPPLNLPSLHLLRLYLQDNAIAHMPRGSLDGMRRLQKLDISGNNLTTLPRGLFKDLDS--LSQLLVRGNPWYCGCN-------------LRWLHDWLHERGSSVTVRGLTCHAPERLRGMALRDLSSQLE 373          
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Match: flrt1b (fibronectin leucine rich transmembrane protein 1b [Source:ZFIN;Acc:ZDB-GENE-080327-6])

HSP 1 Score: 63.1586 bits (152), Expect = 9.226e-10
Identity = 73/284 (25.70%), Postives = 116/284 (40.85%), Query Frame = 2
Query:  404 ETKFTRIPHDLPDFVETLEVKNQNIHSLTADQLVKVGWLEDLNLDSNKLS--SIEFDAFNNVPKLKTLSLKSNFLILGGNSFPSAAXXXXXXXXXXXXXNNPLGFVPDFFFQPLKFLTKLIL---------------SRATN------------------------GFYLEPN--------SLVGLTSLEYLDISASHLTALDRQIHSALNNMQLTDFYFFGNQWTCDCNXXXXXXXXXXXXDVRIFKKFSRSNGQSALLQP-QCFSPHKFQGYNIFEFSTEYD 1105
            + +    P  LP  +  L +++ NI +L    L ++  LE L++D N +S  SIE  AF N P+L+ L L  N L    +S PS        L+ L LD+N +  +P   F+ L  L +L L               SR +N                          YL+ N        SL G+  L+ LDIS ++LT L R +   L++  L+     GN W C CN             +R    +    G S  ++   C +P + +G  + + S++ +
Sbjct:  112 DNELDDFPTHLPPSLRELHLQDNNIRTLPRSALARLPLLEKLHMDDNSISTVSIEDKAFTNNPRLRLLFLSRNHL----SSIPSG---LPASLEELRLDDNRISTIPTHAFRGLSSLRRLFLDGNLLANQRIADDTFSRLSNLTELSLVRNSLQAPPLNLPSLHLLRLYLQDNAIAHMPRGSLDGMRRLQKLDISGNNLTTLPRGLFKDLDS--LSQLLVRGNPWYCGCN-------------LRWLHDWLHERGSSVTVRGLTCHAPERLRGMALRDLSSQLE 373          
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Match: lrrc4ba (leucine rich repeat containing 4Ba [Source:ZFIN;Acc:ZDB-GENE-080327-25])

HSP 1 Score: 62.003 bits (149), Expect = 2.022e-9
Identity = 48/162 (29.63%), Postives = 75/162 (46.30%), Query Frame = 2
Query:  368 AEKRKQCICSRLETKFTRIPHDLPDFVETLEVKNQNIHSLTADQLVKVGWLEDLNLDSNKLSSIEFDAFNNVPKLKTLSLKSNFLILGGNSFPSAAXXXXXXXXXXXXXNNPLGFVPDFFFQPLKFLTKLILSRATNGFYLEPNSLVGLTSLEYLDISASHL 853
            + +  + IC+R       +P ++ +    L ++   I  + +D    +  LE L L  N++  IE  AFN +P L TL L  N L L     PS A   L  L+ L L NNP+  +P + F  +  L +L L       Y+   + VGL +L YL++    L
Sbjct:   47 SNQASRVICAR--QHLEEVPDNISNNTRYLNLQENTIQVIKSDTFKHLRHLEILQLSKNQIRQIEVGAFNGLPNLNTLELFDNRLTL----VPSQAFEYLSKLRELWLRNNPIETLPGYAFHRVPSLRRLDLGELKKLDYISDAAFVGLINLRYLNLGMCGL 202          
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Match: lrrc4ba (leucine rich repeat containing 4Ba [Source:ZFIN;Acc:ZDB-GENE-080327-25])

HSP 1 Score: 62.003 bits (149), Expect = 2.022e-9
Identity = 48/162 (29.63%), Postives = 75/162 (46.30%), Query Frame = 2
Query:  368 AEKRKQCICSRLETKFTRIPHDLPDFVETLEVKNQNIHSLTADQLVKVGWLEDLNLDSNKLSSIEFDAFNNVPKLKTLSLKSNFLILGGNSFPSAAXXXXXXXXXXXXXNNPLGFVPDFFFQPLKFLTKLILSRATNGFYLEPNSLVGLTSLEYLDISASHL 853
            + +  + IC+R       +P ++ +    L ++   I  + +D    +  LE L L  N++  IE  AFN +P L TL L  N L L     PS A   L  L+ L L NNP+  +P + F  +  L +L L       Y+   + VGL +L YL++    L
Sbjct:   47 SNQASRVICAR--QHLEEVPDNISNNTRYLNLQENTIQVIKSDTFKHLRHLEILQLSKNQIRQIEVGAFNGLPNLNTLELFDNRLTL----VPSQAFEYLSKLRELWLRNNPIETLPGYAFHRVPSLRRLDLGELKKLDYISDAAFVGLINLRYLNLGMCGL 202          
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Match: lrrc4ba (leucine rich repeat containing 4Ba [Source:ZFIN;Acc:ZDB-GENE-080327-25])

HSP 1 Score: 61.6178 bits (148), Expect = 2.671e-9
Identity = 47/157 (29.94%), Postives = 74/157 (47.13%), Query Frame = 2
Query:  368 AEKRKQCICSRLETKFTRIPHDLPDFVETLEVKNQNIHSLTADQLVKVGWLEDLNLDSNKLSSIEFDAFNNVPKLKTLSLKSNFLILGGNSFPSAAXXXXXXXXXXXXXNNPLGFVPDFFFQPLKFLTKLILSRATNGFYLEPNSLVGLTSLEYLDI 838
            + +  + IC+R       +P ++ +    L ++   I  + +D    +  LE L L  N++  IE  AFN +P L TL L  N L L     PS A   L  L+ L L NNP+  +P + F  +  L +L L       Y+   + VGL +L YL++
Sbjct:   47 SNQASRVICAR--QHLEEVPDNISNNTRYLNLQENTIQVIKSDTFKHLRHLEILQLSKNQIRQIEVGAFNGLPNLNTLELFDNRLTL----VPSQAFEYLSKLRELWLRNNPIETLPGYAFHRVPSLRRLDLGELKKLDYISDAAFVGLINLRYLNL 197          
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Match: lingo1 (leucine rich repeat and Ig domain containing 1 [Source:NCBI gene;Acc:100101739])

HSP 1 Score: 60.077 bits (144), Expect = 9.320e-9
Identity = 56/225 (24.89%), Postives = 90/225 (40.00%), Query Frame = 2
Query:  788 LEPNSLVGLTSLEYLDISASHLTALDRQIHSALNNMQLTDFYFFGNQWTCDCNXXXXXXXXXXXXDVRIFKKFSRSNGQSALLQPQCFSPHKFQGYNIFEFSTEYDTIKPEQLNCPPKIFTKN--QQIQIDQGKNLTLMCEFEADPGGTVEWSKNGMRVQRHWKKTKWGQTSGMRFTAW----LSITRTDLEDNGLWRCILITDTQSANATYSLRVRPSFP--PH 1438
            +EP +  GL  L+ L++S+++L+ L+     ++ N++        N   CDC L            + IF++  R N      QP C SP   QG    EF    D ++P    C       +  Q + +D+G  +   C  + DP  T+ W           +KT     S  R T +    L +    ++DNG + CI      +  +   L VR   P  PH
Sbjct:  312 VEPYAFRGLNHLKVLNVSSNYLSTLEESSFHSVGNLE--TLILDKNPLACDCRL------------LWIFRRRWRLNFSRQ--QPSCSSPEYVQGK---EFKDFPDVLQPNYFTCRRARIQDHSAQVVYVDEGHTVHFFCRADGDPPPTILWQSP--------RKTFITSKSNGRLTVFPDGTLEVRYAQVQDNGTYHCIASNAGGNDTSLAHLHVRSYSPNWPH 509          

HSP 2 Score: 54.299 bits (129), Expect = 6.895e-7
Identity = 49/172 (28.49%), Postives = 82/172 (47.67%), Query Frame = 2
Query:  380 KQCICSRLETKFTRIPHDLPDFVETLEVKNQNIHSLTADQLVKVGWLEDLNLDSNKLSSIEFDAFNNVPKLKTLSLKSNFLILGGNSFPSAAXXXXXXXXXXXXXNNPLGFVPDFFFQPLKFLTKLILSRATNGFYLEPNSLVGLTSLEYLDISASHLTALDRQIHSALNNM 895
            +  +C R   ++  +P  +P     L++    I +L  D+     +LE+L L+ N +S IE  AFN +  L++L L+SN L L     P      L +L  LD+  N +  + D  FQ L  L  L +    +  Y+   +  GL SLE L +   +LT++  +  S L+ +
Sbjct:   39 RSVLCHR--KRYLDVPEGIPTDTRLLDLSKNRIKALNQDEFSAFPYLEELELNENIVSIIEPGAFNGLFNLRSLGLRSNRLKL----IPLGVFTGLSNLTQLDISENKIVILLDDMFQDLYNLKSLEVG-DNDLVYISHRAFRGLNSLEELTLEKCNLTSVPTEALSHLHGL 203          
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Match: atf3 (activating transcription factor 3 [Source:Xenbase;Acc:XB-GENE-6085251])

HSP 1 Score: 59.6918 bits (143), Expect = 1.289e-8
Identity = 69/223 (30.94%), Postives = 97/223 (43.50%), Query Frame = 2
Query:  404 ETKFTRIPHDLPDFVETLEVKNQNIHSLTADQLVKVGWLEDLNLDSNKLS--SIEFDAFNNVPKLKTLSLKSNFLILGGNSFPSA-----------------AXXXXXXXXXXXXXNNPLG--FVPDFFFQPLKFLTKLILSRAT-------------NGFYLEPN--------SLVGLTSLEYLDISASHLTALDRQIHSALNNMQLTDFYFFGNQWTCDCN 946
            E      P +LP  +  L +++ NI S+T D L ++  +E L+LD N +S  SIE DAF +  +L+ L L  N L    N  P                   A   L +L+ L LD N L    + D  F  L+ LT+L L R T                YL+ N        SL  +  L+ LD+S+++LTAL R +   L N  L+      N W C CN
Sbjct:  122 ENDLDEFPVNLPHSLRELHLQDNNIRSVTRDSLSRIPLIEKLHLDDNSVSTVSIEDDAFLDSHQLRLLFLSRNHLSSIPNGLPHTLEELRLDDNRISTIPLHAFKGLNNLRRLVLDGNLLANQRIADDTFSRLQNLTELSLVRNTLAAPPVNLPSTHLQKLYLQDNAITHIPYSSLSKMRQLQRLDLSSNNLTALPRGLFDDLEN--LSQLLLRNNPWFCGCN 342          
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Match: LINGO2 (leucine rich repeat and Ig domain containing 2 [Source:NCBI gene;Acc:100490134])

HSP 1 Score: 56.9954 bits (136), Expect = 1.027e-7
Identity = 52/176 (29.55%), Postives = 83/176 (47.16%), Query Frame = 2
Query:  368 AEKRKQCICSRLETKFTRIPHDLPDFVETLEVKNQNIHSLTADQLVKVGWLEDLNLDSNKLSSIEFDAFNNVPKLKTLSLKSNFLILGGNSFPSAAXXXXXXXXXXXXXNNPLGFVPDFFFQPLKFLTKLILSRATNGFYLEPNSLVGLTSLEYLDISASHLTALDRQIHSALNNM 895
            + + K   C R   +   IP  +P   + L++    + S+     V    LED++L  N +S++E  AFN++  L++LSLK N L L     P      L +L  LD+  N +  + D+ FQ L  L  L +       Y+   +  GL SLE L +   +LTA+     S L+N+
Sbjct:   39 SAQNKSVSCHR--RRLVTIPEGIPIETKILDLSKNKLKSVNPVDFVSYPLLEDIDLSDNIISNVEPGAFNSLFNLRSLSLKGNRLKL----VPLGVFTGLSNLTKLDISENKIVILLDYMFQDLHSLKSLEVGD-NELVYISHRAFSGLVSLEQLTLEKCNLTAVPTDALSHLHNL 207          
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Match: LRIG3 (leucine-rich repeats and immunoglobulin like domains 3 [Source:NCBI gene;Acc:100151727])

HSP 1 Score: 55.0694 bits (131), Expect = 5.166e-7
Identity = 80/376 (21.28%), Postives = 143/376 (38.03%), Query Frame = 2
Query:  446 VETLEVKNQNIHSLTADQLVKVGWLEDLNLDSNKLSSIEFDAFNNVPKLKTLSLKSNFLILGGNSFPSAAXXXXXXXXXXXXXNNPLGFVPDFFFQPLKFLTKLILS--------RATNGFY----------LEPNSLVGLT--------SLEYLDISASHLTALDRQIHSALNNMQLTDFYFFGNQWTCDCNXXXXXXXXXXXXDVRIFKKFSRSNGQSALLQPQCFSPHKFQGYNIFEFSTEYDTIKPEQLNC----PPKIFTKNQQIQIDQGKNLTLMCEFEADPGG--TVEWSKNGMRVQ----RHWKKTKWGQTSGMRFTAWLSITRTDLEDNGLWRCIL---ITDTQSANATYSLRVRPSFPPH-IDLTI 1453
            +E L++ +  +  +T   L  +  L+ L+L  N +SSI  DA+    KL  L L  N L         ++   L  L  L + NN + F+ D  F+ L  L  L L            NG +          L+ N +  +T        +LEYLD+S + +T++     S + ++Q    Y       CDC              ++   K+   +     +   C  P   +G +IF        + P+   C     P+I  + +     +G N+T +C   +      T  W K+   +      ++   +      M +T  L +   +  + G ++C++      T S  A  ++ + P F    +DLTI
Sbjct:  261 MEILQLDHNRLTEITKGWLYGLLMLQKLHLSQNAISSITPDAWEFCQKLSELDLAFNQL----TRLEESSFAGLGLLGGLYIGNNKINFIADGAFRGLSSLNSLDLKSNEISWTIEDMNGTFSGLERLKRLILQDNRITSITKKAFSWLDALEYLDLSDNAITSMQTNAFSQMKSLQ--QLYLNTTSLLCDCQ-------------LKWLPKWLAESKFQTFVNASCGHPQILKGKSIF-------AVSPDDFVCDDFPKPQITVQPETQSAIKGSNVTFICSAASSSESPMTFAWKKDNELLHDSEIENYAHLRAQGGEVMEYTTILRLRNVEFINEGKYQCVISNHFGPTYSVKAKLTVNMLPLFTKMPMDLTI 610          
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Match: Lrit2 (leucine-rich repeat, immunoglobulin-like and transmembrane domains 2 [Source:MGI Symbol;Acc:MGI:2444885])

HSP 1 Score: 66.6254 bits (161), Expect = 7.575e-11
Identity = 91/376 (24.20%), Postives = 144/376 (38.30%), Query Frame = 2
Query:  383 QCICSR---------LETKFTRIPHDLPDFVETLEVKNQNIHSLTADQLVKVGWLEDLNLDSNKLSSIEFDAFNNVPKLKTLSLKSNFLILGGNSFPSAAXXXXXXXXXXXXXNNPLGFVPDFFFQPLKFLTKLILSRATNGFYLEPNSLVGLTSLEYLDISASHLTALDRQIH----------------SALNNMQLTDFYFFGNQWTCDCNXXXXXXXXXXXXDVRIFKKFSRSNGQSALLQPQ---CFSPHKFQGYNIFEFSTEYDTIKPEQLNCPPKIFTKNQQIQIDQGKNLTLMCEFEADPGGTVEWSKNGMRVQRHWKKTKWGQTSGMRFTAWLSITRTDLEDNGLWRCILITDTQSANATYSLRVRPS 1426
            +C CS          +     +IP + P+ ++ + ++N  +  L+      +  LE L L+ N ++ I   A  ++P+L+ L L+ N L     S P  A      L+VLDL +N +  VP+     L+FLT LI                      YLDIS++ LT + + +                   L+NM L+      N W CDC              +R   +F +S G   +L      C  P    G  + E  TE            P I T +  + I  GKN+TL C  +A P  T+ W K  +   R +         G+  +  L I    L D G + C+       ++    L V+P+
Sbjct:   27 ECTCSEESFGRSLQCMSMSLGKIPDNFPEELKQVRIENSPLFELSQGFFTNMSSLEYLWLNFNNVTVIHLGALEDLPELRELRLEGNKL----RSVPWTAFRATPLLRVLDLKHNRIDSVPEL---ALQFLTNLI----------------------YLDISSNRLTVVSKGVFLNWPAYQKRQQLGCGAEFLSNMVLS---LHNNPWLCDCR-------------LRGLAQFVKSVGPPFILVNSYLVCQGPVSKAGQLLHE--TELGVCMK------PTISTPSVNVTIQVGKNVTLQCFAQASPSPTIAW-KYPLSTWREFDVLASPIAEGIILSQ-LVIPAAQLVDGGNYTCMAFNSIGRSSLVILLYVQPA 347          
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Match: Lingo4 (leucine rich repeat and Ig domain containing 4 [Source:MGI Symbol;Acc:MGI:2444651])

HSP 1 Score: 66.2402 bits (160), Expect = 9.853e-11
Identity = 78/314 (24.84%), Postives = 120/314 (38.22%), Query Frame = 2
Query:  458 EVKNQNIHSLTADQLVKVGWLEDLNLDSNK-----LSSIEFDAFNNVPKLKTLSLKSNFLILGGNSFPSAAXXXXXXXXXXXXXNNPLGFVPDFFFQPLKFLTKLILSRATNGFYLEPNSLVGLTSLEYLDISASHLTALDRQIHSALNNMQLTDFYFFGNQWTCDCNXXXXXXXXXXXXDVRIFKKFSRSNGQSALLQPQCFSPHKFQGYNIFEFSTEYDTIKPEQLNCPPKIFTKN--QQIQIDQGKNLTLMCEFEADPGGTVEWSKNGMRVQRHWKKTKWGQTSGMRFT--AWLSITRTDLEDNGLWRCIL 1372
            ++K   IH   + + +  G L  LNL S       LSS+ F A +++  L+ L L                              NP+  +P     PL  L +L LS A     +  ++  GLT+   LD++ + L  L+     + +  +L      GN  TCDC L WL +   +         F  S        P C  P   QG ++ EFS   D + P    C P +  K+  + +  ++G +    C  + DP  TV W    MR Q  W     G+   +R      L I    L D G + C++
Sbjct:  254 QLKELEIHHWPSLEALDPGSLVGLNLSSLAITRCNLSSVPFQALHHLSFLRILDLS----------------------------QNPISAIPARRLSPLVRLQELRLSGACL-TSIAAHAFHGLTAFHLLDVADNALQTLEETAFPSPD--KLVTLRLSGNPLTCDCRLLWLLRLRRR-------LDFGTS-------PPACAGPQHVQGKSLREFS---DILPPGHFTCKPALIRKSGPRWVIAEEGGHAVFSCSGDGDPAPTVSW----MRPQGAW----LGRVGRVRVLEDGTLEIRSVQLRDRGAYVCVV 511          
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Match: Lingo1 (leucine rich repeat and Ig domain containing 1 [Source:MGI Symbol;Acc:MGI:1915522])

HSP 1 Score: 62.7734 bits (151), Expect = 1.246e-9
Identity = 51/172 (29.65%), Postives = 84/172 (48.84%), Query Frame = 2
Query:  380 KQCICSRLETKFTRIPHDLPDFVETLEVKNQNIHSLTADQLVKVGWLEDLNLDSNKLSSIEFDAFNNVPKLKTLSLKSNFLILGGNSFPSAAXXXXXXXXXXXXXNNPLGFVPDFFFQPLKFLTKLILSRATNGFYLEPNSLVGLTSLEYLDISASHLTALDRQIHSALNNM 895
            +  +C R   +F  +P  +P     L++    I +L  D+      LE+L L+ N +S++E  AFNN+  L+TL L+SN L L     P      L +L  LD+  N +  + D+ FQ L  L  L +    +  Y+   +  GL SLE L +   +LT++  +  S L+ +
Sbjct:   53 RAVLCHR--KRFVAVPEGIPTETRLLDLGKNRIKTLNQDEFASFPHLEELELNENIVSAVEPGAFNNLFNLRTLGLRSNRLKL----IPLGVFTGLSNLTKLDISENKIVILLDYMFQDLYNLKSLEVG-DNDLVYISHRAFSGLNSLEQLTLEKCNLTSIPTEALSHLHGL 217          

HSP 2 Score: 60.4622 bits (145), Expect = 5.675e-9
Identity = 62/255 (24.31%), Postives = 99/255 (38.82%), Query Frame = 2
Query:  698 NPLGFVPDFFFQPLKFLTKLILSRATNGFYLEPNSLVGLTSLEYLDISASHLTALDRQIHSALNNMQLTDFYFFGNQWTCDCNXXXXXXXXXXXXDVRIFKKFSRSNGQSALLQPQCFSPHKFQGYNIFEFSTEYDTIKPEQLNCPPKIFT--KNQQIQIDQGKNLTLMCEFEADPGGTVEWSKNGMRVQRHWKKTKWGQTSGMRFTAW----LSITRTDLEDNGLWRCILITDTQSANATYSLRVRPSFP--PH 1438
            NP+G +       L  L ++ L        +EP +  GL  L  L++S + LT L+     ++ N++        N   CDC L            + +F++  R N      QP C +P   QG    EF    D + P    C        K QQ+ +D+G  +  +C  + DP   + W    +  ++H    K    S  R T +    L +    ++DNG + CI      + +    L VR   P  PH
Sbjct:  297 NPIGTIEGSMLHELLRLQEIQLVGGQLAV-VEPYAFRGLNYLRVLNVSGNQLTTLEESAFHSVGNLE--TLILDSNPLACDCRL------------LWVFRRRWRLNFNRQ--QPTCATPEFVQGK---EFKDFPDVLLPNYFTCRRAHIRDRKAQQVFVDEGHTVQFVCRADGDPPPAILW----LSPRKHLVSAK----SNGRLTVFPDGTLEVRYAQVQDNGTYLCIAANAGGNDSMPAHLHVRSYSPDWPH 523          
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Match: Lingo1 (leucine rich repeat and Ig domain containing 1 [Source:MGI Symbol;Acc:MGI:1915522])

HSP 1 Score: 62.3882 bits (150), Expect = 1.471e-9
Identity = 51/172 (29.65%), Postives = 84/172 (48.84%), Query Frame = 2
Query:  380 KQCICSRLETKFTRIPHDLPDFVETLEVKNQNIHSLTADQLVKVGWLEDLNLDSNKLSSIEFDAFNNVPKLKTLSLKSNFLILGGNSFPSAAXXXXXXXXXXXXXNNPLGFVPDFFFQPLKFLTKLILSRATNGFYLEPNSLVGLTSLEYLDISASHLTALDRQIHSALNNM 895
            +  +C R   +F  +P  +P     L++    I +L  D+      LE+L L+ N +S++E  AFNN+  L+TL L+SN L L     P      L +L  LD+  N +  + D+ FQ L  L  L +    +  Y+   +  GL SLE L +   +LT++  +  S L+ +
Sbjct:   47 RAVLCHR--KRFVAVPEGIPTETRLLDLGKNRIKTLNQDEFASFPHLEELELNENIVSAVEPGAFNNLFNLRTLGLRSNRLKL----IPLGVFTGLSNLTKLDISENKIVILLDYMFQDLYNLKSLEVG-DNDLVYISHRAFSGLNSLEQLTLEKCNLTSIPTEALSHLHGL 211          

HSP 2 Score: 60.4622 bits (145), Expect = 5.690e-9
Identity = 62/255 (24.31%), Postives = 99/255 (38.82%), Query Frame = 2
Query:  698 NPLGFVPDFFFQPLKFLTKLILSRATNGFYLEPNSLVGLTSLEYLDISASHLTALDRQIHSALNNMQLTDFYFFGNQWTCDCNXXXXXXXXXXXXDVRIFKKFSRSNGQSALLQPQCFSPHKFQGYNIFEFSTEYDTIKPEQLNCPPKIFT--KNQQIQIDQGKNLTLMCEFEADPGGTVEWSKNGMRVQRHWKKTKWGQTSGMRFTAW----LSITRTDLEDNGLWRCILITDTQSANATYSLRVRPSFP--PH 1438
            NP+G +       L  L ++ L        +EP +  GL  L  L++S + LT L+     ++ N++        N   CDC L            + +F++  R N      QP C +P   QG    EF    D + P    C        K QQ+ +D+G  +  +C  + DP   + W    +  ++H    K    S  R T +    L +    ++DNG + CI      + +    L VR   P  PH
Sbjct:  291 NPIGTIEGSMLHELLRLQEIQLVGGQLAV-VEPYAFRGLNYLRVLNVSGNQLTTLEESAFHSVGNLE--TLILDSNPLACDCRL------------LWVFRRRWRLNFNRQ--QPTCATPEFVQGK---EFKDFPDVLLPNYFTCRRAHIRDRKAQQVFVDEGHTVQFVCRADGDPPPAILW----LSPRKHLVSAK----SNGRLTVFPDGTLEVRYAQVQDNGTYLCIAANAGGNDSMPAHLHVRSYSPDWPH 517          
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Match: Lingo1 (leucine rich repeat and Ig domain containing 1 [Source:MGI Symbol;Acc:MGI:1915522])

HSP 1 Score: 62.3882 bits (150), Expect = 1.471e-9
Identity = 51/172 (29.65%), Postives = 84/172 (48.84%), Query Frame = 2
Query:  380 KQCICSRLETKFTRIPHDLPDFVETLEVKNQNIHSLTADQLVKVGWLEDLNLDSNKLSSIEFDAFNNVPKLKTLSLKSNFLILGGNSFPSAAXXXXXXXXXXXXXNNPLGFVPDFFFQPLKFLTKLILSRATNGFYLEPNSLVGLTSLEYLDISASHLTALDRQIHSALNNM 895
            +  +C R   +F  +P  +P     L++    I +L  D+      LE+L L+ N +S++E  AFNN+  L+TL L+SN L L     P      L +L  LD+  N +  + D+ FQ L  L  L +    +  Y+   +  GL SLE L +   +LT++  +  S L+ +
Sbjct:   47 RAVLCHR--KRFVAVPEGIPTETRLLDLGKNRIKTLNQDEFASFPHLEELELNENIVSAVEPGAFNNLFNLRTLGLRSNRLKL----IPLGVFTGLSNLTKLDISENKIVILLDYMFQDLYNLKSLEVG-DNDLVYISHRAFSGLNSLEQLTLEKCNLTSIPTEALSHLHGL 211          

HSP 2 Score: 60.4622 bits (145), Expect = 5.690e-9
Identity = 62/255 (24.31%), Postives = 99/255 (38.82%), Query Frame = 2
Query:  698 NPLGFVPDFFFQPLKFLTKLILSRATNGFYLEPNSLVGLTSLEYLDISASHLTALDRQIHSALNNMQLTDFYFFGNQWTCDCNXXXXXXXXXXXXDVRIFKKFSRSNGQSALLQPQCFSPHKFQGYNIFEFSTEYDTIKPEQLNCPPKIFT--KNQQIQIDQGKNLTLMCEFEADPGGTVEWSKNGMRVQRHWKKTKWGQTSGMRFTAW----LSITRTDLEDNGLWRCILITDTQSANATYSLRVRPSFP--PH 1438
            NP+G +       L  L ++ L        +EP +  GL  L  L++S + LT L+     ++ N++        N   CDC L            + +F++  R N      QP C +P   QG    EF    D + P    C        K QQ+ +D+G  +  +C  + DP   + W    +  ++H    K    S  R T +    L +    ++DNG + CI      + +    L VR   P  PH
Sbjct:  291 NPIGTIEGSMLHELLRLQEIQLVGGQLAV-VEPYAFRGLNYLRVLNVSGNQLTTLEESAFHSVGNLE--TLILDSNPLACDCRL------------LWVFRRRWRLNFNRQ--QPTCATPEFVQGK---EFKDFPDVLLPNYFTCRRAHIRDRKAQQVFVDEGHTVQFVCRADGDPPPAILW----LSPRKHLVSAK----SNGRLTVFPDGTLEVRYAQVQDNGTYLCIAANAGGNDSMPAHLHVRSYSPDWPH 517          
BLAST of Ig-like domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6PFC5|LRIT2_MOUSE (Leucine-rich repeat, immunoglobulin-like domain and transmembrane domain-containing protein 2 OS=Mus musculus OX=10090 GN=Lrit2 PE=2 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 5.298e-10
Identity = 91/376 (24.20%), Postives = 144/376 (38.30%), Query Frame = 2
Query:  383 QCICSR---------LETKFTRIPHDLPDFVETLEVKNQNIHSLTADQLVKVGWLEDLNLDSNKLSSIEFDAFNNVPKLKTLSLKSNFLILGGNSFPSAAXXXXXXXXXXXXXNNPLGFVPDFFFQPLKFLTKLILSRATNGFYLEPNSLVGLTSLEYLDISASHLTALDRQIH----------------SALNNMQLTDFYFFGNQWTCDCNXXXXXXXXXXXXDVRIFKKFSRSNGQSALLQPQ---CFSPHKFQGYNIFEFSTEYDTIKPEQLNCPPKIFTKNQQIQIDQGKNLTLMCEFEADPGGTVEWSKNGMRVQRHWKKTKWGQTSGMRFTAWLSITRTDLEDNGLWRCILITDTQSANATYSLRVRPS 1426
            +C CS          +     +IP + P+ ++ + ++N  +  L+      +  LE L L+ N ++ I   A  ++P+L+ L L+ N L     S P  A      L+VLDL +N +  VP+     L+FLT LI                      YLDIS++ LT + + +                   L+NM L+      N W CDC              +R   +F +S G   +L      C  P    G  + E  TE            P I T +  + I  GKN+TL C  +A P  T+ W K  +   R +         G+  +  L I    L D G + C+       ++    L V+P+
Sbjct:   27 ECTCSEESFGRSLQCMSMSLGKIPDNFPEELKQVRIENSPLFELSQGFFTNMSSLEYLWLNFNNVTVIHLGALEDLPELRELRLEGNKL----RSVPWTAFRATPLLRVLDLKHNRIDSVPEL---ALQFLTNLI----------------------YLDISSNRLTVVSKGVFLNWPAYQKRQQLGCGAEFLSNMVLS---LHNNPWLCDCR-------------LRGLAQFVKSVGPPFILVNSYLVCQGPVSKAGQLLHE--TELGVCMK------PTISTPSVNVTIQVGKNVTLQCFAQASPSPTIAW-KYPLSTWREFDVLASPIAEGIILSQ-LVIPAAQLVDGGNYTCMAFNSIGRSSLVILLYVQPA 347          
BLAST of Ig-like domain-containing protein vs. UniProt/SwissProt
Match: sp|Q149C3|LIGO4_MOUSE (Leucine-rich repeat and immunoglobulin-like domain containing-NOGO receptor-interacting protein 4 OS=Mus musculus OX=10090 GN=Lingo4 PE=2 SV=2)

HSP 1 Score: 65.855 bits (159), Expect = 8.955e-10
Identity = 78/314 (24.84%), Postives = 120/314 (38.22%), Query Frame = 2
Query:  458 EVKNQNIHSLTADQLVKVGWLEDLNLDSNK-----LSSIEFDAFNNVPKLKTLSLKSNFLILGGNSFPSAAXXXXXXXXXXXXXNNPLGFVPDFFFQPLKFLTKLILSRATNGFYLEPNSLVGLTSLEYLDISASHLTALDRQIHSALNNMQLTDFYFFGNQWTCDCNXXXXXXXXXXXXDVRIFKKFSRSNGQSALLQPQCFSPHKFQGYNIFEFSTEYDTIKPEQLNCPPKIFTKN--QQIQIDQGKNLTLMCEFEADPGGTVEWSKNGMRVQRHWKKTKWGQTSGMRFT--AWLSITRTDLEDNGLWRCIL 1372
            ++K   IH   + + +  G L  LNL S       LSS+ F A +++  L+ L L                              NP+  +P     PL  L +L LS A     +  ++  GLT+   LD++ + L  L+     + +  +L      GN  TCDC L WL +   +         F  S        P C  P   QG ++ EFS   D + P    C P +  K+  + +  ++G +    C  + DP  TV W    MR Q  W     G+   +R      L I    L D G + C++
Sbjct:  229 QLKELEIHHWPSLEALDPGSLVGLNLSSLAITRCNLSSVPFQALHHLSFLRILDLS----------------------------QNPISAIPARRLSPLVRLQELRLSGACL-TSIAAHAFHGLTAFHLLDVADNALQTLEETAFPSPD--KLVTLRLSGNPLTCDCRLLWLLRLRRR-------LDFGTS-------PPACAGPQHVQGKSLREFS---DILPPGHFTCKPALIRKSGPRWVIAEEGGHAVFSCSGDGDPAPTVSW----MRPQGAW----LGRVGRVRVLEDGTLEIRSVQLRDRGAYVCVV 486          
BLAST of Ig-like domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6UY18|LIGO4_HUMAN (Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 4 OS=Homo sapiens OX=9606 GN=LINGO4 PE=2 SV=1)

HSP 1 Score: 65.855 bits (159), Expect = 9.513e-10
Identity = 78/314 (24.84%), Postives = 118/314 (37.58%), Query Frame = 2
Query:  458 EVKNQNIHSLTADQLVKVGWLEDLNLDSNK-----LSSIEFDAFNNVPKLKTLSLKSNFLILGGNSFPSAAXXXXXXXXXXXXXNNPLGFVPDFFFQPLKFLTKLILSRATNGFYLEPNSLVGLTSLEYLDISASHLTALDRQIHSALNNMQLTDFYFFGNQWTCDCNXXXXXXXXXXXXDVRIFKKFSRSNGQSALLQPQCFSPHKFQGYNIFEFSTEYDTIKPEQLNCPPKIFTKN--QQIQIDQGKNLTLMCEFEADPGGTVEWSKNGMRVQRHWKKTKWGQTSGMRFT--AWLSITRTDLEDNGLWRCIL 1372
            ++K   IH   + + +  G L  LNL S       LSS+ F A  ++  L+ L L                              NP+  +P     PL  L +L LS A     +  ++  GLT+   LD++ + L  L+     + +  +L      GN  TCDC L WL +             F  S        P C  PH  QG ++ EFS   D + P    C P +  K+  + +  ++G +    C  + DP  TV W    MR    W     G+   +R      L I    L D G + C++
Sbjct:  229 QLKELEIHLWPSLEALDPGSLVGLNLSSLAITRCNLSSVPFQALYHLSFLRVLDLS----------------------------QNPISAIPARRLSPLVRLQELRLSGACL-TSIAAHAFHGLTAFHLLDVADNALQTLEETAFPSPD--KLVTLRLSGNPLTCDCRLLWLLRLRRH-------LDFGMS-------PPACAGPHHVQGKSLKEFS---DILPPGHFTCKPALIRKSGPRWVIAEEGGHAVFSCSGDGDPAPTVSW----MRPHGAW----LGRAGRVRVLEDGTLEIRSVQLRDRGAYVCVV 486          
BLAST of Ig-like domain-containing protein vs. UniProt/SwissProt
Match: sp|Q50L44|LIGO1_CHICK (Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1 OS=Gallus gallus OX=9031 GN=LINGO1 PE=2 SV=1)

HSP 1 Score: 63.1586 bits (152), Expect = 6.509e-9
Identity = 56/189 (29.63%), Postives = 90/189 (47.62%), Query Frame = 2
Query:  332 SESVVGCV-TIMIAEKRKQCICSRLETKFTRIPHDLPDFVETLEVKNQNIHSLTADQLVKVGWLEDLNLDSNKLSSIEFDAFNNVPKLKTLSLKSNFLILGGNSFPSAAXXXXXXXXXXXXXNNPLGFVPDFFFQPLKFLTKLILSRATNGFYLEPNSLVGLTSLEYLDISASHLTALDRQIHSALNNM 895
            S S  GC      + + +  +C R   +F  +P  +P     L++    I +L  D+      LE+L L+ N +S+IE  AFNN+  L+TL L+SN L L     P      L +L  LD+  N +  + D+ FQ L  L  L +    +  Y+   +  GL SLE L +   +LT++  +  S L+ +
Sbjct:   29 SGSATGCPPRCECSAQERAVLCHR--KRFMVVPEGIPTETRQLDLGKNRIKTLNQDEFANYPHLEELELNENIISAIEPGAFNNLFNLRTLGLRSNRLKL----IPLGVFTGLSNLTKLDISENKIVILLDYMFQDLYNLKSLEVG-DNDLVYISHRAFSGLNSLEQLTLEKCNLTSIPTEALSHLHGL 210          

HSP 2 Score: 58.5362 bits (140), Expect = 1.704e-7
Identity = 59/225 (26.22%), Postives = 91/225 (40.44%), Query Frame = 2
Query:  788 LEPNSLVGLTSLEYLDISASHLTALDRQIHSALNNMQLTDFYFFGNQWTCDCNXXXXXXXXXXXXDVRIFKKFSRSNGQSALLQPQCFSPHKFQGYNIFEFSTEYDTIKPEQLNCPPKIFT--KNQQIQIDQGKNLTLMCEFEADPGGTVEWSKNGMRVQRHWKKTKWGQTSGMRFTAW----LSITRTDLEDNGLWRCILITDTQSANATYSLRVRPSFP--PH 1438
            +EP +  GL  L  L++S + LT L+     ++ N++        N   CDC L            + +F++  R N      QP C +P   QG    EF    D + P    C        K QQI +D+G  +  +C  + DP   + W    +  ++H   TK   T+G R T +    L +    ++DNG + CI      +      L VR   P  PH
Sbjct:  319 VEPFAFRGLNYLRILNVSGNLLTTLEESAFHSVGNLE--TLILDNNPLACDCRL------------LWVFRRRWRLNFNKQ--QPTCSTPEFVQGK---EFKDFPDVLLPNYFTCRRARIRDRKPQQIFVDEGHTVHFVCRADGDPPPAIMW----LSPRKHLISTK---TNG-RLTVFPDGTLEVRYAQIQDNGTYLCIASNAGGNDTMLAHLHVRSYSPDWPH 516          
BLAST of Ig-like domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5RDJ4|LIGO1_PONAB (Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1 OS=Pongo abelii OX=9601 GN=LINGO1 PE=2 SV=1)

HSP 1 Score: 62.3882 bits (150), Expect = 9.278e-9
Identity = 51/172 (29.65%), Postives = 84/172 (48.84%), Query Frame = 2
Query:  380 KQCICSRLETKFTRIPHDLPDFVETLEVKNQNIHSLTADQLVKVGWLEDLNLDSNKLSSIEFDAFNNVPKLKTLSLKSNFLILGGNSFPSAAXXXXXXXXXXXXXNNPLGFVPDFFFQPLKFLTKLILSRATNGFYLEPNSLVGLTSLEYLDISASHLTALDRQIHSALNNM 895
            +  +C R   +F  +P  +P     L++    I +L  D+      LE+L L+ N +S++E  AFNN+  L+TL L+SN L L     P      L +L  LD+  N +  + D+ FQ L  L  L +    +  Y+   +  GL SLE L +   +LT++  +  S L+ +
Sbjct:   47 RAVLCHR--KRFVAVPEGIPTETRLLDLGKNRIKTLNQDEFASFPHLEELELNENIVSAVEPGAFNNLFNLRTLGLRSNRLKL----IPLGVFTGLSNLTKLDISENKIVILLDYMFQDLYNLKSLEVG-DNDLVYISHRAFSGLNSLEQLTLEKCNLTSIPTEALSHLHGL 211          

HSP 2 Score: 61.2326 bits (147), Expect = 2.724e-8
Identity = 56/225 (24.89%), Postives = 90/225 (40.00%), Query Frame = 2
Query:  788 LEPNSLVGLTSLEYLDISASHLTALDRQIHSALNNMQLTDFYFFGNQWTCDCNXXXXXXXXXXXXDVRIFKKFSRSNGQSALLQPQCFSPHKFQGYNIFEFSTEYDTIKPEQLNCPPKIFT--KNQQIQIDQGKNLTLMCEFEADPGGTVEWSKNGMRVQRHWKKTKWGQTSGMRFTAW----LSITRTDLEDNGLWRCILITDTQSANATYSLRVRPSFP--PH 1438
            +EP +  GL  L  L++S + LT L+  +  ++ N++        N   CDC L            + +F++  R N      QP C +P   QG    EF    D + P    C        K QQ+ +D+G  +  +C  + DP   + W    +  ++H    K    S  R T +    L +    ++DNG + CI      + +    L VR   P  PH
Sbjct:  320 VEPYAFRGLNYLRVLNVSGNQLTTLEESVFHSVGNLE--TLILDSNPLACDCRL------------LWVFRRRWRLNFNRQ--QPTCATPEFVQGK---EFKDFPDVLLPNYFTCRRARIRDRKAQQVFVDEGHTVQFVCRADGDPPPAILW----LSPRKHLVSAK----SNGRLTVFPGGTLEVRYAQVQDNGTYLCIAANAGGNDSMPAHLHVRSYSPDWPH 517          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: A0A3P8EXC8 (Ig-like domain-containing protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS3162 PE=4 SV=1)

HSP 1 Score: 224.172 bits (570), Expect = 1.118e-58
Identity = 207/683 (30.31%), Postives = 312/683 (45.68%), Query Frame = 2
Query:  326 KYSESVVGCVTIMIAE--KRKQCICSRLETKFTRIPHDLPDFVETLEVKNQNIHSLTADQLVKVGWLEDLNLDSNKLSSIEFDAFNNVPKLKTLSLKSNFLILGGNSFPSAAXXXXXXXXXXXXXNNPLGFVPDFFFQPL-KFLTKLILSRATNGFYLEPNSLVGLTSLEYLDISASHLTALDRQIHSALNNMQLTDFYFFGNQWTCDCNXXXXXXXXXXXXDVRIFKK----------------------FSRSNGQSALLQPQCFSPHKFQGYNIFEFST--EYDTIKPEQLNCPPKIFTKNQQIQIDQGKNLTLMCEFEADPGGTVEWSKNGMRVQRHWKKTKWGQTSGMRFTAWLSITRTDLEDNGLWRCILITDTQSANATYSLRVRPS--------------FPPHIDLTIILKYXXXXXXXXXXXXXXXXXXXYCVYGFRIR-------------------------PFIKQGKGSTASHSQPDRSIRP-----TRLDGENHHCESNSIRPLTVNALVNK--DKRQTEENLKKYCNNDESQKCLLLPSSPALVIPITNQTVINNSTH---IPCPLHGNINFIDHSAFTDSKQHSNMEYNNPIGFIQPHTLP-RQNNRTMNRMKTNPIF----------ITSNNQTNPNSCISCPLHGNILASIQRQNEEENDNINS 2113
            K + SV GCVT +  E    +Q IC + +T FT IP  LP  V  L V +Q+I  L + Q   +  L  L+LDSNK+  I  + F+ +  L+TLSL+ N LI   +SF       L  L+ L+L  NP+G+VP   F P+   L  L+LS  +  F L+P +L GLT L+ LD+S +HL +L     S L++MQL + Y +GN W CDCNL+WLK W LK+    I+ +                      +  +    +LLQP+C SP+   G  +F   T      ++    +C P+  T NQ +Q+  G N TL CEF ADP G V W +NG  +Q+ W +    QT+G  F A L++      D G + C L T     N T+S++V                 +   ++ T++LKY GI A  LI+LL+IIG+ IYC YG R R                         P   Q    T     P  S+        R +      + N++R + + +  N+  D   T   L     ND  Q+C +   + A++ P+   +V+ +ST+   IP P    +  +   A      H++          Q H L  ++  R +  M+ + I           + +N  T  +    CPLHG+I A++     +  DN+ S
Sbjct:   95 KAAFSVRGCVTYVAGEDYSMRQSICDKPDTHFTTIPAALPSQVVKLTVNHQDITELNSTQFKHLPNLTYLDLDSNKIVRIHPNTFHVLKHLQTLSLRFNLLIFSVDSFHPDVTHGLIGLENLNLLQNPMGYVPKRIFAPIGSSLRSLVLSGGSEDFQLDPGALDGLTMLQLLDLSYNHLESLPESFESTLHHMQLKELYLYGNPWRCDCNLRWLKVWFLKYNSKLIYSRPVPEGVNRNLLDPSAQRWYDYNYDGTGDGPSLLQPRCASPYALFGRPLFSHQTLAGLQPVRTTDFHCLPQALTANQPVQLTLGSNATLTCEFFADPTGIVVWYRNGTLIQQRWARMSMHQTTGRTFQAELTVQDVQPSDAGTYVCFLDTGHGRVNTTFSVQVNSDDQTVSSKIKEGVFRWINRLNTTLVLKYTGIIASCLIMLLMIIGLFIYCFYGKRNRLSKPRFDRERMSNQVEPDVQMNNDSPIKSQTNAGTYDFLPPRPSVVAPQSSLVRRENVPVDIKDNNMREMQLISPTNEKMDNYVTFRILPTDSKNDLPQRCSV--HNYAIIHPVGADSVLLDSTNPRLIPLPSAAQL-LVSPPAMPAPIAHTD----------QSHLLVFKEPERNLTNMELSGIIQPPGPVLSDALVANTST--SDLTPCPLHGHIYATLHPHQSDRRDNVES 762          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: A0A504Z776 (Leucine-rich repeat-containing protein 4 OS=Fasciola gigantica OX=46835 GN=FGIG_10709 PE=4 SV=1)

HSP 1 Score: 223.402 bits (568), Expect = 1.214e-58
Identity = 203/665 (30.53%), Postives = 316/665 (47.52%), Query Frame = 2
Query:  341 VVGCVTIMIAE--KRKQCICSRLETKFTRIPHDLPDFVETLEVKNQNIHSLTADQLVKVGWLEDLNLDSNKLSSIEFDAFNNVPKLKTLSLKSNFLILGGNSFPSAAXXXXXXXXXXXXXNNPLGFVPDFFFQPL-KFLTKLILSRATNGFYLEPNSLVGLTSLEYLDISASHLTALDRQIHSALNNMQLTDFYFFGNQWTCDCNXXXXXXXXXXXXDVRIFKK----------------------FSRSNGQSALLQPQCFSPHKFQGYNIFEFST--EYDTIKPEQLNCPPKIFTKNQQIQIDQGKNLTLMCEFEADPGGTVEWSKNGMRVQRHWKKTKWGQTSGMRFTAWLSITRTDLEDNGLWRCILITDTQSANATYSLRVR------PS--------FPPHIDLTIILKYXXXXXXXXXXXXXXXXXXXYCVYGFRIRPFIKQ-GKGSTASHSQPDRSI---RPTRLDGENHHCESNSIRPLTV--NALVNKDKRQTE----------------ENLKKYCN---------NDESQKCLLLPSSPALVIPIT-NQTVINNSTHIPCPLHGNINFIDHSAFTDSKQHSNMEYNNPIGFIQPHTLPRQNNRTMNRMKTNPIFITSNNQ---TNPNSCISCPLHGNILASIQRQNEEENDNI 2107
            V GCVT +  E    +Q IC + +T F  IP  LP  V  L V +Q+I  L A Q   +  L  L+LDSNK+  I  + F+ +  L+TLSL+ N L  G NSF       L +L+ L+L  NP+G+VP   F PL   L  L+LS  +  F L+P +L GLT L+ LD+S +HL  L     + +++MQL + Y +GN W CDCNL+WLK W LK     I+ +                      +  S    +LLQP+C SP+   G  +F   T      ++    +C P+  T NQ IQI +G N T+ CEF ADP G V W +NG  +Q+ W++    QT+G  F A L+I      D G + C L T     N T+S++V       PS        +   ++ T++LKY GI A  LI+LL+IIG+ IYC YG R R    +  +     H + D  +    P +L       +    RP++   ++LV +++   E                E +  Y            D  Q+C +   + A++ P+  N  +++   H    L  +   + + + T+S   S  + ++ + F +P +    +N  ++ +  +P  +   +Q      +    CPLHG+I AS+  Q ++  +N+
Sbjct:   61 VRGCVTYVAGEDYSMRQSICDKPDTHFLTIPASLPSQVVKLTVNHQDISELNASQFRHLPNLTYLDLDSNKIIRIHPNTFHVLKHLRTLSLRFNLLTFGVNSFHPDVPHGLIYLESLNLLQNPMGYVPKRIFAPLGSSLRVLVLSGGSEDFQLDPGALDGLTMLQVLDLSYNHLETLHESFETTISHMQLKELYLYGNPWRCDCNLRWLKVWFLKVNTKLIYSRPVPEGVNRNLLDPSAQRWYDYNYGGSGDAPSLLQPRCASPYALFGRPLFSHQTLSGIQPVRTTDFHCLPQALTPNQPIQIMKGSNATITCEFFADPTGIVVWYRNGTLIQQRWERMSTHQTTGRTFQAELTIRDVQSIDAGTYVCFLDTGQGRVNTTFSVQVSTEDQHAPSKFKEGVFRWINRLNTTLVLKYTGIIASCLIMLLIIIGLFIYCFYGRRNRLSKTEFDRDHVTKHLEQDSYLNNESPAKLHNNAGTYDYLPPRPISAPQSSLVRRERFPAEVKENGMHEMQLISPTGEKIDNYVTLRILPTDSKGDLVQRCSM--HNYAIIHPVGPNSVLLDGEAHSVITLPSSDQLMVNPS-TESTPLSRTDQSHLLVFKEPGS--HSHNMDLSGITQSPRPVVPGDQDTGATSSDFTPCPLHGHIYASLHPQQKDRRENV 720          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: A0A183A877 (Ig-like domain-containing protein OS=Echinostoma caproni OX=27848 PE=4 SV=1)

HSP 1 Score: 224.172 bits (570), Expect = 1.359e-58
Identity = 212/687 (30.86%), Postives = 314/687 (45.71%), Query Frame = 2
Query:  326 KYSESVVGCVTIMIAE--KRKQCICSRLETKFTRIPHDLPDFVETLEVKNQNIHSLTADQLVKVGWLEDLNLDSNKLSSIEFDAFNNVPKLKTLSLKSNFLILGGNSFPSAAXXXXXXXXXXXXXNNPLGFVPDFFFQPL-KFLTKLILSRATNGFYLEPNSLVGLTSLEYLDISASHLTALDRQIHSALNNMQLTDFYFFGNQWTCDCNXXXXXXXXXXXXDVRIFKK----------------------FSRSNGQSALLQPQCFSPHKFQGYNIFEFST--EYDTIKPEQLNCPPKIFTKNQQIQIDQGKNLTLMCEFEADPGGTVEWSKNGMRVQRHWKKTKWGQTSGMRFTAWLSITRTDLEDNGLWRCILITDTQSANATYSLRVRPS--------------FPPHIDLTIILKYXXXXXXXXXXXXXXXXXXXYCVYGFRIR-------------------------PFIKQGKGSTASHSQPDRSIRP-----TRLDGENHHCESNSIRPLTVNALVNK--DKRQTEENLKKYCNNDESQKCLLLPSSPALVIPITNQTVINNSTH---IPCP-----------LHGNINFIDHS---AFTDSKQH-SNMEYNNPIGFIQPHTLPRQNNRTMNRMKTNPIFITSNNQTNPNSCISCPLHGNILASIQRQNEEENDNINS 2113
            K + SV GCVT +  E    +Q IC + +T FT IP  LP  V  L V +Q+I  L + Q   +  L  L+LDSNK+  I  + F+ +  L+TLSL+ N LI   +SF       L  L+ L+L  NP+G+VP   F P+   L  L+LS  +  F L+P +L GLT L+ LD+S +HL +L     S L++MQL + Y +GN W CDCNL+WLK W LK+    I+ +                      +  +    +LLQP+C SP+   G  +F   T      ++    +C P+  T NQ +Q+  G N TL CEF ADP G V W +NG  +Q+ W +    QT+G  F A L++      D G + C L T     N T+S++V                 +   ++ T++LKY GI A  LI+LL+IIG+ IYC YG R R                         P   Q    T     P  S+        R +      + N++R + + +  N+  D   T   L     ND  Q+C +   + A++ P+   +V+ +ST+   IP P           +   I   D S    F + +++ +NME +   G IQP      +    N         TS +   P     CPLHG+I A++     +  DN+ S
Sbjct:   95 KAAFSVRGCVTYVAGEDYSMRQSICDKPDTHFTTIPAALPSQVVKLTVNHQDITELNSTQFKHLPNLTYLDLDSNKIVRIHPNTFHVLKHLQTLSLRFNLLIFSVDSFHPDVTHGLIGLENLNLLQNPMGYVPKRIFAPIGSSLRSLVLSGGSEDFQLDPGALDGLTMLQLLDLSYNHLESLPESFESTLHHMQLKELYLYGNPWRCDCNLRWLKVWFLKYNSKLIYSRPVPEGVNRNLLDPSAQRWYDYNYDGTGDGPSLLQPRCASPYALFGRPLFSHQTLAGLQPVRTTDFHCLPQALTANQPVQLTLGSNATLTCEFFADPTGIVVWYRNGTLIQQRWARMSMHQTTGRTFQAELTVQDVQPSDAGTYVCFLDTGHGRVNTTFSVQVNSDDQTVSSKIKEGVFRWINRLNTTLVLKYTGIIASCLIMLLMIIGLFIYCFYGKRNRLSKPRFDRERMSNQVEPDVQMNNDSPIKSQTNAGTYDFLPPRPSVVAPQSSLVRRENVPVDIKDNNMREMQLISPTNEKMDNYVTFRILPTDSKNDLPQRCSV--HNYAIIHPVGADSVLLDSTNPRLIPLPSAAQLLVSPPAMPAPIAHTDQSHLLVFKEPERNLTNMELS---GIIQPPGPVLSDALVAN---------TSTSDLTP-----CPLHGHIYATLHPHQSDRRDNVES 762          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: A0A2H1CPY5 (Immunoglobulin I-set domain protein OS=Fasciola hepatica OX=6192 GN=D915_002068 PE=4 SV=1)

HSP 1 Score: 220.32 bits (560), Expect = 1.552e-57
Identity = 201/665 (30.23%), Postives = 314/665 (47.22%), Query Frame = 2
Query:  341 VVGCVTIMIAE--KRKQCICSRLETKFTRIPHDLPDFVETLEVKNQNIHSLTADQLVKVGWLEDLNLDSNKLSSIEFDAFNNVPKLKTLSLKSNFLILGGNSFPSAAXXXXXXXXXXXXXNNPLGFVPDFFFQPL-KFLTKLILSRATNGFYLEPNSLVGLTSLEYLDISASHLTALDRQIHSALNNMQLTDFYFFGNQWTCDCNXXXXXXXXXXXXDVRIFKK----------------------FSRSNGQSALLQPQCFSPHKFQGYNIFEFST--EYDTIKPEQLNCPPKIFTKNQQIQIDQGKNLTLMCEFEADPGGTVEWSKNGMRVQRHWKKTKWGQTSGMRFTAWLSITRTDLEDNGLWRCILITDTQSANATYSLRVR------PS--------FPPHIDLTIILKYXXXXXXXXXXXXXXXXXXXYCVYGFRIR-PFIKQGKGSTASHSQPDRSI---RPTRLDGENHHCESNSIRPLTV--NALVNKDKRQTE----------------ENLKKYCN---------NDESQKCLLLPSSPALVIPIT-NQTVINNSTHIPCPLHGNINFIDHSAFTDSKQHSNMEYNNPIGFIQPHTLPRQNNRTMNRMKTNPIFITSNNQ---TNPNSCISCPLHGNILASIQRQNEEENDNI 2107
            V GCVT +  E    +Q IC + +T F  IP  LP  V  L V +Q+I  L A Q   +  L  L+LDSNK+  I  + F+ +  L+ LSL+ N L  G NSF       L +L+ L+L  NP+G+VP   F PL   L  L+LS  +  F L+P +L GLT L+ LD+S +HL  L     + +++MQL + Y +GN W CDCNL+WLK W LK     I+ +                      +  +    +LLQP+C SP+   G  +F   T      ++    +C P+  T NQ IQI +G N T+ CEF ADP G V W +NG  +Q+ W++    QT+G  F A L+I      D G + C L T     N T+S++V       PS        +   ++ T++LKY GI A  LI+LL+IIG+ IYC YG R R    +  +     H + D  +    P +L       +    RP++   ++LV +++   E                E +  Y            D  Q+C +   + A++ P+  N  +++   H    L  +   + + + T+S   S  + ++ + F +P +    +N   + +  +P  +   +Q      +    CPLHG+I AS+  Q ++  +N+
Sbjct:   61 VRGCVTYVAGEDYSMRQSICDKPDTHFLTIPASLPSQVVKLTVNHQDISELNASQFRHLPNLTYLDLDSNKIIRIHPNTFHVLKHLRILSLRFNLLTFGVNSFHPDVPHGLIYLESLNLLQNPMGYVPKRIFAPLGSSLRVLVLSGGSEDFQLDPGALEGLTMLQVLDLSYNHLETLHESFETTIHHMQLKELYLYGNPWRCDCNLRWLKVWFLKVNTKLIYSRPVPEGVNRNLLDPSAQRWYDYNYGGNGDAPSLLQPRCASPYALFGRPLFSHQTLSGLQPVRTTDFHCLPQALTPNQPIQIMKGSNATITCEFFADPTGIVVWYRNGTLIQQRWERMSMHQTTGRTFQAELTIKDVQSIDAGTYVCFLDTGHGRVNTTFSVQVSTEDQHAPSKFKEGVFRWINRLNTTLVLKYTGIIASCLIMLLIIIGLFIYCFYGRRNRLSKTEIDRDHVTKHLEQDSYLNNESPAKLHSNTGTYDYLPPRPISAPQSSLVRRERFPAELKENGVREMQLMSPTGEKIDNYVTLRILPTDSKGDLVQRCSM--HNYAIIHPVGPNSVLLDGGAHSVITLPSSDQLMVNPS-TESTPLSRTDPSHLLVFKEPES--HSHNMDFSGIIQSPRPVVPGDQDTGATSSDFTPCPLHGHIYASLHPQQKDRRENV 720          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: A0A183VKE4 (Ig-like domain-containing protein OS=Trichobilharzia regenti OX=157069 GN=TRE_LOCUS478 PE=4 SV=1)

HSP 1 Score: 208.764 bits (530), Expect = 1.601e-54
Identity = 143/404 (35.40%), Postives = 206/404 (50.99%), Query Frame = 2
Query:  335 ESVVGCVTIMIAE--KRKQCICSRLETKFTRIPHDLPDFVETLEVKNQNIHSLTADQLVKVGWLEDLNLDSNKLSSIEFDAFNNVPKLKTLSLKSNFLILGGNSFPSAAXXXXXXXXXXXXXNNPLGFVPDFFFQPL-KFLTKLILSRATNGFYLEPNSLVGLTSLEYLDISASHLTALDRQIHSALNNMQLTDFYFFGNQWTCDCNXXXXXXXXXXXXDVRIFKK----------------------------------FSRSNGQSALLQPQCFSPHKFQGYNIFEF--STEYDTIKPEQLNCPPKIFTKNQQIQIDQGKNLTLMCEFEADPGGTVEWSKNGMRVQRHWKKTKWGQTSGMRFTAWLSITRTDLEDNGLWRCILITDTQSANATYSLRVRPSF 1429
            + V GCVT +  +    +Q IC +L T F  IP  LP  V  L V +Q+I  L A Q   +  L  LNLDSNK+  I  + F+N+ KL+TLSL+ NFL +   SF    +  L  L+ ++L +NP+G VP+ FF P+ K L  ++LS  +  F L   +  GL  L+ LD+S +HL +L        + MQL + Y +GN W CDC+L+WLK W LK+    I+ K                                    + N  + LLQP+C SP +  G  +F    +     +      CPP+++T NQQIQ+  G N TL+C F ADP G V W K+G+R+Q HW +T   Q+ G +F A L+I      D G++ C L T     N T++++V  S 
Sbjct:   49 DCVKGCVTFVAGDDYSMRQSICDKLNTHFQTIPLSLPSEVIKLTVNHQDIVQLNASQFNHLPNLTFLNLDSNKIKIIHPNTFSNLNKLQTLSLRYNFLTISHESFHPNVINGLIGLQHINLLHNPIGNVPNHFFLPISKTLRSIVLSGGSTDFQLNKETFYGLWKLQLLDLSNNHLESLPEFYEGIFSQMQLQELYLYGNPWKCDCHLRWLKVWFLKYGKKLIYSKPINDAVLLRNNIDIETNNWLLNGNTNSNNNNGKLDYQLNDVNTLLQPKCASPIELHGRPLFSQINNAGVQAVHSTDFYCPPEVYTPNQQIQLILGNNSTLLCNFFADPSGIVVWYKDGIRIQNHWPRTIIKQSQGKKFQAELTIENIQPSDAGIYVCYLDTGYGYVNTTFNVQVDSSL 452          
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Match: lingo1a (leucine rich repeat and Ig domain containing 1 [Source:NCBI gene;Acc:103034139])

HSP 1 Score: 64.3142 bits (155), Expect = 3.043e-10
Identity = 55/200 (27.50%), Postives = 86/200 (43.00%), Query Frame = 2
Query:  788 LEPNSLVGLTSLEYLDISASHLTALDRQIHSALNNMQLTDFYFFGNQWTCDCNXXXXXXXXXXXXDVRIFKKFSRSNGQSALLQPQCFSPHKFQGYNIFEFSTEYDTIKPEQLNCPPKIFT--KNQQIQIDQGKNLTLMCEFEADPGGTVEWSKNGMRVQRHWKKTKWGQTSGMRFTAW----LSITRTDLEDNGLWRCI 1369
            +EP S  GL  L+ L++S + LT L+  +  ++ N++      + N   CDC L            + IF++  R N      QP C SP   QG    EF    D ++P    C        K QQ  +D+G  +   C+ + DP   + W    +  Q+ +  TK   T G R T +    L +    ++DNG + CI
Sbjct:  319 IEPYSFRGLNYLKILNVSGNSLTTLEESVFHSVGNLE--TLVLYDNPLACDCRL------------LWIFRRRWRLNFNRQ--QPTCSSPEFVQGK---EFKDFPDILQPNYFTCRKSRIRDRKPQQKFVDEGTTVHFACQADGDPAPVIMW----LSPQKQYITTK---TIG-RLTVFPDGTLEVRYAQIQDNGTYMCI 491          
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Match: lrrc4ba (leucine-rich repeat-containing protein 4B-like [Source:NCBI gene;Acc:103034410])

HSP 1 Score: 62.003 bits (149), Expect = 1.381e-9
Identity = 48/162 (29.63%), Postives = 76/162 (46.91%), Query Frame = 2
Query:  368 AEKRKQCICSRLETKFTRIPHDLPDFVETLEVKNQNIHSLTADQLVKVGWLEDLNLDSNKLSSIEFDAFNNVPKLKTLSLKSNFLILGGNSFPSAAXXXXXXXXXXXXXNNPLGFVPDFFFQPLKFLTKLILSRATNGFYLEPNSLVGLTSLEYLDISASHL 853
            + +  + IC+R       +P ++ +    L ++  +I  + +D    +  LE L L  N++  IE  AFN +P L TL L  N L L     PS A   L  L+ L L NNP+  +P + F  +  L +L L       Y+   + VGL +L YL++    L
Sbjct:   34 SNQASRVICTR--QSLDEVPENISNNTRYLNLQENSIQVIRSDTFKHLRHLEILQLSKNQIRQIEVGAFNGLPNLNTLELFDNRLTL----VPSQAFEYLSKLRELWLRNNPIETLPGYAFHRVPSLRRLDLGELKKLDYISDAAFVGLINLRYLNLGMCGL 189          
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Match: lrrc4ba (leucine-rich repeat-containing protein 4B-like [Source:NCBI gene;Acc:103034410])

HSP 1 Score: 61.6178 bits (148), Expect = 2.017e-9
Identity = 48/162 (29.63%), Postives = 76/162 (46.91%), Query Frame = 2
Query:  368 AEKRKQCICSRLETKFTRIPHDLPDFVETLEVKNQNIHSLTADQLVKVGWLEDLNLDSNKLSSIEFDAFNNVPKLKTLSLKSNFLILGGNSFPSAAXXXXXXXXXXXXXNNPLGFVPDFFFQPLKFLTKLILSRATNGFYLEPNSLVGLTSLEYLDISASHL 853
            + +  + IC+R       +P ++ +    L ++  +I  + +D    +  LE L L  N++  IE  AFN +P L TL L  N L L     PS A   L  L+ L L NNP+  +P + F  +  L +L L       Y+   + VGL +L YL++    L
Sbjct:   47 SNQASRVICTR--QSLDEVPENISNNTRYLNLQENSIQVIRSDTFKHLRHLEILQLSKNQIRQIEVGAFNGLPNLNTLELFDNRLTL----VPSQAFEYLSKLRELWLRNNPIETLPGYAFHRVPSLRRLDLGELKKLDYISDAAFVGLINLRYLNLGMCGL 202          
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Match: lrrc4ba (leucine-rich repeat-containing protein 4B-like [Source:NCBI gene;Acc:103034410])

HSP 1 Score: 61.6178 bits (148), Expect = 2.017e-9
Identity = 48/162 (29.63%), Postives = 76/162 (46.91%), Query Frame = 2
Query:  368 AEKRKQCICSRLETKFTRIPHDLPDFVETLEVKNQNIHSLTADQLVKVGWLEDLNLDSNKLSSIEFDAFNNVPKLKTLSLKSNFLILGGNSFPSAAXXXXXXXXXXXXXNNPLGFVPDFFFQPLKFLTKLILSRATNGFYLEPNSLVGLTSLEYLDISASHL 853
            + +  + IC+R       +P ++ +    L ++  +I  + +D    +  LE L L  N++  IE  AFN +P L TL L  N L L     PS A   L  L+ L L NNP+  +P + F  +  L +L L       Y+   + VGL +L YL++    L
Sbjct:   47 SNQASRVICTR--QSLDEVPENISNNTRYLNLQENSIQVIRSDTFKHLRHLEILQLSKNQIRQIEVGAFNGLPNLNTLELFDNRLTL----VPSQAFEYLSKLRELWLRNNPIETLPGYAFHRVPSLRRLDLGELKKLDYISDAAFVGLINLRYLNLGMCGL 202          
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Match: lingo1b (leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1-B [Source:NCBI gene;Acc:103044004])

HSP 1 Score: 60.077 bits (144), Expect = 5.984e-9
Identity = 46/196 (23.47%), Postives = 83/196 (42.35%), Query Frame = 2
Query:  788 LEPNSLVGLTSLEYLDISASHLTALDRQIHSALNNMQLTDFYFFGNQWTCDCNXXXXXXXXXXXXDVRIFKKFSRSNGQSALLQPQCFSPHKFQGYNIFEFSTEYDTIKPEQLNCPPKIFTKNQQIQ--IDQGKNLTLMCEFEADPGGTVEWSKNGMRVQRHWKKTKWGQTSGMRFTAWLSITRTDLEDNGLWRCI 1369
            +EP S  GL  L+ L++S + L+ L+  +  ++ N++    Y   N+  CDC L+W            +F++  R N      QP C +P   QG    +FS   D +      C P     ++ +   +D+G  +  +C+ E DP   + W       ++ +   K      +     L +    ++DNG + CI
Sbjct:  328 IEPYSFRGLNYLKVLNVSNNRLSTLEESVFHSVGNLETLGLY--SNRLACDCRLRW------------VFRRRLRLNFNKQ--QPSCETPEFVQGQEFKDFS---DNLPANLFVCQPSKILDHKALHRFVDEGTTVNFVCKAEGDPAPVIMWQNP----KKQFITVKSVGRLSVSQDGTLEVRYAQIQDNGTYTCI 500          

HSP 2 Score: 51.2174 bits (121), Expect = 3.129e-6
Identity = 52/197 (26.40%), Postives = 93/197 (47.21%), Query Frame = 2
Query:  332 SESVVGCVTIMIAEKRKQCI-CSRLETKFTRIPHDLPDFVETLEVKNQNIHSLTADQLVKVGWLEDLNLDSNKLSSIEFDAFNNVPKLKTLSLKSNFLILGGNSFPSAAXXXXXXXXXXXXXNNPLGFVPDFFFQPLKFLTKLILSRATNGFYLEPNSLVGLTSLEYLDISASHLTALDRQIHSALNNMQLTDFYFF 919
            S S  GC +      +++ + C R   K   +P  +P     L++    + ++  ++ +    LE+L L+ N +S IE  AF+N+  L+TL L++N L L            L +L  LD+  N +  + D+ FQ L  L +L +    +  ++   +  GLTSLE L +   +LT +     S L+N+ +   + F
Sbjct:   38 SGSATGCPSRCECSAQERSVQCHR--RKLITLPEGIPIETRLLDLSKNRLKAINPEEFINYPHLEELQLNENVISVIEPGAFSNLFGLRTLGLRNNKLKL----IQLGVFTGLSNLTRLDISENKIVILLDYVFQDLYNLKELEVGDH-DLVFISSRAFHGLTSLEQLTMERCNLTTVPTDALSHLHNLLVLKLWNF 227          
BLAST of Ig-like domain-containing protein vs. Ensembl Sea Lamprey
Match: LINGO2 (leucine rich repeat and Ig domain containing 2 [Source:HGNC Symbol;Acc:HGNC:21207])

HSP 1 Score: 63.1586 bits (152), Expect = 1.335e-10
Identity = 91/365 (24.93%), Postives = 147/365 (40.27%), Query Frame = 2
Query:  446 VETLEVKNQNIHSLTADQLVKVGWLEDLNLDSNKLSSIEFDAFNNVPKLKTLSLKSNFLI--LGGNSF------------------PSAAXXXXXXXXXXXXXNNPLGFVPDFFFQPLKFLTKLILSRATNGFYLEPNSLVGLTSLEYLDISASHLTALDRQIHSALNNMQLTDFYFF-GNQWTCDCNXXXXXXXXXXXXDVRIFKKFSRSNGQS-ALLQPQCFSPHKFQGYNIFEFSTEYDTIKPEQLNCP-PKIF-TKNQQIQIDQGKNLTLMCEFEADPGGTVEWSKNGMRVQRHWKKTKWGQTSGMRFTAW----LSITRTDLEDNGLWRCIL--ITDTQSANATYSLRVRPSFPPHIDLT 1450
            +  L ++  N+ ++  + L ++  L  L L    +++++  AF  +P+L++L +    L+  LG  SF                  P  AL  L HL+ LDL  N +  V    F  L  L +L + R T    +EP +L G+  L  L++S + L  L+     AL++  L +     GN   CDC              +      +R  G S    +P C +P    G    EF+   + +    L C  P+I   + QQ+   +G+ + LMC  + DP   V W          WK+    + S  R        L I R  + D G + C+     D  SA    S+R     P +I+ T
Sbjct:  196 LRELALERCNLTAVPTEALAQLHGLSSLRLRHLGIAAVKPHAFQRLPRLRSLEIDHWPLLETLGAGSFSSLNLTSLSVTNTNITRVPRLALQTLVHLRTLDLSFNAIASVEAGAFATLTRLRELRMER-TGLLVVEPRALQGVEQLGLLNLSGNGLRTLE---EGALDSPGLLEVLRLDGNPLACDCR-------------LLWVVALNRRGGLSFDGREPSCDAPESVSGA---EFADLPEPLPKGYLACRRPRISPRRTQQLTAVEGQAVHLMCRADGDPAPDVAWLAP-------WKQRVTPRRSTGRLAVLHDGTLLIRRAQVSDGGPYVCVASNAGDNDSARTLLSVRGLSPQPLYINET 533          
BLAST of Ig-like domain-containing protein vs. Ensembl Sea Lamprey
Match: lingo4b (leucine rich repeat and Ig domain containing 4b [Source:ZFIN;Acc:ZDB-GENE-091214-3])

HSP 1 Score: 59.6918 bits (143), Expect = 1.910e-9
Identity = 81/347 (23.34%), Postives = 143/347 (41.21%), Query Frame = 2
Query:  446 VETLEVKNQNIHSLTADQLVKVGWLEDLNLDSNKLSSIEFDAFNNVPKLKTLSLKS-NFL-------ILGGN------------SFPSAAXXXXXXXXXXXXXNNPLGFVPDFFFQPLKFLTKLILSRATNGFYLEPNSLVGLTSLEYLDISASHLTALDRQIHSALNNMQLTDFYFFGNQWTCDCNXXXXXXXXXXXXDVRIFKKFSRSNGQSALLQPQCFSPHKFQGYNIFEFSTEYDTIKPEQLNCP-PKIFTKN-QQIQIDQGKNLTLMCEFEADPGGTVEWSKNGMRVQRHWKKTKWGQTSGMRFTAWLSITRTDLEDNGLWRCILITDTQSANATYSLRVR 1420
            +E L ++  N+  +  D L+ +  L+ L L    ++SI   +F  + +LK L +    +L       + G N            +FP AA+  L +L+ L+L +NPLG +       L  LT+L +S A     +EP +  GL  L  L+ S + LT L+  +  AL N+ +      GN   CDC L W+ +           ++    +G     QP C +P    G  + +F    + + P    C   +I  K  +   + +G ++   C+ E DP   + W     +V       +   T+       + +     +D G + C+      + + T +L VR
Sbjct:  190 LEQLTLEKYNLTVVPRDSLMHLHRLKVLRLKYMNINSIPPYSFKRLVRLKILEIDHWPYLSRLPPKSLYGLNLTSLSVTHCNLTTFPHAAMHHLVYLRYLNLSHNPLGVIEAHALSDLVRLTELHVSNA-QLLAIEPQAFSGLLHLRVLNTSGNLLTTLEENVFQALGNLDV--LRLDGNPLACDCRLLWILRR----------RRRLNFDGH----QPICATPDYVHGQELKDFP---EILLPNHFTCQRARIREKEPEHYIVMEGHSVRFPCQAEGDPTPRIHWVSPQRKVLLSRSVGRLLVTAD----GSIEVRYAQTQDGGTYTCVATNAGGTDSYTVTLFVR 512          
BLAST of Ig-like domain-containing protein vs. Ensembl Sea Lamprey
Match: lrrn1 (leucine rich repeat neuronal 1 [Source:ZFIN;Acc:ZDB-GENE-071126-1])

HSP 1 Score: 58.5362 bits (140), Expect = 3.185e-9
Identity = 75/338 (22.19%), Postives = 130/338 (38.46%), Query Frame = 2
Query:  446 VETLEVKNQNIHSLTADQLVKVGWLEDLNLDSNKLSSIEFDAFNNVPKLKTLSLKSN-FLILGGNSFPSAAXXXXXXXXXXXXXNNPLGFVP--DFFFQPLKFLTKLILSRATNGFYLEPNSLVGLTSLEYLDISASHLTALDRQIHSALNNMQLTDFYFFGNQWTCDCNXXXXXXXXXXXXDVRIFKKFSRSNGQSALLQPQ---CFSPHKFQGYNIFEFSTEYDTIKPEQLNCPPKIFTKN--QQIQIDQGKNLTLMCEFEADPGGTVEW-SKNGMRVQRHWKKTKWGQTSGMRFTAWLSITRTDLEDNGLWRCILITDTQSANATYSLRVRPSFP 1432
            + +L +    + ++  + L+ +  LE L+   NKL+++   A   VP LK L L  N   ++    F S               NN +  V         L  LTKL ++      ++ P+SL  +  LE L ++ + L+AL R+   AL N++  + +  GN   CDC                I +  + +  +   ++PQ   C SP + +G  +    +  D        C P I           D G  L+ +C   A+P   + W + +G  V       K+  +        L I     ED GL+ C+        +   +++V  S P
Sbjct:  134 LRSLVLAGMGLRAVPENALMGLDNLESLSFYDNKLAAVPRLALRKVPSLKFLDLNKNPVAVIREGDFRS------MLQLKELGVNNMMELVAIDRHALDDLPQLTKLEVTNNPRLSFVHPDSLRAIPRLETLMLNNNDLSALHRRTVDALPNLREVNLH--GNPIRCDC----------------IVRWMTGNATRVRFMEPQSTRCVSPAEHEGSPVRSVPSS-DVAD----GCLPAIAHGAFPSGATADPGATLSFVCRAVAEPPADIYWVTPSGDSVAPGGASDKYRLSE----EGTLEILDVRYEDTGLYTCVARNSEGLDSRAVTVQVNGSVP 438          
BLAST of Ig-like domain-containing protein vs. Ensembl Sea Lamprey
Match: LINGO2 (leucine rich repeat and Ig domain containing 2 [Source:HGNC Symbol;Acc:HGNC:21207])

HSP 1 Score: 55.0694 bits (131), Expect = 4.798e-8
Identity = 82/335 (24.48%), Postives = 142/335 (42.39%), Query Frame = 2
Query:  446 VETLEVKNQNIHSLTADQLVKVGWLEDLNLDSNKLSSIEFDAFNNVPKLKTLSLKSNFLI--LGGNSF------------------PSAAXXXXXXXXXXXXXNNPLGFVPDFFFQPLKFLTKL--ILSRATNGFYLEPNSLVGLTSLEYLDISASHLTALDRQIHSALNNMQLTDFYFFGNQWTCDCNXXXXXXXXXXXXDVRIFKKFSRSNGQSALLQPQCFSPHKFQGYNIFEFSTEYDTIKPEQLNC--PPKIFTKNQQIQIDQGKNLTLMCEFEADPGGTVEWSKNGMRVQRHWKKTKWGQTSGMRFT---AWLSITRTDLEDNGLWRCI 1369
            +E L ++  N+ SL  + L  +G L  L L    ++SI   +F  + +LK L L    ++  L  NS                   P +AL  L +L++L+L  N +  V    FQ L  L +L   +SR T    ++P + +GL+ L  L++S + L +L+     + +++Q+       N   CDC L W+ +           ++   + G+    QP C SP   +G    +F  E   + P   +C  P     K QQ+   + + + L C+ E DP  ++ W          WK+    Q++G         L I    + D+G + C+
Sbjct:  188 LEQLTLEKCNLTSLPTEALSHLGSLSTLRLRHLNIASILPFSFRRLLRLKVLELSHWPMLEELPMNSLYALNLTALSITFTNITTIPQSALQPLVNLRLLNLSYNQIRVVEAGAFQNLIRLQELHVAVSRLTT---IKPQAFIGLSKLRVLNVSKNLLQSLEESAFQSTSSLQVLGLD--SNPLACDCRLLWVVR-----------RRRRLALGER---QPSCESPEHVKGMAFGDFPEE---MSPYYFSCKKPWITVQKPQQVATAESQTVLLPCQAEGDPQPSIMWVSP-------WKQKITAQSNGRMAVLPDGTLQIRYAQILDSGTYVCV 493          

HSP 2 Score: 53.5286 bits (127), Expect = 1.531e-7
Identity = 52/173 (30.06%), Postives = 90/173 (52.02%), Query Frame = 2
Query:  377 RKQCICSRLETKFTRIPHDLPDFVETLEVKNQNIHSLTADQLVKVGWLEDLNLDSNKLSSIEFDAFNNVPKLKTLSLKSNFLILGGNSFPSAAXXXXXXXXXXXXXNNPLGFVPDFFFQPLKFLTKLILSRATNGFYLEPNSLVGLTSLEYLDISASHLTALDRQIHSALNNM 895
            +K  +C R   +   IP  +P   ++L++    + SL  D       LE+L ++ N +++IE  AFNN+P L++LSL++N L L     P     +L +L  LD+  N +  + D+ FQ L+ L +L +       Y+  ++  GL SLE L +   +LT+L  +  S L ++
Sbjct:   47 QKSVVCHR--RRMVAIPEGIPTETKSLDLSKNRLRSLDPDDFSNFLLLEELEVNENVIANIEPGAFNNLPFLRSLSLRNNRLKL----IPRGVFSRLTNLTHLDISENKIVILLDYMFQDLRNLKRLEVGD-NELVYVSHHAFKGLQSLEQLTLEKCNLTSLPTEALSHLGSL 212          
BLAST of Ig-like domain-containing protein vs. Ensembl Sea Lamprey
Match: flrt3 (fibronectin leucine rich transmembrane 3 [Source:ZFIN;Acc:ZDB-GENE-030131-1988])

HSP 1 Score: 51.9878 bits (123), Expect = 4.167e-7
Identity = 62/247 (25.10%), Postives = 98/247 (39.68%), Query Frame = 2
Query:  410 KFTRIPHDLPDFVETLEVKNQNIHSLTADQLVKVGWLEDLNLDSNKLSS--IEFDAFNNVPKLKTLSLKSNFLILGGNSFPSAAXXXXXXXXXXXXXNNPLGFVPDFFFQPLKFLTKLILSRATNGFYLEPNSLVGLTSLEYLDISASHLTALDRQIHSALNNMQLTDFYFFGNQWTCDCNXXXXXXXXXXXXDVRIFKKFSRS-----NGQSALLQPQCFSPHKFQGYNIFEFSTEYDTIKPEQLN 1129
            +   +P+DLP  +E L++++  I ++  +    +  L+ LNLD N L+S  I   +F ++ +L+ LSL +N L      FP                                 L KL L    N   +  NS + L +L YLD+S +H+ +L  +  S LNN++        N W CD             + + + K F  +     NG        C  PH  +G         Y  I+PE LN
Sbjct:  161 QLLSVPYDLPKSLEELQLESNRITTILENTFEGMVNLKHLNLDWNALTSEGIHDSSFADLVELEELSLANNLLTSPPRIFPGTN------------------------------LQKLHLQH-NNITTIPSNSFLSLHNLVYLDLSENHIQSLPVEAFSGLNNLK--QLTLQNNPWLCD-------------RKLLLLKDFLETSTVHVNGFI------CNEPHYLKGET-------YKAIRPEMLN 348          
BLAST of Ig-like domain-containing protein vs. Ensembl Nematostella
Match: EDO48179 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RK32])

HSP 1 Score: 50.447 bits (119), Expect = 2.805e-6
Identity = 65/294 (22.11%), Postives = 124/294 (42.18%), Query Frame = 2
Query:  518 LEDLNLDSNKLSSIEFDAFNNVPKLKTLSLKSNFLILGGNSFPSAAXXXXXXXXXXXXXNNPLGFVPDFFFQPLKFLTKLILSRATNG--FYLEPNSLVGLTSLEYLDISASHLTALDRQIHSALNNMQLTDFYFFGNQWTCDCNXXXXXXXXXXXXDVRIFKKFSRSNGQSA-LLQPQCFSPHKFQGYNIFEFSTEYDTIKPEQLNCPPKIFTKNQQIQIDQGKNLTLMCEFEA----DPGGTVEWSKNGMRVQRHWKKTKWGQTSG---MRFTAWLSITRTDLEDNGLWRCI 1369
            L  LNL+ N+LS I+   F ++  LK L+L +N +          +   L+ L+ LDL NN + +  +    P + LT L   R        +   + +GL +++YL++SA+ +T++       ++ +Q    +   +Q  CDC              ++ F  + RS   +   ++ +C  P      ++F  +   D    +  N  P+I       +  +G N+TL C  +          ++W + G  V      T + +T     + + + L +   D  D GL++CI
Sbjct:  348 LRKLNLERNRLSHIQDTTFKHLLALKVLNLANNRIY----HISQGSFSDLRSLEGLDLSNNDISWTVEEMNGPFRGLTNLASLRLDGNRITAIAATAFLGLENIKYLNLSANIITSIQENSFQGMDKLQ--KLWLNTSQLMCDCK-------------IKWFGSWLRSRPSTRHTVRARCLHPQTLYMKSVFNITP--DAFVCDTSNPIPQISVHPPSQKAMRGDNVTLRCRVQVVQRNSSSVRLQW-RLGYEVISERDITDFVRTDDDDIVTYNSDLFLISVDFSDAGLYQCI 619          
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Match: lingo2b (leucine rich repeat and Ig domain containing 2b [Source:ZFIN;Acc:ZDB-GENE-080723-57])

HSP 1 Score: 65.855 bits (159), Expect = 3.959e-11
Identity = 62/227 (27.31%), Postives = 100/227 (44.05%), Query Frame = 2
Query:  410 KFTRIPHDLPDFVETLEVKNQNIHSLTADQLVKVGWLEDLNLDSNKLSSIEFDAFNNVPKLKTLSLKSNFLILGGNSFPSAAXXXXXXXXXXXXXNNPLGFVPDFFFQPLKFLTKLILSRATNGFYLEPNSLVGLTSLEYLDISASHLTALDRQIHSALNNMQLTDFYFFGNQWTCDCNXXXXXXXXXXXXDVRIFKKFSRSNGQSALLQPQCFSPHKFQGYNIFEF 1090
            +   IP  +P     L++    +  +T D       LEDL+L  N +S++E  +F     L++LS +SN L       P   L  L +L  LDL +N L  +       L +L +L L  A     +EP + VGL SL+ LD+S + L +L+R + ++ + +Q       GN   CDC L            + +       + Q   +QP+C +P    G  + E 
Sbjct:   53 RLPSIPEGIPIETRMLDLSKNKLRIITPDNFSSFLQLEDLDLSDNLISAVEPGSFRFQLALRSLSFRSNVL----QMVPPGVLSGLTNLTYLDLSHNRLVHIHQGVLGQLPYLMELRLQGA-QLVSIEPFAFVGLKSLQLLDVSQNRLDSLERAVFASPDTLQ--RLCLGGNPLVCDCRL------------LWLLSSHKPPSLQILDMQPECSAPKHLMGKILREL 260          
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Match: lingo4b (leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1 [Source:NCBI gene;Acc:101164675])

HSP 1 Score: 61.6178 bits (148), Expect = 1.954e-9
Identity = 82/350 (23.43%), Postives = 154/350 (44.00%), Query Frame = 2
Query:  446 VETLEVKNQNIHSLTADQLVKVGWLEDLNLDSNKLSSIEFDAFNNVPKLKTL---------SLKSNFLILGGN------------SFPSAAXXXXXXXXXXXXXNNPLGFVPDFFFQPLKFLTKLILSRATNGFYLEPNSLVGLTSLEYLDISASHLTALDRQIHSALNNMQLTDFYFFGNQWTCDCNXXXXXXXXXXXXDVRIFKKFSRSNGQSALLQPQCFSPHKFQGYNIFEFSTEYDTIKPEQLNC-PPKIFTKN-QQIQIDQGKNLTLMCEFEADPGGTVEWSKNGMRVQRHWKKTKWGQTSGMRFT--AWLSITRTDLEDNGLWRCILITDTQSANATYSLRVR 1420
            ++ L +   N+ S+  + L ++  L  + +    +SS+  +AF  +P+L+TL         ++ SN LI G N            + P AAL  L +L+ LDL  NP+  +       L  L +L L+ A+    +EP +  GL+    L+++++ LT L+     ++ N+Q+      GN   CDC L            + + ++  R N      QP C SP   Q     +FS E + ++     C P +I  +  Q+ ++++G  +   C+ + DP  T+ W      +  H  K     T  +R      L +    ++D+G ++C+ +    + + +  L V+
Sbjct:  179 LQELNLDRSNLTSIPTEALTQLQSLTVIRMFRLTISSLPNNAFRRLPRLRTLQILNWPALDTIASNSLI-GLNLTSLTISSCNLTAVPYAALRHLVYLRFLDLSYNPITVIQGNLLGDLLRLQELHLAGASL-LRIEPGAFKGLSFFRMLNVTSNMLTTLEESAFHSVGNLQV--LRLDGNPLACDCRL------------LWVMRRRQRLNFDGH--QPTCSSPDAVQQREFRDFS-EKELVR--LFTCRPARIMDRRPQEARVEEGTTVLFSCKADGDPFPTITW------ISSH--KNTVSPTGRIRVLPNGTLEVRFAQVQDSGTYQCLAVNAAGNDSMSVGLYVK 499          
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Match: lingo4b (leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1 [Source:NCBI gene;Acc:101164675])

HSP 1 Score: 61.6178 bits (148), Expect = 1.954e-9
Identity = 82/350 (23.43%), Postives = 154/350 (44.00%), Query Frame = 2
Query:  446 VETLEVKNQNIHSLTADQLVKVGWLEDLNLDSNKLSSIEFDAFNNVPKLKTL---------SLKSNFLILGGN------------SFPSAAXXXXXXXXXXXXXNNPLGFVPDFFFQPLKFLTKLILSRATNGFYLEPNSLVGLTSLEYLDISASHLTALDRQIHSALNNMQLTDFYFFGNQWTCDCNXXXXXXXXXXXXDVRIFKKFSRSNGQSALLQPQCFSPHKFQGYNIFEFSTEYDTIKPEQLNC-PPKIFTKN-QQIQIDQGKNLTLMCEFEADPGGTVEWSKNGMRVQRHWKKTKWGQTSGMRFT--AWLSITRTDLEDNGLWRCILITDTQSANATYSLRVR 1420
            ++ L +   N+ S+  + L ++  L  + +    +SS+  +AF  +P+L+TL         ++ SN LI G N            + P AAL  L +L+ LDL  NP+  +       L  L +L L+ A+    +EP +  GL+    L+++++ LT L+     ++ N+Q+      GN   CDC L            + + ++  R N      QP C SP   Q     +FS E + ++     C P +I  +  Q+ ++++G  +   C+ + DP  T+ W      +  H  K     T  +R      L +    ++D+G ++C+ +    + + +  L V+
Sbjct:  179 LQELNLDRSNLTSIPTEALTQLQSLTVIRMFRLTISSLPNNAFRRLPRLRTLQILNWPALDTIASNSLI-GLNLTSLTISSCNLTAVPYAALRHLVYLRFLDLSYNPITVIQGNLLGDLLRLQELHLAGASL-LRIEPGAFKGLSFFRMLNVTSNMLTTLEESAFHSVGNLQV--LRLDGNPLACDCRL------------LWVMRRRQRLNFDGH--QPTCSSPDAVQQREFRDFS-EKELVR--LFTCRPARIMDRRPQEARVEEGTTVLFSCKADGDPFPTITW------ISSH--KNTVSPTGRIRVLPNGTLEVRFAQVQDSGTYQCLAVNAAGNDSMSVGLYVK 499          
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Match: lingo1a (leucine rich repeat and Ig domain containing 1a [Source:ZFIN;Acc:ZDB-GENE-080327-16])

HSP 1 Score: 60.077 bits (144), Expect = 5.999e-9
Identity = 50/196 (25.51%), Postives = 81/196 (41.33%), Query Frame = 2
Query:  788 LEPNSLVGLTSLEYLDISASHLTALDRQIHSALNNMQLTDFYFFGNQWTCDCNXXXXXXXXXXXXDVRIFKKFSRSNGQSALLQPQCFSPHKFQGYNIFEFSTEYDTIKPEQLNCPPKIFT--KNQQIQIDQGKNLTLMCEFEADPGGTVEWSKNGMRVQRHWKKTKWGQTSGMRFTAWLSITRTDLEDNGLWRCI 1369
            +EP S  GL  L+ L++S + L+ L+     ++ N++    Y   N   CDC L            + +F++  R N      QP C SP   QG    EF    D ++P    C        K QQ  +D+G  +   C+ + DP   + W    +  Q+ +  TK      +     L +    ++DNG + CI
Sbjct:  326 IEPYSFRGLNYLKILNVSGNTLSTLEESAFHSVGNLETLALY--DNPLACDCRL------------LWVFRRRWRLNFNKQ--QPTCASPEFVQGK---EFKDFPDVLQPNYFTCRKSRIRDRKPQQKFVDEGAIVHFACQADGDPAPVIMW----LSPQKKFITTKTIGRLSVLPDGTLEVRYAQIQDNGTYVCI 498          

HSP 2 Score: 57.3806 bits (137), Expect = 3.816e-8
Identity = 48/169 (28.40%), Postives = 82/169 (48.52%), Query Frame = 2
Query:  389 ICSRLETKFTRIPHDLPDFVETLEVKNQNIHSLTADQLVKVGWLEDLNLDSNKLSSIEFDAFNNVPKLKTLSLKSNFLILGGNSFPSAAXXXXXXXXXXXXXNNPLGFVPDFFFQPLKFLTKLILSRATNGFYLEPNSLVGLTSLEYLDISASHLTALDRQIHSALNNM 895
            +C R   K   +P  +P     L++    I ++  D+      LE L L  N +S+IE  AFNN+P L+TL L+SN L L            L +L  LD+  N +  + D+ FQ L  L  L +    +  ++   +  GL+ LE+L +   +L+++  +  + L+N+
Sbjct:   56 LCHR--KKLMSVPEGIPPDTRLLDLSKNRIRTINPDEFANFLSLEHLELSENTISTIEPGAFNNLPGLRTLGLRSNKLKL----IQLGVFTGLSNLTELDISENKIVILLDYMFQDLYNLRSLEVG-DNDLVFISHRAFHGLSGLEHLSLEKCNLSSVPTEAFTHLHNL 217          
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Match: lingo1a (leucine rich repeat and Ig domain containing 1a [Source:ZFIN;Acc:ZDB-GENE-080327-16])

HSP 1 Score: 60.077 bits (144), Expect = 6.384e-9
Identity = 50/196 (25.51%), Postives = 81/196 (41.33%), Query Frame = 2
Query:  788 LEPNSLVGLTSLEYLDISASHLTALDRQIHSALNNMQLTDFYFFGNQWTCDCNXXXXXXXXXXXXDVRIFKKFSRSNGQSALLQPQCFSPHKFQGYNIFEFSTEYDTIKPEQLNCPPKIFT--KNQQIQIDQGKNLTLMCEFEADPGGTVEWSKNGMRVQRHWKKTKWGQTSGMRFTAWLSITRTDLEDNGLWRCI 1369
            +EP S  GL  L+ L++S + L+ L+     ++ N++    Y   N   CDC L            + +F++  R N      QP C SP   QG    EF    D ++P    C        K QQ  +D+G  +   C+ + DP   + W    +  Q+ +  TK      +     L +    ++DNG + CI
Sbjct:  337 IEPYSFRGLNYLKILNVSGNTLSTLEESAFHSVGNLETLALY--DNPLACDCRL------------LWVFRRRWRLNFNKQ--QPTCASPEFVQGK---EFKDFPDVLQPNYFTCRKSRIRDRKPQQKFVDEGAIVHFACQADGDPAPVIMW----LSPQKKFITTKTIGRLSVLPDGTLEVRYAQIQDNGTYVCI 509          

HSP 2 Score: 57.3806 bits (137), Expect = 4.778e-8
Identity = 48/169 (28.40%), Postives = 82/169 (48.52%), Query Frame = 2
Query:  389 ICSRLETKFTRIPHDLPDFVETLEVKNQNIHSLTADQLVKVGWLEDLNLDSNKLSSIEFDAFNNVPKLKTLSLKSNFLILGGNSFPSAAXXXXXXXXXXXXXNNPLGFVPDFFFQPLKFLTKLILSRATNGFYLEPNSLVGLTSLEYLDISASHLTALDRQIHSALNNM 895
            +C R   K   +P  +P     L++    I ++  D+      LE L L  N +S+IE  AFNN+P L+TL L+SN L L            L +L  LD+  N +  + D+ FQ L  L  L +    +  ++   +  GL+ LE+L +   +L+++  +  + L+N+
Sbjct:   67 LCHR--KKLMSVPEGIPPDTRLLDLSKNRIRTINPDEFANFLSLEHLELSENTISTIEPGAFNNLPGLRTLGLRSNKLKL----IQLGVFTGLSNLTELDISENKIVILLDYMFQDLYNLRSLEVGD-NDLVFISHRAFHGLSGLEHLSLEKCNLSSVPTEAFTHLHNL 228          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000058478.1 (SMESG000058478.1)

HSP 1 Score: 1177.16 bits (3044), Expect = 0.000e+0
Identity = 632/632 (100.00%), Postives = 632/632 (100.00%), Query Frame = 2
Query:  263 MPILKFSQFXXXXXXXXXXXXKYSESVVGCVTIMIAEKRKQCICSRLETKFTRIPHDLPDFVETLEVKNQNIHSLTADQLVKVGWLEDLNLDSNKLSSIEFDAFNNVPKLKTLSLKSNFLILGGNSFPSAAXXXXXXXXXXXXXNNPLGFVPDFFFQPLKFLTKLILSRATNGFYLEPNSLVGLTSLEYLDISASHLTALDRQIHSALNNMQLTDFYFFGNQWTCDCNXXXXXXXXXXXXDVRIFKKFSRSNGQSALLQPQCFSPHKFQGYNIFEFSTEYDTIKPEQLNCPPKIFTKNQQIQIDQGKNLTLMCEFEADPGGTVEWSKNGMRVQRHWKKTKWGQTSGMRFTAWLSITRTDLEDNGLWRCILITDTQSANATYSLRVRPSFPPHIDLTIILKYXXXXXXXXXXXXXXXXXXXYCVYGFRIRPFIKQGKGSTASHSQPDRSIRPTRLDGENHHCESNSIRPLTVNALVNKDKRQTEENLKKYCNNDESQKCLLLPSSPALVIPITNQTVINNSTHIPCPLHGNINFIDHSAFTDSKQHSNMEYNNPIGFIQPHTLPRQNNRTMNRMKTNPIFITSNNQTNPNSCISCPLHGNILASIQRQNEEENDNINSIYSTFFSPRHSQPLI 2158
            MPILKFSQFSLILILGLLSLIKYSESVVGCVTIMIAEKRKQCICSRLETKFTRIPHDLPDFVETLEVKNQNIHSLTADQLVKVGWLEDLNLDSNKLSSIEFDAFNNVPKLKTLSLKSNFLILGGNSFPSAALLQLKHLKVLDLDNNPLGFVPDFFFQPLKFLTKLILSRATNGFYLEPNSLVGLTSLEYLDISASHLTALDRQIHSALNNMQLTDFYFFGNQWTCDCNLKWLKKWGLKHKDVRIFKKFSRSNGQSALLQPQCFSPHKFQGYNIFEFSTEYDTIKPEQLNCPPKIFTKNQQIQIDQGKNLTLMCEFEADPGGTVEWSKNGMRVQRHWKKTKWGQTSGMRFTAWLSITRTDLEDNGLWRCILITDTQSANATYSLRVRPSFPPHIDLTIILKYIGIGAITLILLLVIIGIAIYCVYGFRIRPFIKQGKGSTASHSQPDRSIRPTRLDGENHHCESNSIRPLTVNALVNKDKRQTEENLKKYCNNDESQKCLLLPSSPALVIPITNQTVINNSTHIPCPLHGNINFIDHSAFTDSKQHSNMEYNNPIGFIQPHTLPRQNNRTMNRMKTNPIFITSNNQTNPNSCISCPLHGNILASIQRQNEEENDNINSIYSTFFSPRHSQPLI
Sbjct:    1 MPILKFSQFSLILILGLLSLIKYSESVVGCVTIMIAEKRKQCICSRLETKFTRIPHDLPDFVETLEVKNQNIHSLTADQLVKVGWLEDLNLDSNKLSSIEFDAFNNVPKLKTLSLKSNFLILGGNSFPSAALLQLKHLKVLDLDNNPLGFVPDFFFQPLKFLTKLILSRATNGFYLEPNSLVGLTSLEYLDISASHLTALDRQIHSALNNMQLTDFYFFGNQWTCDCNLKWLKKWGLKHKDVRIFKKFSRSNGQSALLQPQCFSPHKFQGYNIFEFSTEYDTIKPEQLNCPPKIFTKNQQIQIDQGKNLTLMCEFEADPGGTVEWSKNGMRVQRHWKKTKWGQTSGMRFTAWLSITRTDLEDNGLWRCILITDTQSANATYSLRVRPSFPPHIDLTIILKYIGIGAITLILLLVIIGIAIYCVYGFRIRPFIKQGKGSTASHSQPDRSIRPTRLDGENHHCESNSIRPLTVNALVNKDKRQTEENLKKYCNNDESQKCLLLPSSPALVIPITNQTVINNSTHIPCPLHGNINFIDHSAFTDSKQHSNMEYNNPIGFIQPHTLPRQNNRTMNRMKTNPIFITSNNQTNPNSCISCPLHGNILASIQRQNEEENDNINSIYSTFFSPRHSQPLI 632          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000006317.1 (SMESG000006317.1)

HSP 1 Score: 328.561 bits (841), Expect = 1.445e-102
Identity = 231/591 (39.09%), Postives = 326/591 (55.16%), Query Frame = 2
Query:  326 KYSESVVGCVTIMIAEKRKQCICSRLETKFTRIPHDLPDFVETLEVKNQNIHSLTADQLVKVGWLEDLNLDSNKLSSIEFDAFNNVPKLKTLSLKSNFLILGGNSFPSAAXXXXXXXXXXXXXNNPLGFVPDFFFQPLKFLTKLILSRATNGFYLEPNSLVGLTSLEYLDISASHLTALDRQIHSALNNMQLTDFYFFGNQWTCDCNXXXXXXXXXXXXDVRIFKKFSRS---NGQSAL--LQPQCFSPHKFQGYNIFEFSTEYDTIKPEQLNCPPKIFTKNQQIQIDQGKNLTLMCEFEADPGGTVEWSKNGMRVQRHWKKTKWGQTSGMRFTAWLSITRTDLEDNGLWRCILITDTQSANATYSLRVRPSFPPH--IDLTIILKYXXXXXXXXXXXXXXXXXXXYCVYGFRIRPFIKQGKGSTASHSQPDRSIRPTRLDGENHHCESNSIRPLTVNALVNK---DKRQTEENLKKYCNNDESQKCLLLPSSPALVIPITNQTVINNSTHIPCPLHGNINFIDHSAFTDSKQHSNMEYNNPIGFIQPHTLPRQNNRTMNRMKTNPIFITSNNQTNPNSCISCPLHGNILA 2068
            ++  SV GC+TIM   K K  IC+  +  FTRIP   PD V  + ++NQN+  + + QL  +  L +L L+SNK++ +  +AF +VP+L +L L  N + LG NS PS++L+ LK L  LDL  NPLGFVPD++FQ LK L  L LS A  GFY+E N L GLT+L+ LD++ +H T L   +  +L  MQL +FY F N W CDCN     K       V+  K  S+    NG   +  LQP+C SP      NIF  ST  D+I    L C P+IFT+++  ++ +  N+T  CEF A+PGGTV WSKNGM VQ HW++  W ++ G++F AWL++   +  D+G WRCIL T     NAT+ L+V     P   ID   ILKY+GIGA+TLILLLV+IGI IYCVYGF+I+   +  K  +A   +   +  P + +  N+H  S   + +  N+ +     D  Q   +     N+   Q CL  P SP       +  ++N S+ I CPLHG ++      F DS   +N+E   PI    P                       ++ T P+S I CP+HG++L+
Sbjct:   25 QFGLSVQGCITIMKDSKYKMSICTNYKANFTRIPERFPDQVAEIIIENQNLSVIDSAQLKNLPNLVNLTLNSNKITKLSPNAFTHVPQLISLRLSGNQIYLGENSMPSSSLIYLKKLHTLDLSENPLGFVPDYYFQLLKQLRILNLSTANKGFYIETNGLYGLTNLQVLDLTNNHFTTLSEGLSISLKAMQLNEFYLFNNPWNCDCN-LQWLKAWFTSHKVKYTKDLSKDITINGGKIIEDLQPKCESPFPLSERNIFSDSTNTDSIGINDLKCAPRIFTQDRVYEMTKDHNITFTCEFHANPGGTVTWSKNGMIVQNHWRRVSWNRSQGIKFKAWLTLQNVEENDSGNWRCILTTHVSKVNATFLLKV---ISPQNIIDFKSILKYVGIGAVTLILLLVVIGIIIYCVYGFQIQNNRRPKKSLSAILIEEKET--PVKQNLGNYHIISKPCKEIDYNSKIIVSPIDDAQYYTSQLIESNHTFIQPCLEQPHSPF------SHYLVNGSSTI-CPLHGELSKQKSQKFDDSS--NNIEKKLPIQIPLP-----------------------DSNTVPSSSIPCPIHGDVLS 577          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000006503.1 (SMESG000006503.1)

HSP 1 Score: 133.65 bits (335), Expect = 2.106e-32
Identity = 106/377 (28.12%), Postives = 169/377 (44.83%), Query Frame = 2
Query:  392 CSRLETKFTRIPHDLPDF---------VETLEVKNQNIHSLTADQLVKVGWLEDLNLDSNKLSSIEFDAFNNVPKLKTLSLKSNFLILGGNSFPSAAXXXXXXXXXXXXXNNPLGFVPDFFFQPLKFLTKLILSRATNGFYLEPNSLVGLTSLEYLDISASHLTALDRQIHSALNNMQLTDFYFFGNQWTCDCNXXXXXXXXXXXXDVRIFKK----------FSRSNGQSALLQPQ---CFSPHKFQGYNIFEFSTEYDTIKPEQLNCPPKIFTKNQQIQIDQGKNLTLMCEFEADPGGTVEWSKNGMRVQRHWKKTKWGQTSGMRFTAWLSITRTDLE-DNGLWRCILITDTQSANATYSLRVRPSFPPHIDLTI 1453
            C R +     I +DL  F         +  L++   NI  L  D L     L +L LDSNK+  I  +AF N  KLK LSL++N LI+  N+F S+    L  L+ LDL +NP+G +P+ FF  L+ L +L L        ++  +   L +L+ L ++ ++  +L   +      MQL       N W CDC              +R FK+          +  S  ++ LL      C +P   Q   + +           +  C PK     + + +   +N+TL C+FE+ P   V+W KNG+ +Q HW + +  Q+SG  + A L+I  +    D+G + C    +  SA + Y+L ++   P H D  I
Sbjct:   21 CIRKQFSLVCIENDLITFPKSNFINKDIAILDLSKNNIRILYEDALDDFENLINLTLDSNKIWKITNNAFKNKSKLKYLSLRNNALIISNNTFLSSVFRYLIRLEYLDLSSNPIGIIPESFFLDLRNLRELYLEEMMKEIRIQKGAFSNLFNLKLLSLAKNNFLSLPNYLEYEFQEMQLETLLLHDNPWACDCR-------------MRWFKRWLITLNQNNDYLYSTIENILLNIHPMLCETPDYLQRKKLCDLPL-------SKFECKPKTLRLGKTLVVKHLENVTLSCQFESFPKSYVKWFKNGILIQDHWDRIQLSQSSGRNYVANLTIFSSKYGIDDGCYVCETTNNVGSARSNYTLIIK--IPSHKDNAI 375          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000023338.1 (SMESG000023338.1)

HSP 1 Score: 134.035 bits (336), Expect = 3.488e-32
Identity = 109/385 (28.31%), Postives = 179/385 (46.49%), Query Frame = 2
Query:  326 KYSESVVGCVTIMI--AEKRKQCICSRLETKFTRIPHDLPDFVETLEVKNQNIHSLTADQLVKVGWLEDLNLDSNKLSSIEFDAFNNVPKLKTLSLKSNFLILGGNSFPSAAXXXXXXXXXXXXXNNPLGFVPDFFFQPLKFLTKLILSRAT-NGFYLEPNSLVGLTSLEYLDISASHLTALDRQIHSALNNMQLTDFYFFG-NQWTCDCNXXXXXXXXXXXXDVRIFKKFSRSNGQSALLQPQCFSPHKFQGYNIFEFSTEYDTIKPEQLNCPPKIF-TKNQQIQIDQGKNLTLMCEFEADPGGTVEWSKNGMRVQRHWKKTKWGQTSGMRFTAWLSITRTDLEDNGLWRCILITDTQSANATYSLRVRPS--FPPHIDLTIIL 1459
            K + ++ GCV  ++     +++ +C   +++   IP+ LPD  E L +  QNI  +  +    V  L  L+L  + L  I  +AF N+  L  L L  N LIL  +S PS  +  L +LK L L NNPL  +PDFFF+PL  L KL+L+    +   +   +  GL SLE LD+  S +  +++ + S    M+       G N W CDC+   L+       +++ F      N     + P+C  P + + Y I     + +  K  +  CP K        + +D  K+L L C+  +DP   V W+KNG +V+    K +   +    F + L I      D+G W C +    Q+    ++L++ P+  FP    L + +
Sbjct:   19 KDAVAIKGCVVTLVNPTSLKRRVLCGDPKSQIELIPNPLPDATEMLIITQQNIPVIKEEDFKNVLELSTLSLTFSNLERIHRNAFKNLSYLTILDLSGNKLILNDDSLPSYLITNLVNLKHLKLTNNPLKMIPDFFFKPLSSLRKLLLNDCGFDSLRISSRAFHGLNSLEELDLRNSGIETINKTMESDFREMKPLRVLLLGENPWICDCH---LRWLYRYLGEIQEFITLQLDNK----VGPRCKQPKRLENYRIIA-GIDRNQSKYVEFVCPIKCSRVSPGNVVLDSEKSLNLTCKCFSDPIKPVIWTKNGYKVEETVNKFQIFNSGNENFYSTLHIRSLKSVDSGSWSCRVDDVFQN----FTLKINPNSIFPMAASLNVYI 391          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000075643.1 (SMESG000075643.1)

HSP 1 Score: 125.176 bits (313), Expect = 1.173e-29
Identity = 110/369 (29.81%), Postives = 180/369 (48.78%), Query Frame = 2
Query:  332 SESVVGCVTIMIAEKR--KQCICSRLETKFTRIPHDLPDFVETLEVKNQNIHSLTADQLVKVGWLEDLNLDSNKLSSIEFDAFNNVPKLKTLSLKSNFLILGG-NSFPSAAXXXXXXXXXXXXXNNPLGFVPDFFFQPL-KFLTKLILSRATNGFYLEPNSLVGLTSLEYLDISASHLTALDRQIHSALNNM-QLTDFYFFGNQWTCDCNXXXXXXXXXXXXDVRIFKKFSRSNGQSALLQPQCFSPHKFQGYNIFEFSTEYDTIKPEQLNCPPKIFTKNQQIQIDQGKNLTLMCEFEA-DPGGTVEWSKNGMRVQRHWKKTKWGQTSGMRFTAWLSITRTDLEDNGLWRCILITDTQSANATYSLRVR 1420
            S++V GC  ++ +++   K  IC+   T   RIP DL   +  LE+  QN+ SL A++   +  LE L L+S  +  I   AF ++ +L  L+L +N L++   N+  S     L  L +LDL  N +  +P  FF+ L K L  LI+S + + F + P+SL  L  LE LDIS ++L  LD    S  + M  L +    GN W CDC ++WL  W      +  F   S  +  S      C SP     +N     +    IK  +  C PK  +KN    + +G+N++L C F++ D    ++WS NG  ++ +  +    ++   R  + L++    ++ +GLWRC ++ D       +S+  R
Sbjct:   24 SDAVRGCTVMLKSDQSNFKVAICNDPSTNLERIPKDLSVNLIRLEMMYQNLTSLEANEFSHIYQLELLTLNSCGVRHISTTAFEHLSQLVILTLSNNSLVIHDINNLQSEIFQPLIGLTLLDLSFNFIQMIPKHFFRYLEKSLKVLIISNSKSPFSISPDSLSDLVRLERLDISHNNLIQLDSGFESVFSKMISLQNLILHGNPWKCDCKIRWLVFWYQHST-LGSFPAESSPSSLSHFQSALCHSPRSM--HNAILLRSISIPIKSHEFPCFPKCLSKNSDFFVGEGENVSLPCSFQSLDQYTRIKWSHNGTLLKSN-SRNYVIKSDTKRHRSVLTLIHFTIKLSGLWRCYILFDDNIIGTNFSVLFR 388          
The following BLAST results are available for this feature:
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LINGO41.981e-1024.84leucine rich repeat and Ig domain containing 4 [So... [more]
LINGO12.048e-929.65leucine rich repeat and Ig domain containing 1 [So... [more]
LINGO12.070e-929.65leucine rich repeat and Ig domain containing 1 [So... [more]
LINGO12.387e-929.65leucine rich repeat and Ig domain containing 1 [So... [more]
AP006333.15.272e-827.21fibronectin leucine rich transmembrane protein 1 [... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
slt-17.638e-623.85Slit homolog 1 protein [Source:UniProtKB/Swiss-Pr... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
kek23.154e-1222.07gene:FBgn0015400 transcript:FBtr0080252[more]
kek34.453e-1122.67gene:FBgn0028370 transcript:FBtr0300848[more]
kek34.453e-1122.67gene:FBgn0028370 transcript:FBtr0080752[more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
flrt1b9.226e-1025.70fibronectin leucine rich transmembrane protein 1b ... [more]
flrt1b9.226e-1025.70fibronectin leucine rich transmembrane protein 1b ... [more]
lrrc4ba2.022e-929.63leucine rich repeat containing 4Ba [Source:ZFIN;Ac... [more]
lrrc4ba2.022e-929.63leucine rich repeat containing 4Ba [Source:ZFIN;Ac... [more]
lrrc4ba2.671e-929.94leucine rich repeat containing 4Ba [Source:ZFIN;Ac... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
lingo19.320e-924.89leucine rich repeat and Ig domain containing 1 [So... [more]
atf31.289e-830.94activating transcription factor 3 [Source:Xenbase;... [more]
LINGO21.027e-729.55leucine rich repeat and Ig domain containing 2 [So... [more]
LRIG35.166e-721.28leucine-rich repeats and immunoglobulin like domai... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lrit27.575e-1124.20leucine-rich repeat, immunoglobulin-like and trans... [more]
Lingo49.853e-1124.84leucine rich repeat and Ig domain containing 4 [So... [more]
Lingo11.246e-929.65leucine rich repeat and Ig domain containing 1 [So... [more]
Lingo11.471e-929.65leucine rich repeat and Ig domain containing 1 [So... [more]
Lingo11.471e-929.65leucine rich repeat and Ig domain containing 1 [So... [more]
back to top
BLAST of Ig-like domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6PFC5|LRIT2_MOUSE5.298e-1024.20Leucine-rich repeat, immunoglobulin-like domain an... [more]
sp|Q149C3|LIGO4_MOUSE8.955e-1024.84Leucine-rich repeat and immunoglobulin-like domain... [more]
sp|Q6UY18|LIGO4_HUMAN9.513e-1024.84Leucine-rich repeat and immunoglobulin-like domain... [more]
sp|Q50L44|LIGO1_CHICK6.509e-929.63Leucine-rich repeat and immunoglobulin-like domain... [more]
sp|Q5RDJ4|LIGO1_PONAB9.278e-929.65Leucine-rich repeat and immunoglobulin-like domain... [more]
back to top
BLAST of Ig-like domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3P8EXC81.118e-5830.31Ig-like domain-containing protein OS=Echinostoma c... [more]
A0A504Z7761.214e-5830.53Leucine-rich repeat-containing protein 4 OS=Fascio... [more]
A0A183A8771.359e-5830.86Ig-like domain-containing protein OS=Echinostoma c... [more]
A0A2H1CPY51.552e-5730.23Immunoglobulin I-set domain protein OS=Fasciola he... [more]
A0A183VKE41.601e-5435.40Ig-like domain-containing protein OS=Trichobilharz... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lingo1a3.043e-1027.50leucine rich repeat and Ig domain containing 1 [So... [more]
lrrc4ba1.381e-929.63leucine-rich repeat-containing protein 4B-like [So... [more]
lrrc4ba2.017e-929.63leucine-rich repeat-containing protein 4B-like [So... [more]
lrrc4ba2.017e-929.63leucine-rich repeat-containing protein 4B-like [So... [more]
lingo1b5.984e-923.47leucine-rich repeat and immunoglobulin-like domain... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LINGO21.335e-1024.93leucine rich repeat and Ig domain containing 2 [So... [more]
lingo4b1.910e-923.34leucine rich repeat and Ig domain containing 4b [S... [more]
lrrn13.185e-922.19leucine rich repeat neuronal 1 [Source:ZFIN;Acc:ZD... [more]
LINGO24.798e-824.48leucine rich repeat and Ig domain containing 2 [So... [more]
flrt34.167e-725.10fibronectin leucine rich transmembrane 3 [Source:Z... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO481792.805e-622.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lingo2b3.959e-1127.31leucine rich repeat and Ig domain containing 2b [S... [more]
lingo4b1.954e-923.43leucine-rich repeat and immunoglobulin-like domain... [more]
lingo4b1.954e-923.43leucine-rich repeat and immunoglobulin-like domain... [more]
lingo1a5.999e-925.51leucine rich repeat and Ig domain containing 1a [S... [more]
lingo1a6.384e-925.51leucine rich repeat and Ig domain containing 1a [S... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000058478.10.000e+0100.00SMESG000058478.1[more]
SMESG000006317.11.445e-10239.09SMESG000006317.1[more]
SMESG000006503.12.106e-3228.12SMESG000006503.1[more]
SMESG000023338.13.488e-3228.31SMESG000023338.1[more]
SMESG000075643.11.173e-2929.81SMESG000075643.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012041 ID=SMED30012041|Name=Ig-like domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2197bp
GTTTAAAACAGTACCAATCTAGGGGATGTTGCAGTTGTTGTTATTTTTAC
TACCATTATCATTCTCGTCATCTTTATTCGGTCTAGCACAGTCACATCTG
CGACTGCTGATTAAGTGAACGTAGAACTCGAATAAGCGAGTCTGTTATTG
GCCAGTTGATGAATACATCATTACTAGGAATTATAATTTAAAAAAATAGA
ACAACTGACAGCATGGCAGATAATTTTAGAATTCGAGTTTCCTCGTAGAA
CATTCCTCTACAATGCCCATTCTAAAGTTTTCTCAATTCTCTCTGATTTT
GATTCTTGGATTATTGAGCCTGATCAAATATTCCGAATCGGTAGTCGGCT
GTGTGACAATTATGATTGCCGAAAAACGCAAGCAATGCATATGCAGTAGA
CTCGAAACCAAATTCACCAGAATTCCTCACGATTTGCCGGATTTCGTGGA
AACTCTCGAAGTGAAAAATCAGAACATTCATTCCTTGACGGCTGATCAAC
TCGTCAAGGTTGGTTGGTTGGAGGATCTGAATCTTGATTCGAACAAATTG
TCGTCGATTGAATTTGATGCATTTAATAATGTACCGAAACTGAAGACTTT
GAGTTTGAAAAGTAATTTTCTGATTCTTGGCGGAAACTCTTTTCCTTCCG
CTGCGCTGCTGCAGCTAAAACATTTAAAAGTATTAGATTTGGATAACAAT
CCTTTGGGATTTGTTCCGGATTTCTTCTTTCAACCATTAAAGTTTTTAAC
CAAGCTGATTTTATCAAGAGCGACAAACGGGTTCTATTTAGAACCAAACA
GTCTCGTTGGTTTGACTAGTTTAGAATATCTCGATATTAGTGCCAGCCAT
TTAACTGCGTTAGATAGACAAATTCATTCAGCTCTCAACAACATGCAACT
GACAGATTTCTACTTTTTCGGAAACCAATGGACCTGCGATTGCAACTTGA
AATGGTTAAAGAAATGGGGATTAAAACACAAAGATGTACGAATTTTTAAA
AAGTTCTCTCGCTCGAATGGTCAATCGGCACTCTTGCAGCCGCAATGTTT
CTCGCCGCACAAATTCCAAGGCTATAACATTTTTGAATTTTCCACCGAAT
ACGACACGATCAAACCTGAACAGTTAAATTGTCCACCAAAAATTTTTACG
AAAAATCAGCAAATTCAAATTGATCAAGGGAAAAATTTGACTTTGATGTG
TGAATTTGAAGCCGATCCTGGTGGTACTGTTGAATGGTCGAAAAATGGAA
TGCGAGTCCAAAGACATTGGAAAAAAACCAAATGGGGCCAAACTTCTGGG
ATGAGATTTACGGCATGGTTGTCAATTACTCGAACAGACCTAGAAGATAA
TGGCTTGTGGAGATGCATATTAATAACGGATACCCAGAGTGCAAACGCTA
CTTATTCTTTGAGAGTTAGACCCTCTTTTCCTCCCCACATAGACTTGACA
ATCATACTTAAATATATTGGAATAGGAGCAATAACATTAATTTTACTTCT
TGTAATCATAGGAATAGCTATTTATTGCGTTTACGGATTTAGAATAAGAC
CTTTTATCAAACAAGGAAAAGGTTCTACTGCTTCTCATTCTCAACCAGAT
CGAAGCATCAGACCAACAAGATTAGATGGTGAAAACCATCATTGTGAAAG
TAACTCAATTCGACCTTTAACTGTCAATGCCTTGGTAAATAAAGACAAAA
GACAAACTGAAGAGAATTTGAAAAAATACTGTAACAATGATGAAAGTCAA
AAATGCCTACTACTTCCTTCCTCTCCTGCTTTGGTCATTCCAATTACAAA
TCAAACTGTTATTAATAACTCAACACATATCCCATGTCCATTGCATGGGA
ACATAAATTTCATAGATCATTCTGCATTCACAGATAGTAAACAACATTCA
AACATGGAATATAACAACCCCATTGGATTTATACAACCTCACACTCTCCC
AAGACAAAACAACCGAACAATGAATAGAATGAAAACAAATCCAATTTTCA
TAACTTCTAATAACCAAACGAACCCAAATAGTTGCATTTCTTGTCCACTT
CATGGCAACATACTAGCTTCCATTCAAAGACAAAATGAGGAAGAGAATGA
CAATATCAATTCCATTTATTCAACATTCTTTTCTCCGAGGCATTCACAAC
CATTAATCAATAATAATAGCAACAACAGTAATAATAATAATAATAAT
back to top

protein sequence of SMED30012041-orf-1

>SMED30012041-orf-1 ID=SMED30012041-orf-1|Name=SMED30012041-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=645bp
MPILKFSQFSLILILGLLSLIKYSESVVGCVTIMIAEKRKQCICSRLETK
FTRIPHDLPDFVETLEVKNQNIHSLTADQLVKVGWLEDLNLDSNKLSSIE
FDAFNNVPKLKTLSLKSNFLILGGNSFPSAALLQLKHLKVLDLDNNPLGF
VPDFFFQPLKFLTKLILSRATNGFYLEPNSLVGLTSLEYLDISASHLTAL
DRQIHSALNNMQLTDFYFFGNQWTCDCNLKWLKKWGLKHKDVRIFKKFSR
SNGQSALLQPQCFSPHKFQGYNIFEFSTEYDTIKPEQLNCPPKIFTKNQQ
IQIDQGKNLTLMCEFEADPGGTVEWSKNGMRVQRHWKKTKWGQTSGMRFT
AWLSITRTDLEDNGLWRCILITDTQSANATYSLRVRPSFPPHIDLTIILK
YIGIGAITLILLLVIIGIAIYCVYGFRIRPFIKQGKGSTASHSQPDRSIR
PTRLDGENHHCESNSIRPLTVNALVNKDKRQTEENLKKYCNNDESQKCLL
LPSSPALVIPITNQTVINNSTHIPCPLHGNINFIDHSAFTDSKQHSNMEY
NNPIGFIQPHTLPRQNNRTMNRMKTNPIFITSNNQTNPNSCISCPLHGNI
LASIQRQNEEENDNINSIYSTFFSPRHSQPLINNNSNNSNNNNNN
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000103central nervous system
PLANA:0000142posterior region of the whole animal
PLANA:0000418head
PLANA:0000421tail
Vocabulary: INTERPRO
TermDefinition
IPR036179Ig-like_dom_sf
IPR003599Ig_sub
IPR003591Leu-rich_rpt_typical-subtyp
IPR013783Ig-like_fold
IPR032675LRR_dom_sf
IPR001611Leu-rich_rpt
IPR007110Ig-like_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003599Immunoglobulin subtypeSMARTSM00409IG_3ccoord: 298..386
e-value: 5.6E-4
score: 29.2
IPR003591Leucine-rich repeat, typical subtypeSMARTSM00369LRR_typ_2coord: 184..207
e-value: 54.0
score: 7.3
coord: 135..158
e-value: 0.14
score: 21.3
coord: 83..106
e-value: 12.0
score: 12.5
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 121..280
e-value: 9.9E-25
score: 88.3
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 29..120
e-value: 3.5E-13
score: 51.2
IPR001611Leucine-rich repeatPFAMPF13855LRR_8coord: 137..197
e-value: 1.6E-8
score: 34.2
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 137..158
score: 7.373
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 186..207
score: 4.57
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 85..106
score: 7.196
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 288..393
e-value: 2.2E-13
score: 52.2
NoneNo IPR availablePFAMPF13927Ig_3coord: 291..369
e-value: 3.9E-8
score: 33.8
NoneNo IPR availablePANTHERPTHR45842FAMILY NOT NAMEDcoord: 24..546
NoneNo IPR availableCDDcd00096Igcoord: 309..382
e-value: 2.31426E-5
score: 40.6885
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..26
score: 0.842
NoneNo IPR availableSUPERFAMILYSSF52058L domain-likecoord: 49..283
NoneNo IPR availableTMHMMTMhelixcoord: 404..426
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 292..384
score: 10.989
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 290..386