SMED30012024

Overview
NameSMED30012024
Smed IDSMED30012024
Length (bp)396
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30012024 (SMED30012024) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30012024 (SMED30012024) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30012024 (SMED30012024) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30012024 (SMED30012024) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012024

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
prepharyngeal regionSMED30012024h1SMcG0015672 SmedASXL_007863SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
X1 cellSMED30012024h1SMcG0015672 SmedASXL_007863SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
zeta neoblastSMED30012024h1SMcG0015672 dd_Smed_v4_13504_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30012024 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000252:84916..85347 +1888
Homology
BLAST of SMED30012024 vs. Ensembl Human
Match: CBFA2T2 (CBFA2/RUNX1 partner transcriptional co-repressor 2 [Source:HGNC Symbol;Acc:HGNC:1536])

HSP 1 Score: 48.1358 bits (113), Expect = 8.136e-7
Identity = 22/60 (36.67%), Postives = 28/60 (46.67%), Query Frame = 1
Query:   22 ECHEQCCYCGQNTIKECSGCGWAFYCSRECQEKHWCIHRFFCQQGYEREFPKLEGMNIVP 201
            E  E C  CG+   + CSGC  A YC   CQ K W  H   C Q    + P  +G  ++P
Sbjct:  512 ESTENCWNCGRKASETCSGCNIARYCGSFCQHKDWERHHRLCGQNLHGQSPHGQGRPLLP 571          
BLAST of SMED30012024 vs. Ensembl Human
Match: CBFA2T2 (CBFA2/RUNX1 partner transcriptional co-repressor 2 [Source:HGNC Symbol;Acc:HGNC:1536])

HSP 1 Score: 47.7506 bits (112), Expect = 9.919e-7
Identity = 22/60 (36.67%), Postives = 28/60 (46.67%), Query Frame = 1
Query:   22 ECHEQCCYCGQNTIKECSGCGWAFYCSRECQEKHWCIHRFFCQQGYEREFPKLEGMNIVP 201
            E  E C  CG+   + CSGC  A YC   CQ K W  H   C Q    + P  +G  ++P
Sbjct:  493 ESTENCWNCGRKASETCSGCNIARYCGSFCQHKDWERHHRLCGQNLHGQSPHGQGRPLLP 552          
BLAST of SMED30012024 vs. Ensembl Human
Match: CBFA2T2 (CBFA2/RUNX1 partner transcriptional co-repressor 2 [Source:HGNC Symbol;Acc:HGNC:1536])

HSP 1 Score: 47.7506 bits (112), Expect = 1.004e-6
Identity = 22/60 (36.67%), Postives = 28/60 (46.67%), Query Frame = 1
Query:   22 ECHEQCCYCGQNTIKECSGCGWAFYCSRECQEKHWCIHRFFCQQGYEREFPKLEGMNIVP 201
            E  E C  CG+   + CSGC  A YC   CQ K W  H   C Q    + P  +G  ++P
Sbjct:  502 ESTENCWNCGRKASETCSGCNIARYCGSFCQHKDWERHHRLCGQNLHGQSPHGQGRPLLP 561          
BLAST of SMED30012024 vs. Ensembl Human
Match: CBFA2T2 (CBFA2/RUNX1 partner transcriptional co-repressor 2 [Source:HGNC Symbol;Acc:HGNC:1536])

HSP 1 Score: 47.7506 bits (112), Expect = 1.004e-6
Identity = 22/60 (36.67%), Postives = 28/60 (46.67%), Query Frame = 1
Query:   22 ECHEQCCYCGQNTIKECSGCGWAFYCSRECQEKHWCIHRFFCQQGYEREFPKLEGMNIVP 201
            E  E C  CG+   + CSGC  A YC   CQ K W  H   C Q    + P  +G  ++P
Sbjct:  502 ESTENCWNCGRKASETCSGCNIARYCGSFCQHKDWERHHRLCGQNLHGQSPHGQGRPLLP 561          
BLAST of SMED30012024 vs. Ensembl Human
Match: CBFA2T2 (CBFA2/RUNX1 partner transcriptional co-repressor 2 [Source:HGNC Symbol;Acc:HGNC:1536])

HSP 1 Score: 47.7506 bits (112), Expect = 1.119e-6
Identity = 22/60 (36.67%), Postives = 28/60 (46.67%), Query Frame = 1
Query:   22 ECHEQCCYCGQNTIKECSGCGWAFYCSRECQEKHWCIHRFFCQQGYEREFPKLEGMNIVP 201
            E  E C  CG+   + CSGC  A YC   CQ K W  H   C Q    + P  +G  ++P
Sbjct:  473 ESTENCWNCGRKASETCSGCNIARYCGSFCQHKDWERHHRLCGQNLHGQSPHGQGRPLLP 532          
BLAST of SMED30012024 vs. Ensembl Fly
Match: nvy (gene:FBgn0005636 transcript:FBtr0072267)

HSP 1 Score: 44.2838 bits (103), Expect = 9.930e-6
Identity = 17/40 (42.50%), Postives = 21/40 (52.50%), Query Frame = 1
Query:   28 HEQCCYCGQNTIKECSGCGWAFYCSRECQEKHWCIHRFFC 147
             +QC  CG+   + CSGC  A YCS  CQ + W  H   C
Sbjct:  590 QQQCWNCGRKATETCSGCNMARYCSASCQYRDWDSHHQVC 629          
BLAST of SMED30012024 vs. Ensembl Zebrafish
Match: BX248306.1 (CBFA2/RUNX1 partner transcriptional co-repressor 3 [Source:NCBI gene;Acc:563252])

HSP 1 Score: 45.8246 bits (107), Expect = 3.082e-6
Identity = 20/50 (40.00%), Postives = 24/50 (48.00%), Query Frame = 1
Query:    7 MEQNLECHEQCCYCGQNTIKECSGCGWAFYCSRECQEKHWCIHRFFCQQG 156
            + Q  +  E C  CG+   + CSGC  A YC   CQ K W  H   C QG
Sbjct:  491 INQQEDSSESCWNCGRKASETCSGCNTARYCGSFCQHKDWEKHHHVCGQG 540          
BLAST of SMED30012024 vs. Ensembl Zebrafish
Match: cbfa2t3 (CBFA2/RUNX1 partner transcriptional co-repressor 3 [Source:ZFIN;Acc:ZDB-GENE-070209-2])

HSP 1 Score: 45.8246 bits (107), Expect = 3.495e-6
Identity = 20/50 (40.00%), Postives = 24/50 (48.00%), Query Frame = 1
Query:    7 MEQNLECHEQCCYCGQNTIKECSGCGWAFYCSRECQEKHWCIHRFFCQQG 156
            + Q  +  E C  CG+   + CSGC  A YC   CQ K W  H   C QG
Sbjct:  507 INQQEDSSESCWNCGRKASETCSGCNTARYCGSFCQHKDWEKHHHVCGQG 556          
BLAST of SMED30012024 vs. Ensembl Zebrafish
Match: BX248306.1 (CBFA2/RUNX1 partner transcriptional co-repressor 3 [Source:NCBI gene;Acc:563252])

HSP 1 Score: 45.8246 bits (107), Expect = 3.790e-6
Identity = 20/50 (40.00%), Postives = 24/50 (48.00%), Query Frame = 1
Query:    7 MEQNLECHEQCCYCGQNTIKECSGCGWAFYCSRECQEKHWCIHRFFCQQG 156
            + Q  +  E C  CG+   + CSGC  A YC   CQ K W  H   C QG
Sbjct:  469 INQQEDSSESCWNCGRKASETCSGCNTARYCGSFCQHKDWEKHHHVCGQG 518          
BLAST of SMED30012024 vs. Ensembl Zebrafish
Match: cbfa2t3 (CBFA2/RUNX1 partner transcriptional co-repressor 3 [Source:ZFIN;Acc:ZDB-GENE-070209-2])

HSP 1 Score: 45.8246 bits (107), Expect = 3.834e-6
Identity = 20/50 (40.00%), Postives = 24/50 (48.00%), Query Frame = 1
Query:    7 MEQNLECHEQCCYCGQNTIKECSGCGWAFYCSRECQEKHWCIHRFFCQQG 156
            + Q  +  E C  CG+   + CSGC  A YC   CQ K W  H   C QG
Sbjct:  489 INQQEDSSESCWNCGRKASETCSGCNTARYCGSFCQHKDWEKHHHVCGQG 538          
BLAST of SMED30012024 vs. Ensembl Zebrafish
Match: BX248306.1 (CBFA2/RUNX1 partner transcriptional co-repressor 3 [Source:NCBI gene;Acc:563252])

HSP 1 Score: 45.4394 bits (106), Expect = 4.373e-6
Identity = 20/50 (40.00%), Postives = 24/50 (48.00%), Query Frame = 1
Query:    7 MEQNLECHEQCCYCGQNTIKECSGCGWAFYCSRECQEKHWCIHRFFCQQG 156
            + Q  +  E C  CG+   + CSGC  A YC   CQ K W  H   C QG
Sbjct:  521 INQQEDSSESCWNCGRKASETCSGCNTARYCGSFCQHKDWEKHHHVCGQG 570          
BLAST of SMED30012024 vs. Ensembl Xenopus
Match: DEAF1 (DEAF1 transcription factor [Source:NCBI gene;Acc:100137100])

HSP 1 Score: 46.595 bits (109), Expect = 2.633e-6
Identity = 18/49 (36.73%), Postives = 25/49 (51.02%), Query Frame = 1
Query:   10 EQNLECHEQCCYCGQNTIKECSGCGWAFYCSRECQEKHWCIHRFFCQQG 156
            +Q +   + C  CG+  + EC+GC    YCS  CQ K W  H+  C Q 
Sbjct:  412 KQEILLRQSCVNCGREALNECTGCHKVNYCSIFCQRKDWKDHQHLCGQA 460          
BLAST of SMED30012024 vs. Ensembl Xenopus
Match: ctsa (cathepsin A [Source:Xenbase;Acc:XB-GENE-1014668])

HSP 1 Score: 45.0542 bits (105), Expect = 8.299e-6
Identity = 20/45 (44.44%), Postives = 22/45 (48.89%), Query Frame = 1
Query:   22 ECHEQCCYCGQNTIKECSGCGWAFYCSRECQEKHWCIHRFFCQQG 156
            E  E C  CG+   + CSGC  A YC   CQ K W  H   C QG
Sbjct:  491 ESTESCWNCGRKASETCSGCNIARYCGSFCQHKDWEKHHRICGQG 535          
BLAST of SMED30012024 vs. Ensembl Xenopus
Match: ctsa (cathepsin A [Source:Xenbase;Acc:XB-GENE-1014668])

HSP 1 Score: 45.0542 bits (105), Expect = 9.219e-6
Identity = 20/45 (44.44%), Postives = 22/45 (48.89%), Query Frame = 1
Query:   22 ECHEQCCYCGQNTIKECSGCGWAFYCSRECQEKHWCIHRFFCQQG 156
            E  E C  CG+   + CSGC  A YC   CQ K W  H   C QG
Sbjct:  488 ESTESCWNCGRKASETCSGCNIARYCGSFCQHKDWEKHHRICGQG 532          
BLAST of SMED30012024 vs. Ensembl Xenopus
Match: ctsa (cathepsin A [Source:Xenbase;Acc:XB-GENE-1014668])

HSP 1 Score: 45.0542 bits (105), Expect = 9.312e-6
Identity = 20/45 (44.44%), Postives = 22/45 (48.89%), Query Frame = 1
Query:   22 ECHEQCCYCGQNTIKECSGCGWAFYCSRECQEKHWCIHRFFCQQG 156
            E  E C  CG+   + CSGC  A YC   CQ K W  H   C QG
Sbjct:  490 ESTESCWNCGRKASETCSGCNIARYCGSFCQHKDWEKHHRICGQG 534          
BLAST of SMED30012024 vs. Ensembl Xenopus
Match: ctsa (cathepsin A [Source:Xenbase;Acc:XB-GENE-1014668])

HSP 1 Score: 45.0542 bits (105), Expect = 9.321e-6
Identity = 20/45 (44.44%), Postives = 22/45 (48.89%), Query Frame = 1
Query:   22 ECHEQCCYCGQNTIKECSGCGWAFYCSRECQEKHWCIHRFFCQQG 156
            E  E C  CG+   + CSGC  A YC   CQ K W  H   C QG
Sbjct:  494 ESTESCWNCGRKASETCSGCNIARYCGSFCQHKDWEKHHRICGQG 538          
BLAST of SMED30012024 vs. Ensembl Mouse
Match: Deaf1 (DEAF1, transcription factor [Source:MGI Symbol;Acc:MGI:1858496])

HSP 1 Score: 45.4394 bits (106), Expect = 4.554e-6
Identity = 21/50 (42.00%), Postives = 27/50 (54.00%), Query Frame = 1
Query:    7 MEQNLECHEQCCY-CGQNTIKECSGCGWAFYCSRECQEKHWCIHRFFCQQ 153
            M+ + E  EQ C  CG+  + EC+GC    YCS  CQ K W  H+  C Q
Sbjct:  494 MQVDTERKEQSCVNCGREAMSECTGCHKVNYCSTFCQRKDWKDHQHVCGQ 543          
BLAST of SMED30012024 vs. Ensembl Mouse
Match: Cbfa2t2 (CBFA2/RUNX1 translocation partner 2 [Source:MGI Symbol;Acc:MGI:1333833])

HSP 1 Score: 45.0542 bits (105), Expect = 6.608e-6
Identity = 21/60 (35.00%), Postives = 26/60 (43.33%), Query Frame = 1
Query:   22 ECHEQCCYCGQNTIKECSGCGWAFYCSRECQEKHWCIHRFFCQQGYEREFPKLEGMNIVP 201
            E  E C  CG+   + CSGC  A YC   CQ K W  H   C Q      P  +   ++P
Sbjct:  493 ESTENCWNCGRKASETCSGCNIARYCGSFCQHKDWERHHRLCGQSLHGHSPHSQSRPLLP 552          
BLAST of SMED30012024 vs. Ensembl Mouse
Match: Cbfa2t2 (CBFA2/RUNX1 translocation partner 2 [Source:MGI Symbol;Acc:MGI:1333833])

HSP 1 Score: 45.0542 bits (105), Expect = 6.933e-6
Identity = 21/60 (35.00%), Postives = 26/60 (43.33%), Query Frame = 1
Query:   22 ECHEQCCYCGQNTIKECSGCGWAFYCSRECQEKHWCIHRFFCQQGYEREFPKLEGMNIVP 201
            E  E C  CG+   + CSGC  A YC   CQ K W  H   C Q      P  +   ++P
Sbjct:  492 ESTENCWNCGRKASETCSGCNIARYCGSFCQHKDWERHHRLCGQSLHGHSPHSQSRPLLP 551          
BLAST of SMED30012024 vs. UniProt/SwissProt
Match: sp|O43439|MTG8R_HUMAN (Protein CBFA2T2 OS=Homo sapiens OX=9606 GN=CBFA2T2 PE=1 SV=1)

HSP 1 Score: 47.7506 bits (112), Expect = 4.819e-6
Identity = 22/60 (36.67%), Postives = 28/60 (46.67%), Query Frame = 1
Query:   22 ECHEQCCYCGQNTIKECSGCGWAFYCSRECQEKHWCIHRFFCQQGYEREFPKLEGMNIVP 201
            E  E C  CG+   + CSGC  A YC   CQ K W  H   C Q    + P  +G  ++P
Sbjct:  502 ESTENCWNCGRKASETCSGCNIARYCGSFCQHKDWERHHRLCGQNLHGQSPHGQGRPLLP 561          
BLAST of SMED30012024 vs. TrEMBL
Match: A0A4S2M036 (MYND-type domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_004951 PE=4 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 1.589e-12
Identity = 56/204 (27.45%), Postives = 76/204 (37.25%), Query Frame = 1
Query:   13 QNLECHEQCCYCGQNTIKECSGCGWAFYCSRECQEKHWCIHRFFCQQGYEREFPKLEGMNIVPCK------DSQ---------------------------------------IQKRQMVVEECIAKSSGPPCCAICADI----------------------------------------PSQVRLARFAGMLICTDCVEIQGS 369
            ++L    QCC+CG  T++ C  C WA YCS  C E H  IH++FC   Y   +P+L G+++VP +      D Q                                       I +R  +V   ++ S G P CAIC D                                         P+  RL RFAG+LICT CVEIQ +
Sbjct:   30 ESLNSGLQCCFCGTQTLERCPKCKWAAYCSLNCLELHRPIHQYFCFPKYASCYPRLIGLSVVPIEGVARQADKQDNDLMSTSHTCTTSSAHEKPDLQKTLSPVMTKRDTNLDLIYRRAELVRANLSASGGRPTCAICGDPCEQYNNQKEISNRSKLENAMEPDVISIGSYSGDANLASQKPTFPRLVRFAGLLICTCCVEIQAT 233          
BLAST of SMED30012024 vs. TrEMBL
Match: A0A504Z455 (MYND-type domain-containing protein OS=Fasciola gigantica OX=46835 GN=FGIG_06421 PE=4 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 7.436e-11
Identity = 28/58 (48.28%), Postives = 39/58 (67.24%), Query Frame = 1
Query:   34 QCCYCGQNTIKECSGCGWAFYCSRECQEKHWCIHRFFCQQGYEREFPKLEGMNIVPCK 207
            QCC CG+ T++ C  C WA YCS +C + H  IH++FC   Y + FP+L GM++VP K
Sbjct:   93 QCCLCGKRTLERCFQCSWAPYCSLQCYKLHRPIHQYFCFPNYAQNFPRLTGMDVVPLK 150          
BLAST of SMED30012024 vs. TrEMBL
Match: A0A2C5YSL1 (MYND-type domain-containing protein OS=Ophiocordyceps camponoti-rufipedis OX=2004952 GN=CDD80_6099 PE=4 SV=1)

HSP 1 Score: 57.3806 bits (137), Expect = 8.359e-7
Identity = 21/48 (43.75%), Postives = 28/48 (58.33%), Query Frame = 1
Query:   31 EQCCYCGQNT------IKECSGCGWAFYCSRECQEKHWCIHRFFCQQG 156
            E+C +CG         ++ CSGC   +YCS+ECQ +HW IHR  CQ  
Sbjct: 1180 EKCAFCGTKAGIETVNLRRCSGCKLVWYCSKECQSRHWKIHRTKCQSA 1227          
BLAST of SMED30012024 vs. TrEMBL
Match: A0A2G8KKY2 (Putative ubiquitin carboxyl-terminal hydrolase 19 OS=Stichopus japonicus OX=307972 GN=BSL78_14539 PE=4 SV=1)

HSP 1 Score: 55.8398 bits (133), Expect = 2.554e-6
Identity = 23/48 (47.92%), Postives = 29/48 (60.42%), Query Frame = 1
Query:   34 QCCYC-----GQNTIKECSGCGWAFYCSRECQEKHWCIHRFFCQQGYE 162
             C YC     G NT+K C+ C  A YC +ECQ+KHW  H+F C+Q  E
Sbjct:  510 HCSYCRAETQGNNTLKRCTRCLKAAYCDQECQKKHWHTHKFSCKQSLE 557          
BLAST of SMED30012024 vs. TrEMBL
Match: A0A0Q3JG67 (Uncharacterized protein OS=Brachypodium distachyon OX=15368 GN=100846465 PE=4 SV=1)

HSP 1 Score: 55.0694 bits (131), Expect = 5.234e-6
Identity = 28/68 (41.18%), Postives = 37/68 (54.41%), Query Frame = 1
Query:   37 CCYCGQNTIKECSGCGWAFYCSRECQEKHW-CIHRFFCQQGYEREFPKLEGMNIVPCKDSQIQKRQMV 237
            C  CG+ +IK CSGC    YCS ECQ KHW   H+F C+Q       KL+ ++ +PC      K+  V
Sbjct:  105 CAECGRASIKRCSGCKRMRYCSGECQSKHWQSDHKFKCKQ------MKLDSVDKLPCGGEASSKKSSV 166          
BLAST of SMED30012024 vs. Ensembl Cavefish
Match: cbfa2t3 (CBFA2/RUNX1 partner transcriptional co-repressor 3 [Source:NCBI gene;Acc:103030256])

HSP 1 Score: 46.595 bits (109), Expect = 1.517e-6
Identity = 20/52 (38.46%), Postives = 25/52 (48.08%), Query Frame = 1
Query:    7 MEQNLECHEQCCYCGQNTIKECSGCGWAFYCSRECQEKHWCIHRFFCQQGYE 162
            + Q  +  E C  CG+   + CSGC  A YC   CQ K W  H   C QG +
Sbjct:  576 INQQEDSSESCWNCGRKASETCSGCNTARYCGSFCQHKDWEKHHHVCGQGLQ 627          
BLAST of SMED30012024 vs. Ensembl Cavefish
Match: cbfa2t3 (CBFA2/RUNX1 partner transcriptional co-repressor 3 [Source:NCBI gene;Acc:103030256])

HSP 1 Score: 45.4394 bits (106), Expect = 3.492e-6
Identity = 20/52 (38.46%), Postives = 25/52 (48.08%), Query Frame = 1
Query:    7 MEQNLECHEQCCYCGQNTIKECSGCGWAFYCSRECQEKHWCIHRFFCQQGYE 162
            + Q  +  E C  CG+   + CSGC  A YC   CQ K W  H   C QG +
Sbjct:  500 INQQEDSSESCWNCGRKASETCSGCNTARYCGSFCQHKDWEKHHHVCGQGLQ 551          
BLAST of SMED30012024 vs. Ensembl Cavefish
Match: deaf1 (DEAF1 transcription factor [Source:NCBI gene;Acc:103031653])

HSP 1 Score: 45.0542 bits (105), Expect = 4.589e-6
Identity = 17/39 (43.59%), Postives = 21/39 (53.85%), Query Frame = 1
Query:   37 CCYCGQNTIKECSGCGWAFYCSRECQEKHWCIHRFFCQQ 153
            C  CG+    EC+GC    YCS  CQ+K W  H+  C Q
Sbjct:  466 CVNCGREASNECTGCHKVHYCSSFCQKKDWTDHQHSCSQ 504          
BLAST of SMED30012024 vs. Ensembl Cavefish
Match: cbfa2t2 (CBFA2/RUNX1 partner transcriptional co-repressor 2 [Source:ZFIN;Acc:ZDB-GENE-070209-1])

HSP 1 Score: 44.669 bits (104), Expect = 7.125e-6
Identity = 22/59 (37.29%), Postives = 29/59 (49.15%), Query Frame = 1
Query:   22 ECHEQCCY-CGQNTIKECSGCGWAFYCSRECQEKHWCIHRFFCQQGYERE-FPKLEGMN 192
            E   +CC+ CG+   + CSGC  A YC   CQ K W  H   C  G + +  P   G+N
Sbjct:  453 EDSSECCWNCGRKASETCSGCNAARYCGSFCQHKDWERHHLICSPGLQAQPKPSQSGLN 511          
BLAST of SMED30012024 vs. Ensembl Cavefish
Match: zmynd10 (zinc finger MYND-type containing 10 [Source:NCBI gene;Acc:103041678])

HSP 1 Score: 44.669 bits (104), Expect = 8.041e-6
Identity = 22/48 (45.83%), Postives = 27/48 (56.25%), Query Frame = 1
Query:    7 MEQNLECHEQCCYCGQNTIKECSGCGWAFYCSRECQEKHWCIHRFFCQ 150
            ME  +    +C  CG   IK CS C   +YC+RECQ KHW  H+  CQ
Sbjct:  387 MESLIPDKPKCGTCGAEGIKRCSRCQGEWYCNRECQVKHWPKHKLACQ 434          
BLAST of SMED30012024 vs. Ensembl Nematostella
Match: EDO49837 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RER7])

HSP 1 Score: 45.0542 bits (105), Expect = 1.961e-6
Identity = 20/57 (35.09%), Postives = 31/57 (54.39%), Query Frame = 1
Query:   13 QNLECHEQCCYCGQN-TIKECSGCGWAFYCSRECQEKHWCIHRFFCQ---QGYEREF 171
            Q+ +    C  CG+  ++K+C+ C    YCS  CQ+ HW  H+  CQ   + YE+E 
Sbjct:  307 QSADFSNACYVCGERRSVKKCAACKKVGYCSVSCQKLHWSTHKKHCQRLAKEYEQEL 363          
BLAST of SMED30012024 vs. Ensembl Nematostella
Match: EDO41750 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3C8])

HSP 1 Score: 44.669 bits (104), Expect = 2.196e-6
Identity = 17/38 (44.74%), Postives = 22/38 (57.89%), Query Frame = 1
Query:   34 QCCYCGQNTIKECSGCGWAFYCSRECQEKHWCIHRFFC 147
            +C  CG+   K CS C   +YC RECQ K+W  H+  C
Sbjct:  403 KCANCGKPATKRCSRCQNEWYCKRECQVKNWSKHKGIC 440          
BLAST of SMED30012024 vs. Ensembl Medaka
Match: zmynd10 (zinc finger MYND-type containing 10 [Source:NCBI gene;Acc:101169848])

HSP 1 Score: 44.2838 bits (103), Expect = 8.413e-6
Identity = 19/48 (39.58%), Postives = 26/48 (54.17%), Query Frame = 1
Query:    7 MEQNLECHEQCCYCGQNTIKECSGCGWAFYCSRECQEKHWCIHRFFCQ 150
            ME   +   +C  CG+   K CS C   +YC R+CQ +HW  H+  CQ
Sbjct:  381 MENFHQEKTKCGSCGKEASKRCSRCQTEWYCHRKCQVQHWPKHKKACQ 428          
BLAST of SMED30012024 vs. Ensembl Medaka
Match: zmynd10 (zinc finger MYND-type containing 10 [Source:NCBI gene;Acc:101169848])

HSP 1 Score: 44.2838 bits (103), Expect = 8.955e-6
Identity = 19/48 (39.58%), Postives = 26/48 (54.17%), Query Frame = 1
Query:    7 MEQNLECHEQCCYCGQNTIKECSGCGWAFYCSRECQEKHWCIHRFFCQ 150
            ME   +   +C  CG+   K CS C   +YC R+CQ +HW  H+  CQ
Sbjct:  370 MENFHQEKTKCGSCGKEASKRCSRCQTEWYCHRKCQVQHWPKHKKACQ 417          
BLAST of SMED30012024 vs. Planmine SMEST
Match: SMESG000042632.1 (SMESG000042632.1)

HSP 1 Score: 254.988 bits (650), Expect = 1.136e-88
Identity = 122/123 (99.19%), Postives = 123/123 (100.00%), Query Frame = 1
Query:    7 MEQNLECHEQCCYCGQNTIKECSGCGWAFYCSRECQEKHWCIHRFFCQQGYEREFPKLEGMNIVPCKDSQIQKRQMVVEECIAKSSGPPCCAICADIPSQVRLARFAGMLICTDCVEIQGSMN 375
            +EQNLECHEQCCYCGQNTIKECSGCGWAFYCSRECQEKHWCIHRFFCQQGYEREFPKLEGMNIVPCKDSQIQKRQMVVEECIAKSSGPPCCAICADIPSQVRLARFAGMLICTDCVEIQGSMN
Sbjct:   36 LEQNLECHEQCCYCGQNTIKECSGCGWAFYCSRECQEKHWCIHRFFCQQGYEREFPKLEGMNIVPCKDSQIQKRQMVVEECIAKSSGPPCCAICADIPSQVRLARFAGMLICTDCVEIQGSMN 158          
BLAST of SMED30012024 vs. Planmine SMEST
Match: SMESG000042632.1 (SMESG000042632.1)

HSP 1 Score: 252.677 bits (644), Expect = 3.295e-88
Identity = 122/123 (99.19%), Postives = 123/123 (100.00%), Query Frame = 1
Query:    7 MEQNLECHEQCCYCGQNTIKECSGCGWAFYCSRECQEKHWCIHRFFCQQGYEREFPKLEGMNIVPCKDSQIQKRQMVVEECIAKSSGPPCCAICADIPSQVRLARFAGMLICTDCVEIQGSMN 375
            +EQNLECHEQCCYCGQNTIKECSGCGWAFYCSRECQEKHWCIHRFFCQQGYEREFPKLEGMNIVPCKDSQIQKRQMVVEECIAKSSGPPCCAICADIPSQVRLARFAGMLICTDCVEIQGSMN
Sbjct:    7 LEQNLECHEQCCYCGQNTIKECSGCGWAFYCSRECQEKHWCIHRFFCQQGYEREFPKLEGMNIVPCKDSQIQKRQMVVEECIAKSSGPPCCAICADIPSQVRLARFAGMLICTDCVEIQGSMN 129          
BLAST of SMED30012024 vs. Planmine SMEST
Match: SMESG000066740.1 (SMESG000066740.1)

HSP 1 Score: 45.4394 bits (106), Expect = 2.589e-6
Identity = 17/38 (44.74%), Postives = 21/38 (55.26%), Query Frame = 1
Query:   34 QCCYCGQNTIKECSGCGWAFYCSRECQEKHWCIHRFFC 147
            +C  CG    K CS C   +YC RECQ +HW  H+  C
Sbjct:  414 RCVVCGNEAAKRCSRCKAEWYCRRECQVQHWKRHKVAC 451          
The following BLAST results are available for this feature:
BLAST of SMED30012024 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CBFA2T28.136e-736.67CBFA2/RUNX1 partner transcriptional co-repressor 2... [more]
CBFA2T29.919e-736.67CBFA2/RUNX1 partner transcriptional co-repressor 2... [more]
CBFA2T21.004e-636.67CBFA2/RUNX1 partner transcriptional co-repressor 2... [more]
CBFA2T21.004e-636.67CBFA2/RUNX1 partner transcriptional co-repressor 2... [more]
CBFA2T21.119e-636.67CBFA2/RUNX1 partner transcriptional co-repressor 2... [more]
back to top
BLAST of SMED30012024 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30012024 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
nvy9.930e-642.50gene:FBgn0005636 transcript:FBtr0072267[more]
back to top
BLAST of SMED30012024 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BX248306.13.082e-640.00CBFA2/RUNX1 partner transcriptional co-repressor 3... [more]
cbfa2t33.495e-640.00CBFA2/RUNX1 partner transcriptional co-repressor 3... [more]
BX248306.13.790e-640.00CBFA2/RUNX1 partner transcriptional co-repressor 3... [more]
cbfa2t33.834e-640.00CBFA2/RUNX1 partner transcriptional co-repressor 3... [more]
BX248306.14.373e-640.00CBFA2/RUNX1 partner transcriptional co-repressor 3... [more]
back to top
BLAST of SMED30012024 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DEAF12.633e-636.73DEAF1 transcription factor [Source:NCBI gene;Acc:1... [more]
ctsa8.299e-644.44cathepsin A [Source:Xenbase;Acc:XB-GENE-1014668][more]
ctsa9.219e-644.44cathepsin A [Source:Xenbase;Acc:XB-GENE-1014668][more]
ctsa9.312e-644.44cathepsin A [Source:Xenbase;Acc:XB-GENE-1014668][more]
ctsa9.321e-644.44cathepsin A [Source:Xenbase;Acc:XB-GENE-1014668][more]
back to top
BLAST of SMED30012024 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Deaf14.554e-642.00DEAF1, transcription factor [Source:MGI Symbol;Acc... [more]
Cbfa2t26.608e-635.00CBFA2/RUNX1 translocation partner 2 [Source:MGI Sy... [more]
Cbfa2t26.933e-635.00CBFA2/RUNX1 translocation partner 2 [Source:MGI Sy... [more]
back to top
BLAST of SMED30012024 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|O43439|MTG8R_HUMAN4.819e-636.67Protein CBFA2T2 OS=Homo sapiens OX=9606 GN=CBFA2T2... [more]
back to top
BLAST of SMED30012024 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2M0361.589e-1227.45MYND-type domain-containing protein OS=Opisthorchi... [more]
A0A504Z4557.436e-1148.28MYND-type domain-containing protein OS=Fasciola gi... [more]
A0A2C5YSL18.359e-743.75MYND-type domain-containing protein OS=Ophiocordyc... [more]
A0A2G8KKY22.554e-647.92Putative ubiquitin carboxyl-terminal hydrolase 19 ... [more]
A0A0Q3JG675.234e-641.18Uncharacterized protein OS=Brachypodium distachyon... [more]
back to top
BLAST of SMED30012024 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cbfa2t31.517e-638.46CBFA2/RUNX1 partner transcriptional co-repressor 3... [more]
cbfa2t33.492e-638.46CBFA2/RUNX1 partner transcriptional co-repressor 3... [more]
deaf14.589e-643.59DEAF1 transcription factor [Source:NCBI gene;Acc:1... [more]
cbfa2t27.125e-637.29CBFA2/RUNX1 partner transcriptional co-repressor 2... [more]
zmynd108.041e-645.83zinc finger MYND-type containing 10 [Source:NCBI g... [more]
back to top
BLAST of SMED30012024 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30012024 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30012024 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO498371.961e-635.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO417502.196e-644.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30012024 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
zmynd108.413e-639.58zinc finger MYND-type containing 10 [Source:NCBI g... [more]
zmynd108.955e-639.58zinc finger MYND-type containing 10 [Source:NCBI g... [more]
back to top
BLAST of SMED30012024 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000042632.11.136e-8899.19SMESG000042632.1[more]
SMESG000042632.13.295e-8899.19SMESG000042632.1[more]
SMESG000066740.12.589e-644.74SMESG000066740.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012024 ID=SMED30012024|Name=SMED30012024|organism=Schmidtea mediterranea sexual|type=transcript|length=396bp
TATTGAATGGAGCAAAACCTAGAATGTCACGAACAATGTTGCTATTGTGG
TCAAAATACGATTAAAGAATGTAGTGGATGCGGGTGGGCATTTTATTGCA
GTCGAGAATGCCAAGAAAAGCACTGGTGCATTCATAGATTTTTTTGTCAA
CAAGGATATGAAAGAGAATTTCCAAAATTAGAAGGAATGAATATCGTTCC
ATGTAAAGATTCTCAAATTCAAAAAAGACAAATGGTCGTCGAAGAATGTA
TAGCAAAAAGTTCTGGGCCACCTTGCTGTGCTATTTGTGCTGACATTCCC
AGTCAAGTGCGGTTAGCGAGATTTGCTGGAATGTTGATTTGCACTGATTG
CGTCGAAATTCAAGGATCAATGAATTAGATTTCGATAATTGCAGAT
back to top

protein sequence of SMED30012024-orf-1

>SMED30012024-orf-1 ID=SMED30012024-orf-1|Name=SMED30012024-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=124bp
MEQNLECHEQCCYCGQNTIKECSGCGWAFYCSRECQEKHWCIHRFFCQQG
YEREFPKLEGMNIVPCKDSQIQKRQMVVEECIAKSSGPPCCAICADIPSQ
VRLARFAGMLICTDCVEIQGSMN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000419prepharyngeal region
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR002893Znf_MYND
Vocabulary: biological process
TermDefinition
GO:0000122negative regulation of transcription from RNA polymerase II promoter
GO:0006351transcription, DNA-templated
GO:0006355regulation of transcription, DNA-templated
GO:0010976positive regulation of neuron projection development
GO:0010977negative regulation of neuron projection development
GO:0030855epithelial cell differentiation
GO:0045746negative regulation of Notch signaling pathway
GO:0045892negative regulation of transcription, DNA-templated
GO:0060575intestinal epithelial cell differentiation
Vocabulary: molecular function
TermDefinition
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0003714transcription corepressor activity
GO:0005515protein binding
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.30.60.180coord: 1..51
e-value: 2.6E-9
score: 38.7
NoneNo IPR availableSUPERFAMILYSSF144232HIT/MYND zinc finger-likecoord: 6..48
IPR002893Zinc finger, MYND-typePFAMPF01753zf-MYNDcoord: 10..46
e-value: 5.9E-8
score: 32.7
IPR002893Zinc finger, MYND-typePROSITEPS50865ZF_MYND_2coord: 10..46
score: 11.257