slc9a-2

Overview
Nameslc9a-2 (AKN21461.1)
Smed IDSMED30012022
Length (bp)2355
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc9a-2 (SMED30012022) t-SNE clustered cells

Violin plots show distribution of expression levels for slc9a-2 (SMED30012022) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc9a-2 (SMED30012022) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc9a-2 (SMED30012022) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012022

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30012022SMESG000028983.1 PL08007A1B12ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
parenchymal cellSMED30012022SMESG000028983.1 dd_Smed_v4_5461_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30012022SMESG000028983.1 dd_Smed_v4_5461_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30012022SMESG000028983.1 dd_Smed_v4_5461_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc9a-2 vs. Ensembl Human
Match: SLC9A6 (solute carrier family 9 member A6 [Source:HGNC Symbol;Acc:HGNC:11079])

HSP 1 Score: 503.442 bits (1295), Expect = 3.942e-168
Identity = 279/610 (45.74%), Postives = 405/610 (66.39%), Query Frame = 3
Query:   51 SKCEALNEKILEQSREEKVQQNHKTDXXXXXXXXXXXXXXXXXXXXFKHKRLRFVHETSCSLIYGLILGVIFY---NLPIDVNKVTTTLQMPQSKTNCAYQLPPDNIILEMNLLNRTSPYTFKYR---HVLNDHESDAKDLSRKATFDAEIFFNLLLPPIIFCAGYNMKKKHFFENLGAIASFAFLGTILSSLTIGGLCYG---LSRTITSISDSIGFGECLLFGSFISATDPVTVLAIFNDINIEVDLYAFVFGESVLNDAVAIVLVNSVEQYGKIANNGE-FNPFAILIAAKSFMTVFLGALSIGCVVGICTALVTKYTYLRDHPLLETSLFFLMSYCSFLIAEVAGASGIVASLFCGITQAHYTYNNLSEESQKWTKGIFELMSFLSENFVFVYIGVSNFTFRDHNWQPRFICIAIFAIIVGRAVNVYILSAMLNLGRKNKIKFNHQHMLMFAGVRGAMAFALAIRNTSSKVRQMFFSTTLVIVMVTVFICGGLTLPMINFLKIRIGKDNEITD-SIPEPADDTTISDEQVLDLNERHKKK---AFLIRMFAKLDCQFIKPLLTHSPPLLIDTCPLCCFTFAKFLTTSEQISRNSHLRISKNNISMD 1838
             +  A++E+I+    E++ +++H+ DS  LL F++LL ++++TIW+FKH+R RF+HET  ++IYGL++G++     ++P DVN VT +         C  Q  P  +++  N+  +   Y  K     H LN+ + +  ++ RK TFD E+FFN+LLPPIIF AGY++K++HFF NLG+I ++AFLGT +S   IG + YG   L +    ++    F +CLLFG+ +SATDPVTVLAIF+++ ++V+LYA +FGESVLNDAVAIVL +S+  Y    +N   F+  A+  +   F+ +F G+ ++G   G+ TALVTK+T LR+  LLET LFFLMS+ +FL+AE  G +G+VA LFCGITQAHYTYNNLS ESQ  TK +FEL++FL+ENF+F Y+G++ FTF++H + P F+  A  AI +GRA N+Y LS +LNLGR++KI  N QHM+MFAG+RGAMAFALAIR+T++  RQM FSTTL+IV  TV++ GG T  M++ L IR+G D++     +PE               NER   K   A+L RM+   D  ++KPLLTHS P L  T P CC   A+ LT+ +       L+   +++ ++
Sbjct:   48 GEARAMDEEIVS---EKQAEESHRQDSANLLIFILLLTLTILTIWLFKHRRARFLHETGLAMIYGLLVGLVLRYGIHVPSDVNNVTLS---------CEVQSSPTTLLV--NVSGKFYEYMLKGEISSHELNNVQDN--EMLRKVTFDPEVFFNILLPPIIFYAGYSLKRRHFFRNLGSILAYAFLGTAISCFVIGSIMYGCVTLMKVTGQLAGDFYFTDCLLFGAIVSATDPVTVLAIFHELQVDVELYALLFGESVLNDAVAIVLSSSIVAYQPAGDNSHTFDVTAMFKSIGIFLGIFSGSFAMGAATGVVTALVTKFTKLREFQLLETGLFFLMSWSTFLLAEAWGFTGVVAVLFCGITQAHYTYNNLSTESQHRTKQLFELLNFLAENFIFSYMGLTLFTFQNHVFNPTFVVGAFVAIFLGRAANIYPLSLLLNLGRRSKIGSNFQHMMMFAGLRGAMAFALAIRDTATYARQMMFSTTLLIVFFTVWVFGGGTTAMLSCLHIRVGVDSDQEHLGVPE---------------NERRTTKAESAWLFRMWYNFDHNYLKPLLTHSGPPLTTTLPACCGPIARCLTSPQAYENQEQLKDDDSDLILN 626          
BLAST of slc9a-2 vs. Ensembl Human
Match: SLC9A6 (solute carrier family 9 member A6 [Source:HGNC Symbol;Acc:HGNC:11079])

HSP 1 Score: 499.975 bits (1286), Expect = 1.622e-167
Identity = 278/605 (45.95%), Postives = 403/605 (66.61%), Query Frame = 3
Query:   66 LNEKILEQSREEKVQQNHKTDXXXXXXXXXXXXXXXXXXXXFKHKRLRFVHETSCSLIYGLILGVIFY---NLPIDVNKVTTTLQMPQSKTNCAYQLPPDNIILEMNLLNRTSPYTFKYR---HVLNDHESDAKDLSRKATFDAEIFFNLLLPPIIFCAGYNMKKKHFFENLGAIASFAFLGTILSSLTIGGLCYG---LSRTITSISDSIGFGECLLFGSFISATDPVTVLAIFNDINIEVDLYAFVFGESVLNDAVAIVLVNSVEQYGKIANNGE-FNPFAILIAAKSFMTVFLGALSIGCVVGICTALVTKYTYLRDHPLLETSLFFLMSYCSFLIAEVAGASGIVASLFCGITQAHYTYNNLSEESQKWTKGIFELMSFLSENFVFVYIGVSNFTFRDHNWQPRFICIAIFAIIVGRAVNVYILSAMLNLGRKNKIKFNHQHMLMFAGVRGAMAFALAIRNTSSKVRQMFFSTTLVIVMVTVFICGGLTLPMINFLKIRIGKDNEITD-SIPEPADDTTISDEQVLDLNERHKKK---AFLIRMFAKLDCQFIKPLLTHSPPLLIDTCPLCCFTFAKFLTTSEQISRNSHLRISKNNISMD 1838
            ++E+I+    E++ +++H+ DS  LL F++LL ++++TIW+FKH+R RF+HET  ++IYGL++G++     ++P DVN VT +         C  Q  P  +++  N+  +   Y  K     H LN+ + +  ++ RK TFD E+FFN+LLPPIIF AGY++K++HFF NLG+I ++AFLGT +S   IG + YG   L +    ++    F +CLLFG+ +SATDPVTVLAIF+++ ++V+LYA +FGESVLNDAVAIVL +S+  Y    +N   F+  A+  +   F+ +F G+ ++G   G+ TALVTK+T LR+  LLET LFFLMS+ +FL+AE  G +G+VA LFCGITQAHYTYNNLS ESQ  TK +FEL++FL+ENF+F Y+G++ FTF++H + P F+  A  AI +GRA N+Y LS +LNLGR++KI  N QHM+MFAG+RGAMAFALAIR+T++  RQM FSTTL+IV  TV++ GG T  M++ L IR+G D++     +PE               NER   K   A+L RM+   D  ++KPLLTHS P L  T P CC   A+ LT+ +       L+   +++ ++
Sbjct:    1 MDEEIVS---EKQAEESHRQDSANLLIFILLLTLTILTIWLFKHRRARFLHETGLAMIYGLLVGLVLRYGIHVPSDVNNVTLS---------CEVQSSPTTLLV--NVSGKFYEYMLKGEISSHELNNVQDN--EMLRKVTFDPEVFFNILLPPIIFYAGYSLKRRHFFRNLGSILAYAFLGTAISCFVIGSIMYGCVTLMKVTGQLAGDFYFTDCLLFGAIVSATDPVTVLAIFHELQVDVELYALLFGESVLNDAVAIVLSSSIVAYQPAGDNSHTFDVTAMFKSIGIFLGIFSGSFAMGAATGVVTALVTKFTKLREFQLLETGLFFLMSWSTFLLAEAWGFTGVVAVLFCGITQAHYTYNNLSTESQHRTKQLFELLNFLAENFIFSYMGLTLFTFQNHVFNPTFVVGAFVAIFLGRAANIYPLSLLLNLGRRSKIGSNFQHMMMFAGLRGAMAFALAIRDTATYARQMMFSTTLLIVFFTVWVFGGGTTAMLSCLHIRVGVDSDQEHLGVPE---------------NERRTTKAESAWLFRMWYNFDHNYLKPLLTHSGPPLTTTLPACCGPIARCLTSPQAYENQEQLKDDDSDLILN 574          
BLAST of slc9a-2 vs. Ensembl Human
Match: SLC9A6 (solute carrier family 9 member A6 [Source:HGNC Symbol;Acc:HGNC:11079])

HSP 1 Score: 499.975 bits (1286), Expect = 1.622e-167
Identity = 278/605 (45.95%), Postives = 403/605 (66.61%), Query Frame = 3
Query:   66 LNEKILEQSREEKVQQNHKTDXXXXXXXXXXXXXXXXXXXXFKHKRLRFVHETSCSLIYGLILGVIFY---NLPIDVNKVTTTLQMPQSKTNCAYQLPPDNIILEMNLLNRTSPYTFKYR---HVLNDHESDAKDLSRKATFDAEIFFNLLLPPIIFCAGYNMKKKHFFENLGAIASFAFLGTILSSLTIGGLCYG---LSRTITSISDSIGFGECLLFGSFISATDPVTVLAIFNDINIEVDLYAFVFGESVLNDAVAIVLVNSVEQYGKIANNGE-FNPFAILIAAKSFMTVFLGALSIGCVVGICTALVTKYTYLRDHPLLETSLFFLMSYCSFLIAEVAGASGIVASLFCGITQAHYTYNNLSEESQKWTKGIFELMSFLSENFVFVYIGVSNFTFRDHNWQPRFICIAIFAIIVGRAVNVYILSAMLNLGRKNKIKFNHQHMLMFAGVRGAMAFALAIRNTSSKVRQMFFSTTLVIVMVTVFICGGLTLPMINFLKIRIGKDNEITD-SIPEPADDTTISDEQVLDLNERHKKK---AFLIRMFAKLDCQFIKPLLTHSPPLLIDTCPLCCFTFAKFLTTSEQISRNSHLRISKNNISMD 1838
            ++E+I+    E++ +++H+ DS  LL F++LL ++++TIW+FKH+R RF+HET  ++IYGL++G++     ++P DVN VT +         C  Q  P  +++  N+  +   Y  K     H LN+ + +  ++ RK TFD E+FFN+LLPPIIF AGY++K++HFF NLG+I ++AFLGT +S   IG + YG   L +    ++    F +CLLFG+ +SATDPVTVLAIF+++ ++V+LYA +FGESVLNDAVAIVL +S+  Y    +N   F+  A+  +   F+ +F G+ ++G   G+ TALVTK+T LR+  LLET LFFLMS+ +FL+AE  G +G+VA LFCGITQAHYTYNNLS ESQ  TK +FEL++FL+ENF+F Y+G++ FTF++H + P F+  A  AI +GRA N+Y LS +LNLGR++KI  N QHM+MFAG+RGAMAFALAIR+T++  RQM FSTTL+IV  TV++ GG T  M++ L IR+G D++     +PE               NER   K   A+L RM+   D  ++KPLLTHS P L  T P CC   A+ LT+ +       L+   +++ ++
Sbjct:    1 MDEEIVS---EKQAEESHRQDSANLLIFILLLTLTILTIWLFKHRRARFLHETGLAMIYGLLVGLVLRYGIHVPSDVNNVTLS---------CEVQSSPTTLLV--NVSGKFYEYMLKGEISSHELNNVQDN--EMLRKVTFDPEVFFNILLPPIIFYAGYSLKRRHFFRNLGSILAYAFLGTAISCFVIGSIMYGCVTLMKVTGQLAGDFYFTDCLLFGAIVSATDPVTVLAIFHELQVDVELYALLFGESVLNDAVAIVLSSSIVAYQPAGDNSHTFDVTAMFKSIGIFLGIFSGSFAMGAATGVVTALVTKFTKLREFQLLETGLFFLMSWSTFLLAEAWGFTGVVAVLFCGITQAHYTYNNLSTESQHRTKQLFELLNFLAENFIFSYMGLTLFTFQNHVFNPTFVVGAFVAIFLGRAANIYPLSLLLNLGRRSKIGSNFQHMMMFAGLRGAMAFALAIRDTATYARQMMFSTTLLIVFFTVWVFGGGTTAMLSCLHIRVGVDSDQEHLGVPE---------------NERRTTKAESAWLFRMWYNFDHNYLKPLLTHSGPPLTTTLPACCGPIARCLTSPQAYENQEQLKDDDSDLILN 574          
BLAST of slc9a-2 vs. Ensembl Human
Match: SLC9A6 (solute carrier family 9 member A6 [Source:HGNC Symbol;Acc:HGNC:11079])

HSP 1 Score: 499.975 bits (1286), Expect = 1.622e-167
Identity = 278/605 (45.95%), Postives = 403/605 (66.61%), Query Frame = 3
Query:   66 LNEKILEQSREEKVQQNHKTDXXXXXXXXXXXXXXXXXXXXFKHKRLRFVHETSCSLIYGLILGVIFY---NLPIDVNKVTTTLQMPQSKTNCAYQLPPDNIILEMNLLNRTSPYTFKYR---HVLNDHESDAKDLSRKATFDAEIFFNLLLPPIIFCAGYNMKKKHFFENLGAIASFAFLGTILSSLTIGGLCYG---LSRTITSISDSIGFGECLLFGSFISATDPVTVLAIFNDINIEVDLYAFVFGESVLNDAVAIVLVNSVEQYGKIANNGE-FNPFAILIAAKSFMTVFLGALSIGCVVGICTALVTKYTYLRDHPLLETSLFFLMSYCSFLIAEVAGASGIVASLFCGITQAHYTYNNLSEESQKWTKGIFELMSFLSENFVFVYIGVSNFTFRDHNWQPRFICIAIFAIIVGRAVNVYILSAMLNLGRKNKIKFNHQHMLMFAGVRGAMAFALAIRNTSSKVRQMFFSTTLVIVMVTVFICGGLTLPMINFLKIRIGKDNEITD-SIPEPADDTTISDEQVLDLNERHKKK---AFLIRMFAKLDCQFIKPLLTHSPPLLIDTCPLCCFTFAKFLTTSEQISRNSHLRISKNNISMD 1838
            ++E+I+    E++ +++H+ DS  LL F++LL ++++TIW+FKH+R RF+HET  ++IYGL++G++     ++P DVN VT +         C  Q  P  +++  N+  +   Y  K     H LN+ + +  ++ RK TFD E+FFN+LLPPIIF AGY++K++HFF NLG+I ++AFLGT +S   IG + YG   L +    ++    F +CLLFG+ +SATDPVTVLAIF+++ ++V+LYA +FGESVLNDAVAIVL +S+  Y    +N   F+  A+  +   F+ +F G+ ++G   G+ TALVTK+T LR+  LLET LFFLMS+ +FL+AE  G +G+VA LFCGITQAHYTYNNLS ESQ  TK +FEL++FL+ENF+F Y+G++ FTF++H + P F+  A  AI +GRA N+Y LS +LNLGR++KI  N QHM+MFAG+RGAMAFALAIR+T++  RQM FSTTL+IV  TV++ GG T  M++ L IR+G D++     +PE               NER   K   A+L RM+   D  ++KPLLTHS P L  T P CC   A+ LT+ +       L+   +++ ++
Sbjct:    1 MDEEIVS---EKQAEESHRQDSANLLIFILLLTLTILTIWLFKHRRARFLHETGLAMIYGLLVGLVLRYGIHVPSDVNNVTLS---------CEVQSSPTTLLV--NVSGKFYEYMLKGEISSHELNNVQDN--EMLRKVTFDPEVFFNILLPPIIFYAGYSLKRRHFFRNLGSILAYAFLGTAISCFVIGSIMYGCVTLMKVTGQLAGDFYFTDCLLFGAIVSATDPVTVLAIFHELQVDVELYALLFGESVLNDAVAIVLSSSIVAYQPAGDNSHTFDVTAMFKSIGIFLGIFSGSFAMGAATGVVTALVTKFTKLREFQLLETGLFFLMSWSTFLLAEAWGFTGVVAVLFCGITQAHYTYNNLSTESQHRTKQLFELLNFLAENFIFSYMGLTLFTFQNHVFNPTFVVGAFVAIFLGRAANIYPLSLLLNLGRRSKIGSNFQHMMMFAGLRGAMAFALAIRDTATYARQMMFSTTLLIVFFTVWVFGGGTTAMLSCLHIRVGVDSDQEHLGVPE---------------NERRTTKAESAWLFRMWYNFDHNYLKPLLTHSGPPLTTTLPACCGPIARCLTSPQAYENQEQLKDDDSDLILN 574          
BLAST of slc9a-2 vs. Ensembl Human
Match: SLC9A6 (solute carrier family 9 member A6 [Source:HGNC Symbol;Acc:HGNC:11079])

HSP 1 Score: 499.975 bits (1286), Expect = 1.622e-167
Identity = 278/605 (45.95%), Postives = 403/605 (66.61%), Query Frame = 3
Query:   66 LNEKILEQSREEKVQQNHKTDXXXXXXXXXXXXXXXXXXXXFKHKRLRFVHETSCSLIYGLILGVIFY---NLPIDVNKVTTTLQMPQSKTNCAYQLPPDNIILEMNLLNRTSPYTFKYR---HVLNDHESDAKDLSRKATFDAEIFFNLLLPPIIFCAGYNMKKKHFFENLGAIASFAFLGTILSSLTIGGLCYG---LSRTITSISDSIGFGECLLFGSFISATDPVTVLAIFNDINIEVDLYAFVFGESVLNDAVAIVLVNSVEQYGKIANNGE-FNPFAILIAAKSFMTVFLGALSIGCVVGICTALVTKYTYLRDHPLLETSLFFLMSYCSFLIAEVAGASGIVASLFCGITQAHYTYNNLSEESQKWTKGIFELMSFLSENFVFVYIGVSNFTFRDHNWQPRFICIAIFAIIVGRAVNVYILSAMLNLGRKNKIKFNHQHMLMFAGVRGAMAFALAIRNTSSKVRQMFFSTTLVIVMVTVFICGGLTLPMINFLKIRIGKDNEITD-SIPEPADDTTISDEQVLDLNERHKKK---AFLIRMFAKLDCQFIKPLLTHSPPLLIDTCPLCCFTFAKFLTTSEQISRNSHLRISKNNISMD 1838
            ++E+I+    E++ +++H+ DS  LL F++LL ++++TIW+FKH+R RF+HET  ++IYGL++G++     ++P DVN VT +         C  Q  P  +++  N+  +   Y  K     H LN+ + +  ++ RK TFD E+FFN+LLPPIIF AGY++K++HFF NLG+I ++AFLGT +S   IG + YG   L +    ++    F +CLLFG+ +SATDPVTVLAIF+++ ++V+LYA +FGESVLNDAVAIVL +S+  Y    +N   F+  A+  +   F+ +F G+ ++G   G+ TALVTK+T LR+  LLET LFFLMS+ +FL+AE  G +G+VA LFCGITQAHYTYNNLS ESQ  TK +FEL++FL+ENF+F Y+G++ FTF++H + P F+  A  AI +GRA N+Y LS +LNLGR++KI  N QHM+MFAG+RGAMAFALAIR+T++  RQM FSTTL+IV  TV++ GG T  M++ L IR+G D++     +PE               NER   K   A+L RM+   D  ++KPLLTHS P L  T P CC   A+ LT+ +       L+   +++ ++
Sbjct:    1 MDEEIVS---EKQAEESHRQDSANLLIFILLLTLTILTIWLFKHRRARFLHETGLAMIYGLLVGLVLRYGIHVPSDVNNVTLS---------CEVQSSPTTLLV--NVSGKFYEYMLKGEISSHELNNVQDN--EMLRKVTFDPEVFFNILLPPIIFYAGYSLKRRHFFRNLGSILAYAFLGTAISCFVIGSIMYGCVTLMKVTGQLAGDFYFTDCLLFGAIVSATDPVTVLAIFHELQVDVELYALLFGESVLNDAVAIVLSSSIVAYQPAGDNSHTFDVTAMFKSIGIFLGIFSGSFAMGAATGVVTALVTKFTKLREFQLLETGLFFLMSWSTFLLAEAWGFTGVVAVLFCGITQAHYTYNNLSTESQHRTKQLFELLNFLAENFIFSYMGLTLFTFQNHVFNPTFVVGAFVAIFLGRAANIYPLSLLLNLGRRSKIGSNFQHMMMFAGLRGAMAFALAIRDTATYARQMMFSTTLLIVFFTVWVFGGGTTAMLSCLHIRVGVDSDQEHLGVPE---------------NERRTTKAESAWLFRMWYNFDHNYLKPLLTHSGPPLTTTLPACCGPIARCLTSPQAYENQEQLKDDDSDLILN 574          
BLAST of slc9a-2 vs. Ensembl Celegans
Match: nhx-5 (Sodium/hydrogen exchanger [Source:UniProtKB/TrEMBL;Acc:G5ECW8])

HSP 1 Score: 419.468 bits (1077), Expect = 3.545e-137
Identity = 249/583 (42.71%), Postives = 362/583 (62.09%), Query Frame = 3
Query:   81 LEQSREEKVQQNHKTDXXXXXXXXXXXXXXXXXXXXFKHKRLRFVHETSCSLIYGLILGVIFYNLPIDVNKVTTTLQMPQSKTNCAYQLPPDNIILEMNLLNRTSPYTFKYRHV----LNDHESDAKDLSRKATFDAEIFFNLLLPPIIFCAGYNMKKKHFFENLGAIASFAFLGTILSSLTIGGLCYGLSRTITSISD-SIGFGECLLFGSFISATDPVTVLAIFNDINIEVDLYAFVFGESVLNDAVAIVLVNSVEQYGKIANNGEFNPFAILIAAKSFMTVFLGALSIGCVVGICTALVTKYTYLRDHPLLETSLFFLMSYCSFLIAEVAGASGIVASLFCGITQAHYTYNNLSEESQKWTKGIFELMSFLSENFVFVYIGVSNFTFRDHNWQPRFICIAIFAIIVGRAVNVYILSAMLNLGRKNKIKFNHQHMLMFAGVRGAMAFALAIRNTSSKVRQMFFSTTLVIVMVTVFICGGLTLPMINFLKIRIGKD-----NEITDSI-PEPADDTTISDEQV---LDLNERHKKKAFLIRMFAKLDCQFIKPLLTHSPPLLIDTCPLCCFTFAKFLTTSEQ 1787
            L+ + + +    H+ D++ILL+++ ++++ V+T W FKH R RF+HE+  +L YGL++G +     + + +  T   + ++KT    + PPD ++LE+      S  +F Y  +     +  +   + + +K+ F  E+FFN+L+PPIIF AGY++KK+HFF N+G+I +  F+GT +S    G L +      TSI      F E L FG+ ISATDPVT++++FND+N+E DL+A +FGES LNDAVAIVL   +E +   +       F   IA   F  VF G+L +G ++G   A +TK T + +H LLE+SLF L+SY SFL+AEV G +GIV+ LFCGI QAHYTYNNLS+ESQ  TK  F ++SF+ E+F+F YIGVS F   +  W   F+  ++ +I   RA+ VY LS +LN+ R+ KI   +QHM++FAG+RGAMAFALA RNTS++ RQM F+TT  +V+VTV + GGLT  MI++L+I+ GKD       + +S+   PAD  +  DE V   +        KAFL R +   D  F+KPLLTH+ P L  T P  C      LT+S Q
Sbjct:   27 LDMAAQRRASNIHRMDTIILLTYVSVMVLIVVTAWAFKHYRFRFIHESGVTLFYGLLIGFVIRYFGLGLLQSQTFDVITKNKT--IVKEPPDYLMLEVKP-EGGSRVSFHYELIEGFFADKRKKIEQQIEQKSVFSPEVFFNMLIPPIIFNAGYSLKKRHFFRNIGSILAIVFIGTTISCFGTGCLMF----VFTSIFQMGYSFKELLFFGALISATDPVTIISVFNDMNVEADLFALIFGESALNDAVAIVLSEVIENFSTSSEAITLQDFGSAIAG--FAGVFFGSLMLGFMIGCMNAFLTKMTLISEHALLESSLFVLISYISFLVAEVCGLTGIVSVLFCGIAQAHYTYNNLSDESQSNTKHFFHMVSFIMESFIFCYIGVSVFVTNNQRWSFSFLLFSLISITASRALFVYPLSWLLNIRRRPKIPKRYQHMILFAGLRGAMAFALAGRNTSTENRQMIFATTTAVVIVTVLVNGGLTSWMIDYLQIKHGKDAIEEGQRLENSMSSSPADQHSDLDESVPVTMSPGLNPWDKAFLPRKWYHFDASFMKPLLTHATPSLEQTLPPFCLPLTSLLTSSRQ 600          
BLAST of slc9a-2 vs. Ensembl Celegans
Match: nhx-5 (Sodium/hydrogen exchanger [Source:UniProtKB/TrEMBL;Acc:G5ECW8])

HSP 1 Score: 419.468 bits (1077), Expect = 5.302e-137
Identity = 249/583 (42.71%), Postives = 362/583 (62.09%), Query Frame = 3
Query:   81 LEQSREEKVQQNHKTDXXXXXXXXXXXXXXXXXXXXFKHKRLRFVHETSCSLIYGLILGVIFYNLPIDVNKVTTTLQMPQSKTNCAYQLPPDNIILEMNLLNRTSPYTFKYRHV----LNDHESDAKDLSRKATFDAEIFFNLLLPPIIFCAGYNMKKKHFFENLGAIASFAFLGTILSSLTIGGLCYGLSRTITSISD-SIGFGECLLFGSFISATDPVTVLAIFNDINIEVDLYAFVFGESVLNDAVAIVLVNSVEQYGKIANNGEFNPFAILIAAKSFMTVFLGALSIGCVVGICTALVTKYTYLRDHPLLETSLFFLMSYCSFLIAEVAGASGIVASLFCGITQAHYTYNNLSEESQKWTKGIFELMSFLSENFVFVYIGVSNFTFRDHNWQPRFICIAIFAIIVGRAVNVYILSAMLNLGRKNKIKFNHQHMLMFAGVRGAMAFALAIRNTSSKVRQMFFSTTLVIVMVTVFICGGLTLPMINFLKIRIGKD-----NEITDSI-PEPADDTTISDEQV---LDLNERHKKKAFLIRMFAKLDCQFIKPLLTHSPPLLIDTCPLCCFTFAKFLTTSEQ 1787
            L+ + + +    H+ D++ILL+++ ++++ V+T W FKH R RF+HE+  +L YGL++G +     + + +  T   + ++KT    + PPD ++LE+      S  +F Y  +     +  +   + + +K+ F  E+FFN+L+PPIIF AGY++KK+HFF N+G+I +  F+GT +S    G L +      TSI      F E L FG+ ISATDPVT++++FND+N+E DL+A +FGES LNDAVAIVL   +E +   +       F   IA   F  VF G+L +G ++G   A +TK T + +H LLE+SLF L+SY SFL+AEV G +GIV+ LFCGI QAHYTYNNLS+ESQ  TK  F ++SF+ E+F+F YIGVS F   +  W   F+  ++ +I   RA+ VY LS +LN+ R+ KI   +QHM++FAG+RGAMAFALA RNTS++ RQM F+TT  +V+VTV + GGLT  MI++L+I+ GKD       + +S+   PAD  +  DE V   +        KAFL R +   D  F+KPLLTH+ P L  T P  C      LT+S Q
Sbjct:   27 LDMAAQRRASNIHRMDTIILLTYVSVMVLIVVTAWAFKHYRFRFIHESGVTLFYGLLIGFVIRYFGLGLLQSQTFDVITKNKT--IVKEPPDYLMLEVKP-EGGSRVSFHYELIEGFFADKRKKIEQQIEQKSVFSPEVFFNMLIPPIIFNAGYSLKKRHFFRNIGSILAIVFIGTTISCFGTGCLMF----VFTSIFQMGYSFKELLFFGALISATDPVTIISVFNDMNVEADLFALIFGESALNDAVAIVLSEVIENFSTSSEAITLQDFGSAIAG--FAGVFFGSLMLGFMIGCMNAFLTKMTLISEHALLESSLFVLISYISFLVAEVCGLTGIVSVLFCGIAQAHYTYNNLSDESQSNTKHFFHMVSFIMESFIFCYIGVSVFVTNNQRWSFSFLLFSLISITASRALFVYPLSWLLNIRRRPKIPKRYQHMILFAGLRGAMAFALAGRNTSTENRQMIFATTTAVVIVTVLVNGGLTSWMIDYLQIKHGKDAIEEGQRLENSMSSSPADQHSDLDESVPVTMSPGLNPWDKAFLPRKWYHFDASFMKPLLTHATPSLEQTLPPFCLPLTSLLTSSRQ 600          
BLAST of slc9a-2 vs. Ensembl Celegans
Match: nhx-8 (Sodium/hydrogen exchanger [Source:UniProtKB/TrEMBL;Acc:G5EFN1])

HSP 1 Score: 215.698 bits (548), Expect = 4.497e-60
Identity = 132/365 (36.16%), Postives = 206/365 (56.44%), Query Frame = 3
Query:  447 KDLSRKATFDAEIFFNLLLPPIIFCAGYNMKKKHFFENLGAIASFAFLGTILSSLTIGGLCYGLSRTITSISDSIGFGECLLFGSFISATDPVTVLAIFNDINIEVDLYAFVFGESVLNDAVAIVLVNSVEQYGKIANNGEFNPFAILIAAKSFMTVFLGALSIGCVVGICTALVTKYTYLRDHPLLETSLFFLMSYCSFLIAEVAGASGIVASLFCGITQAHYTYNNLSEESQKWTKGIFELMSFLSENFVFVYIGVSNFTFRDHNWQPRFICIAIFAIIVGRAVNVYILSAMLNLGRKN-KIKFNHQHMLMFAGVRGAMAFALAI-RNTSSKVRQMFFSTTLVIVMVTVFICGGLTLPMINFL 1535
            +D S       ++FF +LLPPIIF   YN+ K +FF N   I +FA  GT +S++ IG   Y L      +     F EC  F + ISA DPV  LAIF  + +E  LY  VFGES+LNDAV+IVL  +  ++ K + N       I  A  +F  +F  +  +G  +G+ +AL+ K+  LR  P LE +L  + SY  +  AE    SGI+A LFCGI+ + +T +N+S  +Q   +  F  +SF++E   F YIG++ FT +  N+ P  I  ++   ++GRA NV+ L+ ++N  RK+ +I   +Q ++ F+G+RGA+ FAL +  +   + + +  +T L +++ T    GG  LP I+F+
Sbjct:  133 RDWSEIEALSPDVFFLVLLPPIIFENAYNLNKGYFFSNFVPILTFAIFGTTISAMVIGAGLYILGAI--GLIFEFTFFECFAFAAMISAVDPVGTLAIFQAVKVESLLYMLVFGESMLNDAVSIVLAATALRHAKPSFNSLPASEIITSAFVTFTEMFFFSACLGVGIGLLSALLFKHVDLRKTPSLEFALLLIFSYIPYGFAEALDLSGIMAILFCGISMSQFTRHNVSPIAQITFRHTFRTISFVAETSTFAYIGMAFFTIK-LNFAPWLIFWSVVLCLLGRACNVFPLAYLVNQCRKDVQISMKNQIIMWFSGMRGAVCFALVLYMDLDKEKKSILLTTVLFLILFTTIFLGGSALPFISFI 494          
BLAST of slc9a-2 vs. Ensembl Celegans
Match: nhx-8 (Sodium/hydrogen exchanger [Source:UniProtKB/TrEMBL;Acc:G5EFN1])

HSP 1 Score: 215.312 bits (547), Expect = 9.452e-60
Identity = 134/371 (36.12%), Postives = 208/371 (56.06%), Query Frame = 3
Query:  447 KDLSRKATFDAEIFFNLLLPPIIFCAGYNMKKKHFFENLGAIASFAFLGTILSSLTIGGLCYGLSRTITSISDSIG------FGECLLFGSFISATDPVTVLAIFNDINIEVDLYAFVFGESVLNDAVAIVLVNSVEQYGKIANNGEFNPFAILIAAKSFMTVFLGALSIGCVVGICTALVTKYTYLRDHPLLETSLFFLMSYCSFLIAEVAGASGIVASLFCGITQAHYTYNNLSEESQKWTKGIFELMSFLSENFVFVYIGVSNFTFRDHNWQPRFICIAIFAIIVGRAVNVYILSAMLNLGRKN-KIKFNHQHMLMFAGVRGAMAFALAI-RNTSSKVRQMFFSTTLVIVMVTVFICGGLTLPMINFL 1535
            +D S       ++FF +LLPPIIF   YN+ K +FF N   I +FA  GT +S++ IG   Y        I  +IG      F EC  F + ISA DPV  LAIF  + +E  LY  VFGES+LNDAV+IVL  +  ++ K + N       I  A  +F  +F  +  +G  +G+ +AL+ K+  LR  P LE +L  + SY  +  AE    SGI+A LFCGI+ + +T +N+S  +Q   +  F  +SF++E   F YIG++ FT +  N+ P  I  ++   ++GRA NV+ L+ ++N  RK+ +I   +Q ++ F+G+RGA+ FAL +  +   + + +  +T L +++ T    GG  LP I+F+
Sbjct:  159 RDWSEIEALSPDVFFLVLLPPIIFENAYNLNKGYFFSNFVPILTFAIFGTTISAMVIGAGLY--------ILGAIGLIFEFTFFECFAFAAMISAVDPVGTLAIFQAVKVESLLYMLVFGESMLNDAVSIVLAATALRHAKPSFNSLPASEIITSAFVTFTEMFFFSACLGVGIGLLSALLFKHVDLRKTPSLEFALLLIFSYIPYGFAEALDLSGIMAILFCGISMSQFTRHNVSPIAQITFRHTFRTISFVAETSTFAYIGMAFFTIK-LNFAPWLIFWSVVLCLLGRACNVFPLAYLVNQCRKDVQISMKNQIIMWFSGMRGAVCFALVLYMDLDKEKKSILLTTVLFLILFTTIFLGGSALPFISFI 520          
BLAST of slc9a-2 vs. Ensembl Celegans
Match: nhx-9 (Probable Na(+)/H(+) antiporter nhx-9 [Source:UniProtKB/Swiss-Prot;Acc:P35449])

HSP 1 Score: 202.216 bits (513), Expect = 1.177e-55
Identity = 127/417 (30.46%), Postives = 218/417 (52.28%), Query Frame = 3
Query:  465 ATFDAEIFFNLLLPPIIFCAGYNMKKKHFFENLGAIASFAFLGTILSSLTIGGLCYGLSRTITSISDSIGFGECLLFGSFISATDPVTVLAIFNDINIEVDLYAFVFGESVLNDAVAIVLVNSVEQYGKIANNGEFNPFAILIAAKSFMTVFLGALSIGCVVGICTALVTKYTYLRDHPLLETSLFFLMSYCSFLIAEVAGASGIVASLFCGITQAHYTYNNLSEESQKWTKGIFELMSFLSENFVFVYIGVSNFTFRDHNWQPRFICIAIFAIIVGRAVNVYILSAMLNLGRKNKIKFNHQHMLMFAGVRGAMAFALAIRNTSS-KVRQMFFSTTLVIVMVTVFICGGLTLPMINFLKIRIG--KDNEITDSIPEPADDTTISDEQVLDLNERHKKKAFLIRMFAKLDCQFIKPLL 1706
            AT D+  FF  LLPPIIF AGY M  +  FEN  ++  F+  GTI ++  IGG    +++     + S    E L+F + ISA DPV V+A+F +I++   L+  VFGE++ ND V +VL    + +  I +    +         SF  V LG  ++G +  I  +L TKYTY  D  +L     F++ Y ++L AE+   S I+A   CG+    Y   N+++ +    K   ++++  SE  +F+++G+S  +   H++   FIC  +F  ++ RA+ + +   +LN  R  K +   Q ++ + G+RGA+A+ L +   +S   + MF + T+ ++  TVF+ G    P++NFLKI+    +D  + +S+     D  +S  + +   + H      I  F + + + IKP+L
Sbjct:   33 ATLDSHTFFLYLLPPIIFDAGYFMPNRALFENFDSVLVFSVFGTIWNTFAIGGSLLLMAQ-YDLFTMSFTTFEILVFSALISAVDPVAVIAVFEEIHVNEFLFINVFGEALFNDGVTVVLYQMFKSFALIGSE-NLSVLDYATGGLSFFVVALGGAAVGIIFAIAASLTTKYTY--DVRILAPVFIFVLPYMAYLTAEMVSLSSIIAIAICGMLMKQYIKGNVTQAAANSVKYFTKMLAQSSETVIFMFLGLSTIS-SQHHFDLYFICATLFFCLIYRAIGIVVQCYILNRFRAKKFEMVDQFIMSYGGLRGAIAYGLVVSIPASITAKPMFITATIAVIYFTVFLQGITIRPLVNFLKIKKKEERDPTMVESVYNKYLDYMMSGVEDIAGQKGHYT---FIENFERFNAKVIKPVL 441          
BLAST of slc9a-2 vs. Ensembl Fly
Match: Nhe3 (gene:FBgn0028703 transcript:FBtr0273250)

HSP 1 Score: 476.478 bits (1225), Expect = 2.872e-158
Identity = 281/612 (45.92%), Postives = 382/612 (62.42%), Query Frame = 3
Query:   42 IMVSKCEALNEKILEQSREEKVQQNHKTDXXXXXXXXXXXXXXXXXXXXFKHKRLRFVHETSCSLIYGLILGVIFYNLPIDVNKVTTTLQMPQSKTNCAYQLPPDNIILE--MNLLNRTSP----YTFKYRHVLNDHESDAKDLSRKATFDAEIFFNLLLPPIIFCAGYNMKKKHFFENLGAIASFAFLGTILSSLTIGGLCYGLSRTITS-ISDSIGFGECLLFGSFISATDPVTVLAIFNDINIEVDLYAFVFGESVLNDAVAIVLVNSVEQYGK-IANNGEFNPFAILIAAKSFMTVFLGALSIGCVVGICTALVTKYTYLRDHPLLETSLFFLMSYCSFLIAEVAGASGIVASLFCGITQAHYTYNNLSEESQKWTKGIFELMSFLSENFVFVYIGVSNFTFRDHNWQPRFICIAIFAIIVGRAVNVYILSAMLNLGRKNKIKFNHQHMLMFAGVRGAMAFALAIRNTSSKVRQMFFSTTLVIVMVTVFICGGLTLPMINFLKIRIGKDNEI---------------------------TDS-IPEPADDTTISDEQVLDLNERHK-KKAFLIRMFAKLDCQFIKPLLTHSPPLLIDTCPLCCFTFAK 1766
            ++   C A +  I   + + K   NH+  SL LL F+ LL ++V+TIW+FKH R+ ++HET  ++IYGLI+G I          V   ++ PQ     + +LPPD +     +N  N T P     T+ Y      H+ D  ++  KATFD E+FFN++LPPIIF AGY++KKK+FF NLGAI +FA +GT LS+  IGG  YG  + +   +S S  F + L FG+ IS TDP+T+LAIFND+ ++V+LYA V GESVLNDAVAIVL  +++ YG+  +N GEF   A L +   F ++FL +L IG  +G  TAL+TK+T +RD PLLE++LF LMSY +FL+AE    +G+VA LFCGI QAHYTYNNLSE+S++ TK IFEL++FL+ENF+F YIGVS FTF  H++   FI  A     +GRAVNVY LS +LN+ RK KI  N QHML FAG+RGAM+FALAIRNT S  RQ   + T +IV+ TV I GG    ++N+LKI +G D+E                            TD+ +  P D T  S         R+  +KA L R++   D +++KPLLTHS P L++T P+CC   A+
Sbjct:   11 VLAPGCSATDTDI---ALDAKATLNHRIQSLDLLVFVFLLALTVLTIWLFKHHRVSWLHETGLAVIYGLIVGAIIRYAGTSATLVHMQVE-PQGVPTYSDKLPPDTLWFRYPVNQTNGTKPPEGIKTYAYVFRGQVHDVDENEIDLKATFDPEVFFNIILPPIIFYAGYSLKKKYFFRNLGAILTFAIVGTTLSAFLIGGFMYGCVKLMPKYLSSSFTFLDSLYFGALISPTDPLTILAIFNDLRVDVNLYALVLGESVLNDAVAIVLSGAIQNYGEHYSNTGEFETTAFLRSLSDFFSIFLLSLMIGAAMGCLTALMTKFTRVRDFPLLESALFVLMSYSTFLLAEATELTGVVAVLFCGICQAHYTYNNLSEDSRQRTKQIFELLNFLAENFIFSYIGVSMFTFPKHHFDAGFIITAFICAAIGRAVNVYPLSWLLNIKRKPKISTNFQHMLFFAGLRGAMSFALAIRNTVSDERQTMLTATSLIVIFTVVIQGGAANFLLNWLKIPVGVDDETEQLNNYQVHSDVEGGGVNRNKMRLSGGTDTNLDTPVDGTNGSLGGASGGRRRNSHEKAILARIWGNFDTKYMKPLLTHSRPTLLETLPVCCNPIAR 618          
BLAST of slc9a-2 vs. Ensembl Fly
Match: Nhe3 (gene:FBgn0028703 transcript:FBtr0300327)

HSP 1 Score: 476.478 bits (1225), Expect = 4.354e-158
Identity = 281/612 (45.92%), Postives = 382/612 (62.42%), Query Frame = 3
Query:   42 IMVSKCEALNEKILEQSREEKVQQNHKTDXXXXXXXXXXXXXXXXXXXXFKHKRLRFVHETSCSLIYGLILGVIFYNLPIDVNKVTTTLQMPQSKTNCAYQLPPDNIILE--MNLLNRTSP----YTFKYRHVLNDHESDAKDLSRKATFDAEIFFNLLLPPIIFCAGYNMKKKHFFENLGAIASFAFLGTILSSLTIGGLCYGLSRTITS-ISDSIGFGECLLFGSFISATDPVTVLAIFNDINIEVDLYAFVFGESVLNDAVAIVLVNSVEQYGK-IANNGEFNPFAILIAAKSFMTVFLGALSIGCVVGICTALVTKYTYLRDHPLLETSLFFLMSYCSFLIAEVAGASGIVASLFCGITQAHYTYNNLSEESQKWTKGIFELMSFLSENFVFVYIGVSNFTFRDHNWQPRFICIAIFAIIVGRAVNVYILSAMLNLGRKNKIKFNHQHMLMFAGVRGAMAFALAIRNTSSKVRQMFFSTTLVIVMVTVFICGGLTLPMINFLKIRIGKDNEI---------------------------TDS-IPEPADDTTISDEQVLDLNERHK-KKAFLIRMFAKLDCQFIKPLLTHSPPLLIDTCPLCCFTFAK 1766
            ++   C A +  I   + + K   NH+  SL LL F+ LL ++V+TIW+FKH R+ ++HET  ++IYGLI+G I          V   ++ PQ     + +LPPD +     +N  N T P     T+ Y      H+ D  ++  KATFD E+FFN++LPPIIF AGY++KKK+FF NLGAI +FA +GT LS+  IGG  YG  + +   +S S  F + L FG+ IS TDP+T+LAIFND+ ++V+LYA V GESVLNDAVAIVL  +++ YG+  +N GEF   A L +   F ++FL +L IG  +G  TAL+TK+T +RD PLLE++LF LMSY +FL+AE    +G+VA LFCGI QAHYTYNNLSE+S++ TK IFEL++FL+ENF+F YIGVS FTF  H++   FI  A     +GRAVNVY LS +LN+ RK KI  N QHML FAG+RGAM+FALAIRNT S  RQ   + T +IV+ TV I GG    ++N+LKI +G D+E                            TD+ +  P D T  S         R+  +KA L R++   D +++KPLLTHS P L++T P+CC   A+
Sbjct:   11 VLAPGCSATDTDI---ALDAKATLNHRIQSLDLLVFVFLLALTVLTIWLFKHHRVSWLHETGLAVIYGLIVGAIIRYAGTSATLVHMQVE-PQGVPTYSDKLPPDTLWFRYPVNQTNGTKPPEGIKTYAYVFRGQVHDVDENEIDLKATFDPEVFFNIILPPIIFYAGYSLKKKYFFRNLGAILTFAIVGTTLSAFLIGGFMYGCVKLMPKYLSSSFTFLDSLYFGALISPTDPLTILAIFNDLRVDVNLYALVLGESVLNDAVAIVLSGAIQNYGEHYSNTGEFETTAFLRSLSDFFSIFLLSLMIGAAMGCLTALMTKFTRVRDFPLLESALFVLMSYSTFLLAEATELTGVVAVLFCGICQAHYTYNNLSEDSRQRTKQIFELLNFLAENFIFSYIGVSMFTFPKHHFDAGFIITAFICAAIGRAVNVYPLSWLLNIKRKPKISTNFQHMLFFAGLRGAMSFALAIRNTVSDERQTMLTATSLIVIFTVVIQGGAANFLLNWLKIPVGVDDETEQLNNYQVHSDVEGGGVNRNKMRLSGGTDTNLDTPVDGTNGSLGGASGGRRRNSHEKAILARIWGNFDTKYMKPLLTHSRPTLLETLPVCCNPIAR 618          
BLAST of slc9a-2 vs. Ensembl Fly
Match: Nhe3 (gene:FBgn0028703 transcript:FBtr0333348)

HSP 1 Score: 474.937 bits (1221), Expect = 1.185e-157
Identity = 281/618 (45.47%), Postives = 382/618 (61.81%), Query Frame = 3
Query:   42 IMVSKCEALNEKILEQSREEKVQQNHKTDXXXXXXXXXXXXXXXXXXXXFKHKRLRFVHETSCSLIYGLILGVIFYNLPIDVNKVTTTLQMPQSKTNCAYQLPPDNIILE--MNLLNRTSP----YTFKYRHVLNDHESDAKDLSRKATFDAEIFFNLLLPPIIFCAGYNMKKKHFFENLGAIASFAFLGTILSSLTIGGLCYGLSRTITS-ISDSIGFGECLLFGSFISATDPVTVLAIFNDINIEVDLYAFVFGESVLNDAVAIVLVNSVEQYGK-IANNGEFNPFAILIAAKSFMTVFLGALSIGCVVGICTALVTKYTYLRDHPLLETSLFFLMSYCSFLIAEVAGASGIVASLFCGITQAHYTYNNLSEESQKWTKGIFELMSFLSENFVFVYIGVSNFTFRDHNWQPRFICIAIFAIIVGRAVNVYILSAMLNLGRKNKIKFNHQHMLMFAGVRGAMAFALAIRNTSSKVRQMFFSTTLVIVMVTVFICGGLTLPMINFLKIRIGKDNEI---------------------------------TDS-IPEPADDTTISDEQVLDLNERHK-KKAFLIRMFAKLDCQFIKPLLTHSPPLLIDTCPLCCFTFAK 1766
            ++   C A +  I   + + K   NH+  SL LL F+ LL ++V+TIW+FKH R+ ++HET  ++IYGLI+G I          V   ++ PQ     + +LPPD +     +N  N T P     T+ Y      H+ D  ++  KATFD E+FFN++LPPIIF AGY++KKK+FF NLGAI +FA +GT LS+  IGG  YG  + +   +S S  F + L FG+ IS TDP+T+LAIFND+ ++V+LYA V GESVLNDAVAIVL  +++ YG+  +N GEF   A L +   F ++FL +L IG  +G  TAL+TK+T +RD PLLE++LF LMSY +FL+AE    +G+VA LFCGI QAHYTYNNLSE+S++ TK IFEL++FL+ENF+F YIGVS FTF  H++   FI  A     +GRAVNVY LS +LN+ RK KI  N QHML FAG+RGAM+FALAIRNT S  RQ   + T +IV+ TV I GG    ++N+LKI +G D+E                                  TD+ +  P D T  S         R+  +KA L R++   D +++KPLLTHS P L++T P+CC   A+
Sbjct:   11 VLAPGCSATDTDI---ALDAKATLNHRIQSLDLLVFVFLLALTVLTIWLFKHHRVSWLHETGLAVIYGLIVGAIIRYAGTSATLVHMQVE-PQGVPTYSDKLPPDTLWFRYPVNQTNGTKPPEGIKTYAYVFRGQVHDVDENEIDLKATFDPEVFFNIILPPIIFYAGYSLKKKYFFRNLGAILTFAIVGTTLSAFLIGGFMYGCVKLMPKYLSSSFTFLDSLYFGALISPTDPLTILAIFNDLRVDVNLYALVLGESVLNDAVAIVLSGAIQNYGEHYSNTGEFETTAFLRSLSDFFSIFLLSLMIGAAMGCLTALMTKFTRVRDFPLLESALFVLMSYSTFLLAEATELTGVVAVLFCGICQAHYTYNNLSEDSRQRTKQIFELLNFLAENFIFSYIGVSMFTFPKHHFDAGFIITAFICAAIGRAVNVYPLSWLLNIKRKPKISTNFQHMLFFAGLRGAMSFALAIRNTVSDERQTMLTATSLIVIFTVVIQGGAANFLLNWLKIPVGVDDETEQLNNYQVHSSDGYLQDVEGGGVNRNKMRLSGGTDTNLDTPVDGTNGSLGGASGGRRRNSHEKAILARIWGNFDTKYMKPLLTHSRPTLLETLPVCCNPIAR 624          
BLAST of slc9a-2 vs. Ensembl Fly
Match: Nhe3 (gene:FBgn0028703 transcript:FBtr0273248)

HSP 1 Score: 474.552 bits (1220), Expect = 2.217e-157
Identity = 281/618 (45.47%), Postives = 382/618 (61.81%), Query Frame = 3
Query:   42 IMVSKCEALNEKILEQSREEKVQQNHKTDXXXXXXXXXXXXXXXXXXXXFKHKRLRFVHETSCSLIYGLILGVIFYNLPIDVNKVTTTLQMPQSKTNCAYQLPPDNIILE--MNLLNRTSP----YTFKYRHVLNDHESDAKDLSRKATFDAEIFFNLLLPPIIFCAGYNMKKKHFFENLGAIASFAFLGTILSSLTIGGLCYGLSRTITS-ISDSIGFGECLLFGSFISATDPVTVLAIFNDINIEVDLYAFVFGESVLNDAVAIVLVNSVEQYGK-IANNGEFNPFAILIAAKSFMTVFLGALSIGCVVGICTALVTKYTYLRDHPLLETSLFFLMSYCSFLIAEVAGASGIVASLFCGITQAHYTYNNLSEESQKWTKGIFELMSFLSENFVFVYIGVSNFTFRDHNWQPRFICIAIFAIIVGRAVNVYILSAMLNLGRKNKIKFNHQHMLMFAGVRGAMAFALAIRNTSSKVRQMFFSTTLVIVMVTVFICGGLTLPMINFLKIRIGKDNEI---------------------------------TDS-IPEPADDTTISDEQVLDLNERHK-KKAFLIRMFAKLDCQFIKPLLTHSPPLLIDTCPLCCFTFAK 1766
            ++   C A +  I   + + K   NH+  SL LL F+ LL ++V+TIW+FKH R+ ++HET  ++IYGLI+G I          V   ++ PQ     + +LPPD +     +N  N T P     T+ Y      H+ D  ++  KATFD E+FFN++LPPIIF AGY++KKK+FF NLGAI +FA +GT LS+  IGG  YG  + +   +S S  F + L FG+ IS TDP+T+LAIFND+ ++V+LYA V GESVLNDAVAIVL  +++ YG+  +N GEF   A L +   F ++FL +L IG  +G  TAL+TK+T +RD PLLE++LF LMSY +FL+AE    +G+VA LFCGI QAHYTYNNLSE+S++ TK IFEL++FL+ENF+F YIGVS FTF  H++   FI  A     +GRAVNVY LS +LN+ RK KI  N QHML FAG+RGAM+FALAIRNT S  RQ   + T +IV+ TV I GG    ++N+LKI +G D+E                                  TD+ +  P D T  S         R+  +KA L R++   D +++KPLLTHS P L++T P+CC   A+
Sbjct:   11 VLAPGCSATDTDI---ALDAKATLNHRIQSLDLLVFVFLLALTVLTIWLFKHHRVSWLHETGLAVIYGLIVGAIIRYAGTSATLVHMQVE-PQGVPTYSDKLPPDTLWFRYPVNQTNGTKPPEGIKTYAYVFRGQVHDVDENEIDLKATFDPEVFFNIILPPIIFYAGYSLKKKYFFRNLGAILTFAIVGTTLSAFLIGGFMYGCVKLMPKYLSSSFTFLDSLYFGALISPTDPLTILAIFNDLRVDVNLYALVLGESVLNDAVAIVLSGAIQNYGEHYSNTGEFETTAFLRSLSDFFSIFLLSLMIGAAMGCLTALMTKFTRVRDFPLLESALFVLMSYSTFLLAEATELTGVVAVLFCGICQAHYTYNNLSEDSRQRTKQIFELLNFLAENFIFSYIGVSMFTFPKHHFDAGFIITAFICAAIGRAVNVYPLSWLLNIKRKPKISTNFQHMLFFAGLRGAMSFALAIRNTVSDERQTMLTATSLIVIFTVVIQGGAANFLLNWLKIPVGVDDETEQLNNYQVHSSDGYLQDVEGGGVNRNKMRLSGGTDTNLDTPVDGTNGSLGGASGGRRRNSHEKAILARIWGNFDTKYMKPLLTHSRPTLLETLPVCCNPIAR 624          
BLAST of slc9a-2 vs. Ensembl Fly
Match: Nhe3 (gene:FBgn0028703 transcript:FBtr0273247)

HSP 1 Score: 470.315 bits (1209), Expect = 1.807e-155
Identity = 282/631 (44.69%), Postives = 385/631 (61.01%), Query Frame = 3
Query:   42 IMVSKCEALNEKILEQSREEKVQQNHKTDXXXXXXXXXXXXXXXXXXXXFKHKRLRFVHETSCSLIYGLILGVIFYNLPIDVNKVTTTLQMPQSKTNCAYQLPPDNIILE--MNLLNRTSP----YTFKYRHVLNDHESDAKDLSRKATFDAEIFFNLLLPPIIFCAGYNMKKKHFFENLGAIASFAFLGTILSSLTIGGLCYGLSRTITS-ISDSIGFGECLLFGSFISATDPVTVLAIFNDINIEVDLYAFVFGESVLNDAVAIVLVNSVEQYGK-IANNGEFNPFAILIAAKSFMTVFLGALSIGCVVGICTALVTKYTYLRDHPLLETSLFFLMSYCSFLIAEVAGASGIVASLFCGITQAHYTYNNLSEESQKWTKGIFELMSFLSENFVFVYIGVSNFTFRDHNWQPRFICIAIFAIIVGRAVNVYILSAMLNLGRKNKIKFNHQHMLMFAGVRGAMAFALAIRNTSSKVRQMFFSTTLVIVMVTVFICGGLTLPMINFLKIRIGKDNE---------------ITDSIPEPAD----------------------DTTISDEQVLDLN-----------ERHKKKAFLIRMFAKLDCQFIKPLLTHSPPLLIDTCPLCCFTFAK 1766
            ++   C A +  I   + + K   NH+  SL LL F+ LL ++V+TIW+FKH R+ ++HET  ++IYGLI+G I          V   ++ PQ     + +LPPD +     +N  N T P     T+ Y      H+ D  ++  KATFD E+FFN++LPPIIF AGY++KKK+FF NLGAI +FA +GT LS+  IGG  YG  + +   +S S  F + L FG+ IS TDP+T+LAIFND+ ++V+LYA V GESVLNDAVAIVL  +++ YG+  +N GEF   A L +   F ++FL +L IG  +G  TAL+TK+T +RD PLLE++LF LMSY +FL+AE    +G+VA LFCGI QAHYTYNNLSE+S++ TK IFEL++FL+ENF+F YIGVS FTF  H++   FI  A     +GRAVNVY LS +LN+ RK KI  N QHML FAG+RGAM+FALAIRNT S  RQ   + T +IV+ TV I GG    ++N+LKI +G D+E               + +S P+ +D                      DT + D  V   N               +KA L R++   D +++KPLLTHS P L++T P+CC   A+
Sbjct:   11 VLAPGCSATDTDI---ALDAKATLNHRIQSLDLLVFVFLLALTVLTIWLFKHHRVSWLHETGLAVIYGLIVGAIIRYAGTSATLVHMQVE-PQGVPTYSDKLPPDTLWFRYPVNQTNGTKPPEGIKTYAYVFRGQVHDVDENEIDLKATFDPEVFFNIILPPIIFYAGYSLKKKYFFRNLGAILTFAIVGTTLSAFLIGGFMYGCVKLMPKYLSSSFTFLDSLYFGALISPTDPLTILAIFNDLRVDVNLYALVLGESVLNDAVAIVLSGAIQNYGEHYSNTGEFETTAFLRSLSDFFSIFLLSLMIGAAMGCLTALMTKFTRVRDFPLLESALFVLMSYSTFLLAEATELTGVVAVLFCGICQAHYTYNNLSEDSRQRTKQIFELLNFLAENFIFSYIGVSMFTFPKHHFDAGFIITAFICAAIGRAVNVYPLSWLLNIKRKPKISTNFQHMLFFAGLRGAMSFALAIRNTVSDERQTMLTATSLIVIFTVVIQGGAANFLLNWLKIPVGVDDETEQLNNYQVHSVYNSMDNSHPQTSDGYLQDVEGGGVNRNKMRLSGGTDTNL-DTPVDGTNGSLGGASGGRRRNSHEKAILARIWGNFDTKYMKPLLTHSRPTLLETLPVCCNPIAR 636          
BLAST of slc9a-2 vs. Ensembl Zebrafish
Match: slc9a6a (solute carrier family 9 member A6 [Source:ZFIN;Acc:ZDB-GENE-070424-104])

HSP 1 Score: 512.301 bits (1318), Expect = 7.704e-172
Identity = 279/607 (45.96%), Postives = 406/607 (66.89%), Query Frame = 3
Query:   54 KCEALNEKILEQ-SREEKVQQNHKTDXXXXXXXXXXXXXXXXXXXXFKHKRLRFVHETSCSLIYGLILGVIFY---NLPIDVNKVTTTLQMPQSKTNCAYQLPPDNIILEMNLLNRTSPYTFKYR---HVLNDHESDAKDLSRKATFDAEIFFNLLLPPIIFCAGYNMKKKHFFENLGAIASFAFLGTILSSLTIGGLCYG---LSRTITSISDSIGFGECLLFGSFISATDPVTVLAIFNDINIEVDLYAFVFGESVLNDAVAIVLVNSVEQYGKIANNGE-FNPFAILIAAKSFMTVFLGALSIGCVVGICTALVTKYTYLRDHPLLETSLFFLMSYCSFLIAEVAGASGIVASLFCGITQAHYTYNNLSEESQKWTKGIFELMSFLSENFVFVYIGVSNFTFRDHNWQPRFICIAIFAIIVGRAVNVYILSAMLNLGRKNKIKFNHQHMLMFAGVRGAMAFALAIRNTSSKVRQMFFSTTLVIVMVTVFICGGLTLPMINFLKIRIGKDNEITDSI-PEPADDTTISDEQVLDLNERHKKKAFLIRMFAKLDCQFIKPLLTHSPPLLIDTCPLCCFTFAKFLTTSEQISRNSHLRISKNNISMD 1838
            +C A  +  +E    E+K +++H+ DS  LL F++LL ++++TIW+FKH+R RF+HET  ++IYGL++GV+     ++P D+N VT +         C     P  +++  N+  +   YT K     + +ND + +  ++ RK TFD E+FFN+LLPPIIF AGY++K++HFF NLG+I ++AF+GT++S   IG L YG   L + I  + D   F +CL FG+ +SATDPVTVLAIFN++ ++ DLYA +FGESVLNDAVA+VL +S+  Y    +N   F   A+L +   F+ VF G+ ++G   GI TALVTK+T LRD PLLET+LFFLMS+ +FL+AE  G +G+VA LFCG+TQAHYT+NNLS ESQ  TK +FEL++FL+ENF+F Y+G++ FTF++H + P FI  A  A+ +GRA N+Y LS +LNLGR+NKI  N QHM+MFAG+RGAM FAL+IR+T++  RQM FSTTL++V  TV+ICGG T  M++  KIR+G D +  +SI P+  +  +   E            A+L R++   D  ++KP+LTHS P L  T P CC   A+ LT+ +       L+ + +++ ++
Sbjct:   33 QCGAEEDSAMENIVTEKKAEESHRQDSADLLIFIMLLTLTILTIWLFKHRRFRFLHETGLAMIYGLLVGVVLRYAIHVPSDINNVTLS---------CHVNASPATLLV--NVSGKFYEYTLKGEIGANKVNDIQDN--EMLRKVTFDPEVFFNILLPPIIFHAGYSLKRRHFFRNLGSILAYAFVGTVVSCFIIGALMYGCVMLMKKIGHLQDDFFFTDCLFFGAIVSATDPVTVLAIFNELQVDADLYALLFGESVLNDAVAVVLSSSIVAYQPTGDNSHTFEAMAMLKSFGIFLGVFSGSFALGVATGIVTALVTKFTKLRDFPLLETALFFLMSWSTFLLAEACGFTGVVAVLFCGMTQAHYTFNNLSPESQDRTKQLFELLNFLAENFIFSYMGLTLFTFQNHVFNPIFIVCAFLAVFLGRAANIYPLSFLLNLGRRNKISSNFQHMMMFAGLRGAMTFALSIRDTATYARQMMFSTTLLVVFFTVWICGGGTTQMLSCQKIRVGVDTDHENSIGPDGVERRSTKQE-----------SAWLFRIWYNFDHNYLKPILTHSGPPLTATLPACCSPLARCLTSPQAYENEGELKNADSDLILN 615          
BLAST of slc9a-2 vs. Ensembl Zebrafish
Match: slc9a6a (solute carrier family 9 member A6 [Source:ZFIN;Acc:ZDB-GENE-070424-104])

HSP 1 Score: 503.827 bits (1296), Expect = 1.438e-168
Identity = 276/608 (45.39%), Postives = 405/608 (66.61%), Query Frame = 3
Query:   54 KCEALNEKILEQ-SREEKVQQNHKTDXXXXXXXXXXXXXXXXXXXXFKHKRLRFVHETSCSLIYGLILGVIFY---NLPIDVNKVTTTLQMPQSKTNCAYQLPPDNIILEMNLLNRTSPYTFKYR---HVLNDHESDAKDLSRKATFDAEIFFNLLLPPIIFCAGYNMKKKHFFENLGAIASFAFLGTILSSLTIGGLCYG---LSRTITSISDSIGFGECLLFGSFISATDPVTVLAIFNDINIEVDLYAFVFGESVLNDAVAIVLVNSVEQYGKIANNGE-FNPFAILIAAKSFMTVFLGALSIGCVVGICTALVT-KYTYLRDHPLLETSLFFLMSYCSFLIAEVAGASGIVASLFCGITQAHYTYNNLSEESQKWTKGIFELMSFLSENFVFVYIGVSNFTFRDHNWQPRFICIAIFAIIVGRAVNVYILSAMLNLGRKNKIKFNHQHMLMFAGVRGAMAFALAIRNTSSKVRQMFFSTTLVIVMVTVFICGGLTLPMINFLKIRIGKDNEITDSI-PEPADDTTISDEQVLDLNERHKKKAFLIRMFAKLDCQFIKPLLTHSPPLLIDTCPLCCFTFAKFLTTSEQISRNSHLRISKNNISMD 1838
            +C A  +  +E    E+K +++H+ DS  LL F++LL ++++TIW+FKH+R RF+HET  ++IYGL++GV+     ++P D+N VT +         C     P  +++  N+  +   YT K     + +ND + +  ++ RK TFD E+FFN+LLPPIIF AGY++K++HFF NLG+I ++AF+GT++S   IG L YG   L + I  + D   F +CL FG+ +SATDPVTVLAIFN++ ++ DLYA +FGESVLNDAVA+VL +S+  Y    +N   F   A+L +   F+ VF G+ ++G   GI TAL++  +T LRD PLLET+LFFLMS+ +FL+AE  G +G+VA LFCG+TQAHYT+NNLS ESQ  TK +FEL++FL+ENF+F Y+G++ FTF++H + P FI  A  A+ +GRA N+Y LS +LNLGR+NKI  N QHM+MFAG+RGAM FAL+IR+T++  RQM FSTTL++V  TV+ICGG T  M++  KIR+G D +  +SI P+  +  +   E            A+L R++   D  ++KP+LTHS P L  T P CC   A+ LT+ +       L+ + +++ ++
Sbjct:   33 QCGAEEDSAMENIVTEKKAEESHRQDSADLLIFIMLLTLTILTIWLFKHRRFRFLHETGLAMIYGLLVGVVLRYAIHVPSDINNVTLS---------CHVNASPATLLV--NVSGKFYEYTLKGEIGANKVNDIQDN--EMLRKVTFDPEVFFNILLPPIIFHAGYSLKRRHFFRNLGSILAYAFVGTVVSCFIIGALMYGCVMLMKKIGHLQDDFFFTDCLFFGAIVSATDPVTVLAIFNELQVDADLYALLFGESVLNDAVAVVLSSSIVAYQPTGDNSHTFEAMAMLKSFGIFLGVFSGSFALGVATGIVTALISFTFTKLRDFPLLETALFFLMSWSTFLLAEACGFTGVVAVLFCGMTQAHYTFNNLSPESQDRTKQLFELLNFLAENFIFSYMGLTLFTFQNHVFNPIFIVCAFLAVFLGRAANIYPLSFLLNLGRRNKISSNFQHMMMFAGLRGAMTFALSIRDTATYARQMMFSTTLLVVFFTVWICGGGTTQMLSCQKIRVGVDTDHENSIGPDGVERRSTKQE-----------SAWLFRIWYNFDHNYLKPILTHSGPPLTATLPACCSPLARCLTSPQAYENEGELKNADSDLILN 616          
BLAST of slc9a-2 vs. Ensembl Zebrafish
Match: slc9a7 (solute carrier family 9 member 7 [Source:ZFIN;Acc:ZDB-GENE-050913-8])

HSP 1 Score: 503.056 bits (1294), Expect = 5.263e-168
Identity = 284/644 (44.10%), Postives = 424/644 (65.84%), Query Frame = 3
Query:   45 MVSKC---EALNEKILEQSREEKVQQNHKTDXXXXXXXXXXXXXXXXXXXXFKHKRLRFVHETSCSLIYGLILGVIF-YNLPIDVNKVTTTLQMPQSKTNCAYQLPPDNIILEMNLLNRTSPYTFKYRHVLND-HESDAKDLSRKATFDAEIFFNLLLPPIIFCAGYNMKKKHFFENLGAIASFAFLGTILSSLTIGGLCYG---LSRTITSISDSIGFGECLLFGSFISATDPVTVLAIFNDINIEVDLYAFVFGESVLNDAVAIVLVNSVEQYGKI-ANNGEFNPFAILIAAKSFMTVFLGALSIGCVVGICTALVTKYTYLRDHPLLETSLFFLMSYCSFLIAEVAGASGIVASLFCGITQAHYTYNNLSEESQKWTKGIFELMSFLSENFVFVYIGVSNFTFRDHNWQPRFICIAIFAIIVGRAVNVYILSAMLNLGRKNKIKFNHQHMLMFAGVRGAMAFALAIRNTSSKVRQMFFSTTLVIVMVTVFICGGLTLPMINFLKIRIGKDNEIT-----------------DSIPEPADDT----TISDEQVLDLNERHKKKAFLIRMFAKLDCQFIKPLLTHSPPLLIDTCPLCCFTFAKFLTTSEQISRNSHLRISKNNISMDMTGDNMAYKSDRDLTS 1886
            ++S+C    A +  I E + E++ +++H+ DS+ LL+F++LL ++++TIW+FKH+R+RF+HET  ++IYGL++GVI  Y +P       +T    ++  +C  +  P + +L +N+  +   YT K    L + H  +  D+ RK TFD E+FFN+LLPPIIF AGY++KK+HFF NLG+I ++AFLGT +S   IG L YG   L + +  ++D   + +CL FG+ ISATDPVTVLAIFN+++ + DLYA +FGESV+NDAV+IVL +S+  Y    AN   F+  A   +   F+ +F G+ ++G V G+ TALVTK+T L   PLLET+LFFLMS+ +FL+AE  G +G+VA LFCGITQAHYTYNNLSEES K TK +FE++ FL+ENF+F Y+G++ FTF++H + P FI  A  AI +GRA+N+Y LS ++NLGR++KI+ N QHM+MFAG+RGAMAFALAIR+T++  RQM F+TTL+IV  TV++ GG T PM+++L IR+G+ ++                   D   +P  D+         Q    ++  ++ A+L R++   D  ++KP+LTHS P L  T P CC   A+ LT+ +    +  LR + +++ ++  GD      D  +T+
Sbjct:   27 ILSQCYRISADDGGIEELATEKEAEESHRQDSVNLLTFILLLTLTILTIWLFKHRRVRFLHETGLAMIYGLLVGVILRYGIP-------STSYHNKTPPSCMLKEGPVSTVL-LNVSGKFFEYTLKGEINLREIHSVEQNDMLRKLTFDPEVFFNILLPPIIFHAGYSLKKRHFFRNLGSIITYAFLGTAISCFVIGNLMYGVVKLMQVLGQLTDKFYYTDCLFFGAIISATDPVTVLAIFNELHADGDLYALLFGESVMNDAVSIVLSSSIVAYQPSGANTHTFDASAFFKSVGVFIGIFSGSFAMGAVTGVVTALVTKFTKLHCFPLLETALFFLMSWSTFLLAEACGFTGVVAVLFCGITQAHYTYNNLSEESTKRTKQLFEVLHFLAENFIFSYMGLALFTFQNHVFSPIFIVGAFLAIFIGRALNIYPLSFLINLGRRHKIRGNFQHMMMFAGLRGAMAFALAIRDTATYARQMMFTTTLLIVFFTVWVFGGGTTPMLSWLHIRVGESSDAEKERMRRLWNYDRVGVDPDQDLQPCGDSFQVLQGDGSQSEGQSKTKQESAWLFRLWYTFDHNYLKPILTHSGPPLTSTLPACCGPLARCLTSPQAYETHEPLRDNDSDLILN-EGDLTLTYGDTAITA 661          
BLAST of slc9a-2 vs. Ensembl Zebrafish
Match: slc9a7 (solute carrier family 9 member 7 [Source:ZFIN;Acc:ZDB-GENE-050913-8])

HSP 1 Score: 502.671 bits (1293), Expect = 7.416e-168
Identity = 284/645 (44.03%), Postives = 424/645 (65.74%), Query Frame = 3
Query:   45 MVSKC---EALNEKILEQSREEKVQQNHKTDXXXXXXXXXXXXXXXXXXXXFKHKRLRFVHETSCSLIYGLILGVIF-YNLPIDVNKVTTTLQMPQSKTNCAYQLPPDNIILEMNLLNRTSPYTFKYRHVLND-HESDAKDLSRKATFDAEIFFNLLLPPIIFCAGYNMKKKHFFENLGAIASFAFLGTILSSLTIGGLCYG---LSRTITSISDSIGFGECLLFGSFISATDPVTVLAIFNDINIEVDLYAFVFGESVLNDAVAIVLVNSVEQYGKI-ANNGEFNPFAILIAAKSFMTVFLGALSIGCVVGICTALVTKYTYLRDHPLLETSLFFLMSYCSFLIAEVAGASGIVASLFCGITQAHYTYNNLSEESQKWTKGIFELMSFLSENFVFVYIGVSNFTFRDHNWQPRFICIAIFAIIVGRAVNVYILSAMLNLGRKNKIKFNHQHMLMFAGVRGAMAFALAIRNTSSKVRQMFFSTTLVIVMVTVFICGGLTLPMINFLKIRIGKDNEIT------------------DSIPEPADDT----TISDEQVLDLNERHKKKAFLIRMFAKLDCQFIKPLLTHSPPLLIDTCPLCCFTFAKFLTTSEQISRNSHLRISKNNISMDMTGDNMAYKSDRDLTS 1886
            ++S+C    A +  I E + E++ +++H+ DS+ LL+F++LL ++++TIW+FKH+R+RF+HET  ++IYGL++GVI  Y +P       +T    ++  +C  +  P + +L +N+  +   YT K    L + H  +  D+ RK TFD E+FFN+LLPPIIF AGY++KK+HFF NLG+I ++AFLGT +S   IG L YG   L + +  ++D   + +CL FG+ ISATDPVTVLAIFN+++ + DLYA +FGESV+NDAV+IVL +S+  Y    AN   F+  A   +   F+ +F G+ ++G V G+ TALVTK+T L   PLLET+LFFLMS+ +FL+AE  G +G+VA LFCGITQAHYTYNNLSEES K TK +FE++ FL+ENF+F Y+G++ FTF++H + P FI  A  AI +GRA+N+Y LS ++NLGR++KI+ N QHM+MFAG+RGAMAFALAIR+T++  RQM F+TTL+IV  TV++ GG T PM+++L IR+G+ ++                    D   +P  D+         Q    ++  ++ A+L R++   D  ++KP+LTHS P L  T P CC   A+ LT+ +    +  LR + +++ ++  GD      D  +T+
Sbjct:   27 ILSQCYRISADDGGIEELATEKEAEESHRQDSVNLLTFILLLTLTILTIWLFKHRRVRFLHETGLAMIYGLLVGVILRYGIP-------STSYHNKTPPSCMLKEGPVSTVL-LNVSGKFFEYTLKGEINLREIHSVEQNDMLRKLTFDPEVFFNILLPPIIFHAGYSLKKRHFFRNLGSIITYAFLGTAISCFVIGNLMYGVVKLMQVLGQLTDKFYYTDCLFFGAIISATDPVTVLAIFNELHADGDLYALLFGESVMNDAVSIVLSSSIVAYQPSGANTHTFDASAFFKSVGVFIGIFSGSFAMGAVTGVVTALVTKFTKLHCFPLLETALFFLMSWSTFLLAEACGFTGVVAVLFCGITQAHYTYNNLSEESTKRTKQLFEVLHFLAENFIFSYMGLALFTFQNHVFSPIFIVGAFLAIFIGRALNIYPLSFLINLGRRHKIRGNFQHMMMFAGLRGAMAFALAIRDTATYARQMMFTTTLLIVFFTVWVFGGGTTPMLSWLHIRVGESSDAEKERMRRLWNYDSRVGVDPDQDLQPCGDSFQVLQGDGSQSEGQSKTKQESAWLFRLWYTFDHNYLKPILTHSGPPLTSTLPACCGPLARCLTSPQAYETHEPLRDNDSDLILN-EGDLTLTYGDTAITA 662          
BLAST of slc9a-2 vs. Ensembl Zebrafish
Match: slc9a6b (solute carrier family 9 member 6b [Source:ZFIN;Acc:ZDB-GENE-080226-2])

HSP 1 Score: 494.197 bits (1271), Expect = 8.249e-165
Identity = 279/619 (45.07%), Postives = 400/619 (64.62%), Query Frame = 3
Query:   63 ALNEKILEQSREEKVQQNHKTDXXXXXXXXXXXXXXXXXXXXFKHKRLRFVHETSCSLIYGLILGVIFYNLPIDVNKVTTTLQMPQSKTNCAYQLPPDNIILEMNLLNRTSPYTFKYR-HVLNDHESDAKDLSRKATFDAEIFFNLLLPPIIFCAGYNMKKKHFFENLGAIASFAFLGTILSSLTIGGLCYG---LSRTITSISDSIGFGECLLFGSFISATDPVTVLAIFNDINIEVDLYAFVFGESVLNDAVAIVLVNSVEQYGKIANNGE-FNPFAILIAAKSFMTVFLGALSIGCVVGICTALVTKYTYLRDHPLLETSLFFLMSYCSFLIAEVAGASGIVASLFCGITQAHYTYNNLSEESQKWTKGIFELMSFLSENFVFVYIGVSNFTFRDHNWQPRFICIAIFAIIVGRAVNVYILSAMLNLGRKNKIKFNHQHMLMFAGVRGAMAFALAIRNTSSKVRQMFFSTTLVIVMVTVFICGGLTLPMINFLKIRIGKDNEITDSIPEPADDTTISDEQVLDLNERHKKKAFLIRMFAKLDCQFIKPLLTHSPPLLIDTCPLCCFTFAKFLTTSEQISRNSHLRISKNNISMDMTGDNMAYKSDRDLTSFNPGLP 1904
            A N +++    E K +++H+ DS  LL F+ LL ++++TIW+FKH+R RF+HET  ++IYGL +GVI   L   V+ +  T ++  S   CA    P  I++  N+  R   Y+ K        H+    ++ RK TFD E+FFN+LLPPIIF AGY++K++HFF NLG+I S+AF+GT+ S    G   Y      + I  +     F +CL FG+ +SATDPVTVLAIFN++ ++VDLYA +FGESVLNDAVAIVL +S+  Y    +N   F+  A+L     F+ VF G+ ++G   G+ TALVTK+T LRD PLLET+LFFLMS+ +FL+AE  G +G+VA LFCGITQAHYTYNNLS ES+  TK +FEL++FL+ENF+F Y+G++ F+F+ H + P FI  A  AI +GR  N+Y LS +LNLGRKNKI  N QH++MF+G+RGAM FAL+IR+T++  RQM FSTTL+IV  TV++CGG T P+++ ++IR+G D E         D++  + + +   + +H + A+  R++   D  ++KP LTHS P L  T P CC   A+ LT+S+       L      + ++  G  M   SD  +++   G+P
Sbjct:   31 AENTEMVNVVTERKAEESHRQDSANLLIFITLLTITILTIWLFKHRRFRFLHETGLAMIYGLFVGVI---LRFGVHSLQDTSEVTLS---CAVNSSPTTILV--NVSGRFYEYSLKGEVQDSKGHDVPNAEMLRKVTFDPEVFFNILLPPIIFHAGYSLKRRHFFRNLGSILSYAFVGTMTSCFVTGLAMYSCVVFMKIIGQLGGDFFFTDCLFFGAIVSATDPVTVLAIFNELKVDVDLYALMFGESVLNDAVAIVLSSSIVAYQPEGDNRHTFDASALLKCLGVFLGVFSGSFAMGAATGVMTALVTKFTKLRDFPLLETALFFLMSWSTFLLAEACGFTGVVAVLFCGITQAHYTYNNLSVESKSRTKQLFELLNFLAENFIFSYMGLTLFSFQHHVFNPFFIIGAFVAIFLGRLANIYPLSFLLNLGRKNKIPSNFQHVMMFSGLRGAMTFALSIRDTATYARQMMFSTTLLIVFFTVWVCGGGTTPVLSLMQIRVGVDTE--------QDNSATAADGMTQRSTKH-ESAWPFRLWYTFDHNYLKPFLTHSGPPLTTTLPACCGPIARCLTSSQAYENAGQLHDEDTELILNDGGGLM--YSDMTVSTDVHGVP 630          
BLAST of slc9a-2 vs. Ensembl Xenopus
Match: SLC9A6 (solute carrier family 9, subfamily A (NHE6, cation proton antiporter 6), member 6 [Source:NCBI gene;Acc:100497414])

HSP 1 Score: 511.531 bits (1316), Expect = 2.991e-171
Identity = 283/608 (46.55%), Postives = 402/608 (66.12%), Query Frame = 3
Query:   54 KCEALNEKILEQSREEKVQQNHKTDXXXXXXXXXXXXXXXXXXXXFKHKRLRFVHETSCSLIYGLILGVIFY---NLPIDVNKVTTTLQMPQSKTNCAYQLPPDNIILEMNLLNRTSPYTFKYR---HVLNDHESDAKDLSRKATFDAEIFFNLLLPPIIFCAGYNMKKKHFFENLGAIASFAFLGTILSSLTIGGLCYG---LSRTITSISDSIGFGECLLFGSFISATDPVTVLAIFNDINIEVDLYAFVFGESVLNDAVAIVLVNSVEQYGKIANNGE-FNPFAILIAAKSFMTVFLGALSIGCVVGICTALVTKYTYLRDHPLLETSLFFLMSYCSFLIAEVAGASGIVASLFCGITQAHYTYNNLSEESQKWTKGIFELMSFLSENFVFVYIGVSNFTFRDHNWQPRFICIAIFAIIVGRAVNVYILSAMLNLGRKNKIKFNHQHMLMFAGVRGAMAFALAIRNTSSKVRQMFFSTTLVIVMVTVFICGGLTLPMINFLKIRIGKDNEITDSIPEPADDTTISDEQVLDLNERHKKK---AFLIRMFAKLDCQFIKPLLTHSPPLLIDTCPLCCFTFAKFLTTSEQISRNSHLRISKNNISMD 1838
            +  A +  I E   E++V+ +H+ DS  LL F++LL ++++TIW+FKH+R RF+HET  ++IYGLI GV+     ++P DVN VT +         C  Q  P  +++  N+  +   Y  K       LN+ + +  D+ RK TFD E+FFN+LLPPIIF AGY++K++HFF N+G+I ++AFLGT +S L IG L YG   L +   ++     F +CL FG+ ISATDPVTVLAIF++++++V+LYA +FGESVLNDAVAIVL +S+  Y    +N   F+  A+      F+ +F G+ ++G   G+ T+LVTK+T LR+ PLLET LFFLMS+ +FL+AE  G +G+VA LFCGITQAHYTYNNLS ESQ  TK +FEL++FL+ENF+F Y+G++ FTF++H + P FI  A  A+ +GRA N+Y LS +LNLGRKNKI  N QHM+MFAG+RGAMAFALAIR+T++  RQM FSTTL+IV  TV++ GG T  M++ + IR+G D+EI              D+  +  NER   K   A++ R++   D  ++KPLLTHS P L  T P CC   A+ LT+ +       L+   +++ ++
Sbjct:   56 RAGAQDSVIEEIVTEKQVEASHRQDSANLLVFILLLTLTILTIWLFKHRRFRFLHETGLAMIYGLIAGVVLRYGIHVPSDVNNVTMS---------CELQTSPATLLV--NVSGKFYEYMLKGEISSKALNNVQDN--DMLRKVTFDTEVFFNILLPPIIFYAGYSLKRRHFFRNMGSILAYAFLGTAISCLVIGALLYGCVKLMKVTGTLDGDFYFTDCLFFGAIISATDPVTVLAIFHELHVDVELYALLFGESVLNDAVAIVLSSSIVAYQPAGDNSHTFDITAMFKCIGMFLGIFSGSFAMGAATGVVTSLVTKFTKLREFPLLETGLFFLMSWSTFLLAEACGYTGVVAVLFCGITQAHYTYNNLSTESQHRTKQLFELLNFLAENFIFSYMGLALFTFQNHVFNPTFIVGAFLAVFLGRAANIYPLSFLLNLGRKNKIGSNFQHMMMFAGLRGAMAFALAIRDTATYARQMMFSTTLLIVFFTVWVFGGGTTAMLSCMHIRVGVDSEI--------------DQMAIPENERRSTKAESAWIFRLWYNFDHNYLKPLLTHSGPPLTATLPSCCGPLARCLTSPQAYENQEQLKDDDSDLILN 636          
BLAST of slc9a-2 vs. Ensembl Xenopus
Match: SLC9A6 (solute carrier family 9, subfamily A (NHE6, cation proton antiporter 6), member 6 [Source:NCBI gene;Acc:100497414])

HSP 1 Score: 495.738 bits (1275), Expect = 1.627e-165
Identity = 278/608 (45.72%), Postives = 396/608 (65.13%), Query Frame = 3
Query:   54 KCEALNEKILEQSREEKVQQNHKTDXXXXXXXXXXXXXXXXXXXXFKHKRLRFVHETSCSLIYGLILGVIFY---NLPIDVNKVTTTLQMPQSKTNCAYQLPPDNIILEMNLLNRTSPYTFKYR---HVLNDHESDAKDLSRKATFDAEIFFNLLLPPIIFCAGYNMKKKHFFENLGAIASFAFLGTILSSLTIGGLCYG---LSRTITSISDSIGFGECLLFGSFISATDPVTVLAIFNDINIEVDLYAFVFGESVLNDAVAIVLVNSVEQYGKIANNGE-FNPFAILIAAKSFMTVFLGALSIGCVVGICTALVTKYTYLRDHPLLETSLFFLMSYCSFLIAEVAGASGIVASLFCGITQAHYTYNNLSEESQKWTKGIFELMSFLSENFVFVYIGVSNFTFRDHNWQPRFICIAIFAIIVGRAVNVYILSAMLNLGRKNKIKFNHQHMLMFAGVRGAMAFALAIRNTSSKVRQMFFSTTLVIVMVTVFICGGLTLPMINFLKIRIGKDNEITDSIPEPADDTTISDEQVLDLNERHKKK---AFLIRMFAKLDCQFIKPLLTHSPPLLIDTCPLCCFTFAKFLTTSEQISRNSHLRISKNNISMD 1838
            +  A +  I E   E++V+ +H+ DS  LL F++LL ++++TIW+FKH+R RF+HET  ++IYGLI GV+     ++P DVN VT +         C  Q  P  +++  N+  +   Y  K       LN+ + +  D+ RK TFD E+FFN+LLPPIIF AGY++K++HFF N+G+I ++AFLGT +S L IG L YG   L +   ++     F +CL FG+ ISATDPVTVLAIF++++++V+LYA +FGESVLNDAVAIVL +S+  Y    +N   F+  A+      F+ +F G+ ++G   G+       +T LR+ PLLET LFFLMS+ +FL+AE  G +G+VA LFCGITQAHYTYNNLS ESQ  TK +FEL++FL+ENF+F Y+G++ FTF++H + P FI  A  A+ +GRA N+Y LS +LNLGRKNKI  N QHM+MFAG+RGAMAFALAIR+T++  RQM FSTTL+IV  TV++ GG T  M++ + IR+G D+EI              D+  +  NER   K   A++ R++   D  ++KPLLTHS P L  T P CC   A+ LT+ +       L+   +++ ++
Sbjct:   36 RAGAQDSVIEEIVTEKQVEASHRQDSANLLVFILLLTLTILTIWLFKHRRFRFLHETGLAMIYGLIAGVVLRYGIHVPSDVNNVTMS---------CELQTSPATLLV--NVSGKFYEYMLKGEISSKALNNVQDN--DMLRKVTFDTEVFFNILLPPIIFYAGYSLKRRHFFRNMGSILAYAFLGTAISCLVIGALLYGCVKLMKVTGTLDGDFYFTDCLFFGAIISATDPVTVLAIFHELHVDVELYALLFGESVLNDAVAIVLSSSIVAYQPAGDNSHTFDITAMFKCIGMFLGIFSGSFAMGAATGV-------FTKLREFPLLETGLFFLMSWSTFLLAEACGYTGVVAVLFCGITQAHYTYNNLSTESQHRTKQLFELLNFLAENFIFSYMGLALFTFQNHVFNPTFIVGAFLAVFLGRAANIYPLSFLLNLGRKNKIGSNFQHMMMFAGLRGAMAFALAIRDTATYARQMMFSTTLLIVFFTVWVFGGGTTAMLSCMHIRVGVDSEI--------------DQMAIPENERRSTKAESAWIFRLWYNFDHNYLKPLLTHSGPPLTATLPSCCGPLARCLTSPQAYENQEQLKDDDSDLILN 609          
BLAST of slc9a-2 vs. Ensembl Xenopus
Match: SLC9A6 (solute carrier family 9, subfamily A (NHE6, cation proton antiporter 6), member 6 [Source:NCBI gene;Acc:100497414])

HSP 1 Score: 495.352 bits (1274), Expect = 1.682e-165
Identity = 284/635 (44.72%), Postives = 407/635 (64.09%), Query Frame = 3
Query:   63 ALNEKILEQSREEKVQQNHKTDXXXXXXXXXXXXXXXXXXXXFKHKRLRFVHETSCSLIYGLILGVIFY---NLPIDVNKVTTTLQMPQSKTNCAYQLPPDNIILEMNLLNRTSPYTFKYR---HVLNDHESDAKDLSRKATFDAEIFFNLLLPPIIFCAGYNMKKKHFFENLGAIASFAFLGTILSSLTIGGLCYG---LSRTITSISDSIGFGECLLFGSFISATDPVTVLAIFNDINIEVDLYAFVFGESVLNDAVAIVLVNSVEQYGKIANNGE-FNPFAILIAAKSFMTVFLGALSIGCVVGICTALVT------KYTYLRDHPLLETSLFFLMSYCSFLIAEVAGASGIVASLFCGITQAHYTYNNLSEESQKWTKGIFELMSFLSENFVFVYIGVSNFTFRDHNWQPRFICIAIFAIIVGRAVNVYILSAMLNLGRKNKIKFNHQHMLMFAGVRGAMAFALAIRNTSSKVRQMFFSTTLVIVMVTVFICGGLTLPMINFLKIRIGKDNEITDSIPEPADDTTISDEQVLDLNERHKKK---AFLIRMFAKLDCQFIKPLLTHSPPLLIDTCPLCCFTFAKFLTTSEQISRNSHLRISKNNISMDMTGDNMAYK----SDRDLTSFNPG 1898
            A +  I E   E++V+ +H+ DS  LL F++LL ++++TIW+FKH+R RF+HET  ++IYGLI GV+     ++P DVN VT +         C  Q  P  +++  N+  +   Y  K       LN+ + +  D+ RK TFD E+FFN+LLPPIIF AGY++K++HFF N+G+I ++AFLGT +S L IG L YG   L +   ++     F +CL FG+ ISATDPVTVLAIF++++++V+LYA +FGESVLNDAVAIVL +S+  Y    +N   F+  A+      F+ +F G+ ++G   G+ T+L++       +T LR+ PLLET LFFLMS+ +FL+AE  G +G+VA LFCGITQAHYTYNNLS ESQ  TK +FEL++FL+ENF+F Y+G++ FTF++H + P FI  A  A+ +GRA N+Y LS +LNLGRKNKI  N QHM+MFAG+RGAMAFALAIR+T++  RQM FSTTL+IV  TV++ GG T  M++ + IR+G D+EI   +     +       +   NER   K   A++ R++   D  ++KPLLTHS P L  T P CC   A+ LT+ +       L+   +++ ++    ++ Y     S  D  S   G
Sbjct:    5 AQDSVIEEIVTEKQVEASHRQDSANLLVFILLLTLTILTIWLFKHRRFRFLHETGLAMIYGLIAGVVLRYGIHVPSDVNNVTMS---------CELQTSPATLLV--NVSGKFYEYMLKGEISSKALNNVQDN--DMLRKVTFDTEVFFNILLPPIIFYAGYSLKRRHFFRNMGSILAYAFLGTAISCLVIGALLYGCVKLMKVTGTLDGDFYFTDCLFFGAIISATDPVTVLAIFHELHVDVELYALLFGESVLNDAVAIVLSSSIVAYQPAGDNSHTFDITAMFKCIGMFLGIFSGSFAMGAATGVVTSLISFLLLEGNFTKLREFPLLETGLFFLMSWSTFLLAEACGYTGVVAVLFCGITQAHYTYNNLSTESQHRTKQLFELLNFLAENFIFSYMGLALFTFQNHVFNPTFIVGAFLAVFLGRAANIYPLSFLLNLGRKNKIGSNFQHMMMFAGLRGAMAFALAIRDTATYARQMMFSTTLLIVFFTVWVFGGGTTAMLSCMHIRVGVDSEIDQMV-----NIHFQIYHICLKNERRSTKAESAWIFRLWYNFDHNYLKPLLTHSGPPLTATLPSCCGPLARCLTSPQAYENQEQLKDDDSDLILNDGDISLTYGDSTISTEDTNSLRRG 621          
BLAST of slc9a-2 vs. Ensembl Xenopus
Match: SLC9A6 (solute carrier family 9, subfamily A (NHE6, cation proton antiporter 6), member 6 [Source:NCBI gene;Acc:100497414])

HSP 1 Score: 495.738 bits (1275), Expect = 1.961e-165
Identity = 278/608 (45.72%), Postives = 396/608 (65.13%), Query Frame = 3
Query:   54 KCEALNEKILEQSREEKVQQNHKTDXXXXXXXXXXXXXXXXXXXXFKHKRLRFVHETSCSLIYGLILGVIFY---NLPIDVNKVTTTLQMPQSKTNCAYQLPPDNIILEMNLLNRTSPYTFKYR---HVLNDHESDAKDLSRKATFDAEIFFNLLLPPIIFCAGYNMKKKHFFENLGAIASFAFLGTILSSLTIGGLCYG---LSRTITSISDSIGFGECLLFGSFISATDPVTVLAIFNDINIEVDLYAFVFGESVLNDAVAIVLVNSVEQYGKIANNGE-FNPFAILIAAKSFMTVFLGALSIGCVVGICTALVTKYTYLRDHPLLETSLFFLMSYCSFLIAEVAGASGIVASLFCGITQAHYTYNNLSEESQKWTKGIFELMSFLSENFVFVYIGVSNFTFRDHNWQPRFICIAIFAIIVGRAVNVYILSAMLNLGRKNKIKFNHQHMLMFAGVRGAMAFALAIRNTSSKVRQMFFSTTLVIVMVTVFICGGLTLPMINFLKIRIGKDNEITDSIPEPADDTTISDEQVLDLNERHKKK---AFLIRMFAKLDCQFIKPLLTHSPPLLIDTCPLCCFTFAKFLTTSEQISRNSHLRISKNNISMD 1838
            +  A +  I E   E++V+ +H+ DS  LL F++LL ++++TIW+FKH+R RF+HET  ++IYGLI GV+     ++P DVN VT +         C  Q  P  +++  N+  +   Y  K       LN+ + +  D+ RK TFD E+FFN+LLPPIIF AGY++K++HFF N+G+I ++AFLGT +S L IG L YG   L +   ++     F +CL FG+ ISATDPVTVLAIF++++++V+LYA +FGESVLNDAVAIVL +S+  Y    +N   F+  A+      F+ +F G+ ++G   G+       +T LR+ PLLET LFFLMS+ +FL+AE  G +G+VA LFCGITQAHYTYNNLS ESQ  TK +FEL++FL+ENF+F Y+G++ FTF++H + P FI  A  A+ +GRA N+Y LS +LNLGRKNKI  N QHM+MFAG+RGAMAFALAIR+T++  RQM FSTTL+IV  TV++ GG T  M++ + IR+G D+EI              D+  +  NER   K   A++ R++   D  ++KPLLTHS P L  T P CC   A+ LT+ +       L+   +++ ++
Sbjct:   42 RAGAQDSVIEEIVTEKQVEASHRQDSANLLVFILLLTLTILTIWLFKHRRFRFLHETGLAMIYGLIAGVVLRYGIHVPSDVNNVTMS---------CELQTSPATLLV--NVSGKFYEYMLKGEISSKALNNVQDN--DMLRKVTFDTEVFFNILLPPIIFYAGYSLKRRHFFRNMGSILAYAFLGTAISCLVIGALLYGCVKLMKVTGTLDGDFYFTDCLFFGAIISATDPVTVLAIFHELHVDVELYALLFGESVLNDAVAIVLSSSIVAYQPAGDNSHTFDITAMFKCIGMFLGIFSGSFAMGAATGV-------FTKLREFPLLETGLFFLMSWSTFLLAEACGYTGVVAVLFCGITQAHYTYNNLSTESQHRTKQLFELLNFLAENFIFSYMGLALFTFQNHVFNPTFIVGAFLAVFLGRAANIYPLSFLLNLGRKNKIGSNFQHMMMFAGLRGAMAFALAIRDTATYARQMMFSTTLLIVFFTVWVFGGGTTAMLSCMHIRVGVDSEI--------------DQMAIPENERRSTKAESAWIFRLWYNFDHNYLKPLLTHSGPPLTATLPSCCGPLARCLTSPQAYENQEQLKDDDSDLILN 615          
BLAST of slc9a-2 vs. Ensembl Xenopus
Match: SLC9A6 (solute carrier family 9, subfamily A (NHE6, cation proton antiporter 6), member 6 [Source:NCBI gene;Acc:100497414])

HSP 1 Score: 489.574 bits (1259), Expect = 9.990e-163
Identity = 284/641 (44.31%), Postives = 404/641 (63.03%), Query Frame = 3
Query:   54 KCEALNEKILEQSREEKVQQNHKTDXXXXXXXXXXXXXXXXXXXXFKHKRLRFVHETSCSLIYGLILGVIFY---NLPIDVNKVTTTLQMPQSKTNCAYQLPPDNIILEMNLLNRTSPYTFKYR---HVLNDHESDAKDLSRKATFDAEIFFNLLLPPIIFCAGYNMKKKHFFENLGAIASFAFLGTILSSLTIGGLCYG---LSRTITSISDSIGFGECLLFGSFISATDPVTVLAIFNDINIEVDLYAFVFGESVLNDAVAIVLVNSVEQYGKIANNGE-FNPFAILIAAKSFMTVFLGALSIGCVVGICTALVTKYTYLRDHPLLETSLFFLMSYCSFLIAEVAGASGIVASLFCGITQAHYTYNNLSEESQKWTKGIFELMSFLSENFVFVYIGVSNFTFRDHNWQPRFICIAIFAIIVGRAVNVYILSAMLNLGRKNKIKFNHQHMLMFAGVRGAMAFALAIRNTSSKVRQMFFSTTLVIVMVTVFICGGLTLPMINFLKIRIGKDNEITDSIPEPADDTTISDEQVL---------DLNERHKKK---AFLIRMFAKLDCQFIKPLLTHSPPLLIDTCPLCCFTFAKFLTTSEQISRNSHLRISKNNISMDMTGDNMAYK----SDRDLTSFNPG 1898
            +  A +  I E   E++V+ +H+ DS  LL F++LL ++++TIW+FKH+R RF+HET  ++IYGLI GV+     ++P DVN VT +         C  Q  P  +++  N+  +   Y  K       LN+ + +  D+ RK TFD E+FFN+LLPPIIF AGY++K++HFF N+G+I ++AFLGT +S L IG L YG   L +   ++     F +CL FG+ ISATDPVTVLAIF++++++V+LYA +FGESVLNDAVAIVL +S+  Y    +N   F+  A+      F+ +F G+ ++G   G+       +T LR+ PLLET LFFLMS+ +FL+AE  G +G+VA LFCGITQAHYTYNNLS ESQ  TK +FEL++FL+ENF+F Y+G++ FTF++H + P FI  A  A+ +GRA N+Y LS +LNLGRKNKI  N QHM+MFAG+RGAMAFALAIR+T++  RQM FSTTL+IV  TV++ GG T  M++ + IR+G D+EI   +        I    +          D NER   K   A++ R++   D  ++KPLLTHS P L  T P CC   A+ LT+ +       L+   +++ ++    ++ Y     S  D  S   G
Sbjct:   35 RAGAQDSVIEEIVTEKQVEASHRQDSANLLVFILLLTLTILTIWLFKHRRFRFLHETGLAMIYGLIAGVVLRYGIHVPSDVNNVTMS---------CELQTSPATLLV--NVSGKFYEYMLKGEISSKALNNVQDN--DMLRKVTFDTEVFFNILLPPIIFYAGYSLKRRHFFRNMGSILAYAFLGTAISCLVIGALLYGCVKLMKVTGTLDGDFYFTDCLFFGAIISATDPVTVLAIFHELHVDVELYALLFGESVLNDAVAIVLSSSIVAYQPAGDNSHTFDITAMFKCIGMFLGIFSGSFAMGAATGV-------FTKLREFPLLETGLFFLMSWSTFLLAEACGYTGVVAVLFCGITQAHYTYNNLSTESQHRTKQLFELLNFLAENFIFSYMGLALFTFQNHVFNPTFIVGAFLAVFLGRAANIYPLSFLLNLGRKNKIGSNFQHMMMFAGLRGAMAFALAIRDTATYARQMMFSTTLLIVFFTVWVFGGGTTAMLSCMHIRVGVDSEIDQMVNIHFQIYHICLSYLFLAVILVYLPDSNERRSTKAESAWIFRLWYNFDHNYLKPLLTHSGPPLTATLPSCCGPLARCLTSPQAYENQEQLKDDDSDLILNDGDISLTYGDSTISTEDTNSLRRG 655          
BLAST of slc9a-2 vs. Ensembl Mouse
Match: Slc9a6 (solute carrier family 9 (sodium/hydrogen exchanger), member 6 [Source:MGI Symbol;Acc:MGI:2443511])

HSP 1 Score: 504.212 bits (1297), Expect = 1.167e-168
Identity = 281/608 (46.22%), Postives = 406/608 (66.78%), Query Frame = 3
Query:   60 EALNEKILEQSREEKVQQNHKTDXXXXXXXXXXXXXXXXXXXXFKHKRLRFVHETSCSLIYGLILGVIFY---NLPIDVNKVTTTLQMPQSKTNCAYQLPPDNIILEMNLLNRTSPYTFKYR---HVLNDHESDAKDLSRKATFDAEIFFNLLLPPIIFCAGYNMKKKHFFENLGAIASFAFLGTILSSLTIGGLCYG---LSRTITSISDSIGFGECLLFGSFISATDPVTVLAIFNDINIEVDLYAFVFGESVLNDAVAIVLVNSVEQYGKIANNGE-FNPFAILIAAKSFMTVFLGALSIGCVVGICTALVTKYTYLRDHPLLETSLFFLMSYCSFLIAEVAGASGIVASLFCGITQAHYTYNNLSEESQKWTKGIFELMSFLSENFVFVYIGVSNFTFRDHNWQPRFICIAIFAIIVGRAVNVYILSAMLNLGRKNKIKFNHQHMLMFAGVRGAMAFALAIRNTSSKVRQMFFSTTLVIVMVTVFICGGLTLPMINFLKIRIGKDNEITDSIPEPADDTTISDEQVLDL--NERHKKK---AFLIRMFAKLDCQFIKPLLTHSPPLLIDTCPLCCFTFAKFLTTSEQISRNSHLRISKNNISMD 1838
             A++E+I+    E++ +++H+ DS  LL F++LL ++++TIW+FKH+R RF+HET  ++IYGL++G++     ++P DVN VT +         C  Q  P  +++  N+  +   YT K     H LN+ + +  ++ RK TFD E+FFN+LLPPIIF AGY++K++HFF NLG+I ++AFLGT +S   IG + YG   L +    ++    F +CLLFG+ +SATDPVTVLAIF+++ ++V+LYA +FGESVLNDAVAIVL +S+  Y    +N   F+  A+  +   F+ +F G+ ++G   G+ TALVTK+T LR+  LLET LFFLMS+ +FL+AE  G +G+VA LFCGITQAHYTYNNLS ESQ  TK +FEL++FL+ENF+F Y+G++ FTF++H + P F+  A  AI +GRA N+Y LS +LNLGR++KI  N QHM+MFAG+RGAMAFALAIR+T++  RQM FSTTL+IV  TV++ GG T  M++ L IR+G D                SD++ L +  NER   K   A+L RM+   D  ++KPLLTHS P L  T P CC   A+ LT+ +       L+   +++ ++
Sbjct:   52 RAMDEEIVS---EKQAEESHRQDSANLLIFILLLTLTILTIWLFKHRRARFLHETGLAMIYGLLVGLVLRYGIHVPSDVNNVTLS---------CEVQSSPTTLLV--NVSGKFYEYTLKGEISSHELNNVQDN--EMLRKVTFDPEVFFNILLPPIIFYAGYSLKRRHFFRNLGSILAYAFLGTAISCFVIGSIMYGCVTLMKVTGQLAGDFYFTDCLLFGAIVSATDPVTVLAIFHELQVDVELYALLFGESVLNDAVAIVLSSSIVAYQPAGDNSHTFDVTAMFKSIGIFLGIFSGSFAMGAATGVVTALVTKFTKLREFQLLETGLFFLMSWSTFLLAEAWGFTGVVAVLFCGITQAHYTYNNLSTESQHRTKQLFELLNFLAENFIFSYMGLTLFTFQNHVFNPTFVVGAFIAIFLGRAANIYPLSLLLNLGRRSKIGSNFQHMMMFAGLRGAMAFALAIRDTATYARQMMFSTTLLIVFFTVWVFGGGTTAMLSCLHIRVGVD----------------SDQEHLGVPDNERRTTKAESAWLFRMWYNFDHNYLKPLLTHSGPPLTTTLPACCGPIARCLTSPQAYENQEQLKDDDSDLILN 627          
BLAST of slc9a-2 vs. Ensembl Mouse
Match: Slc9a6 (solute carrier family 9 (sodium/hydrogen exchanger), member 6 [Source:MGI Symbol;Acc:MGI:2443511])

HSP 1 Score: 485.723 bits (1249), Expect = 6.861e-162
Identity = 272/605 (44.96%), Postives = 390/605 (64.46%), Query Frame = 3
Query:   60 EALNEKILEQSREEKVQQNHKTDXXXXXXXXXXXXXXXXXXXXFKHKRLRFVHETSCSLIYGLILGVIFY---NLPIDVNKVTTTLQMPQSKTNCAYQLPPDNIILEMNLLNRTSPYTFKYRHVLNDHESDAKDLSRKATFDAEIFFNLLLPPIIFCAGYNMKKKHFFENLGAIASFAFLGTILSSLTIGGLCYG---LSRTITSISDSIGFGECLLFGSFISATDPVTVLAIFNDINIEVDLYAFVFGESVLNDAVAIVLVNSVEQYGKIANNGE-FNPFAILIAAKSFMTVFLGALSIGCVVGICTALVTKYTYLRDHPLLETSLFFLMSYCSFLIAEVAGASGIVASLFCGITQAHYTYNNLSEESQKWTKGIFELMSFLSENFVFVYIGVSNFTFRDHNWQPRFICIAIFAIIVGRAVNVYILSAMLNLGRKNKIKFNHQHMLMFAGVRGAMAFALAIRNTSSKVRQMFFSTTLVIVMVTVFICGGLTLPMINFLKIRIGKDNEITDSIPEPADDTTISDEQVLDL--NERHKKK---AFLIRMFAKLDCQFIKPLLTHSPPLLIDTCPLCCFTFAKFLTTSEQISRNSHLRISKNNISMD 1838
             A++E+I+    E++ +++H+ DS  LL F++LL ++++TIW+FKH+R RF+HET  ++IYGL++G++     ++P DVN VT +         C  Q  P  +++                                 TFD E+FFN+LLPPIIF AGY++K++HFF NLG+I ++AFLGT +S   IG + YG   L +    ++    F +CLLFG+ +SATDPVTVLAIF+++ ++V+LYA +FGESVLNDAVAIVL +S+  Y    +N   F+  A+  +   F+ +F G+ ++G   G+ TALVTK+T LR+  LLET LFFLMS+ +FL+AE  G +G+VA LFCGITQAHYTYNNLS ESQ  TK +FEL++FL+ENF+F Y+G++ FTF++H + P F+  A  AI +GRA N+Y LS +LNLGR++KI  N QHM+MFAG+RGAMAFALAIR+T++  RQM FSTTL+IV  TV++ GG T  M++ L IR+G D                SD++ L +  NER   K   A+L RM+   D  ++KPLLTHS P L  T P CC   A+ LT+ +       L+   +++ ++
Sbjct:   52 RAMDEEIVS---EKQAEESHRQDSANLLIFILLLTLTILTIWLFKHRRARFLHETGLAMIYGLLVGLVLRYGIHVPSDVNNVTLS---------CEVQSSPTTLLV---------------------------------TFDPEVFFNILLPPIIFYAGYSLKRRHFFRNLGSILAYAFLGTAISCFVIGSIMYGCVTLMKVTGQLAGDFYFTDCLLFGAIVSATDPVTVLAIFHELQVDVELYALLFGESVLNDAVAIVLSSSIVAYQPAGDNSHTFDVTAMFKSIGIFLGIFSGSFAMGAATGVVTALVTKFTKLREFQLLETGLFFLMSWSTFLLAEAWGFTGVVAVLFCGITQAHYTYNNLSTESQHRTKQLFELLNFLAENFIFSYMGLTLFTFQNHVFNPTFVVGAFIAIFLGRAANIYPLSLLLNLGRRSKIGSNFQHMMMFAGLRGAMAFALAIRDTATYARQMMFSTTLLIVFFTVWVFGGGTTAMLSCLHIRVGVD----------------SDQEHLGVPDNERRTTKAESAWLFRMWYNFDHNYLKPLLTHSGPPLTTTLPACCGPIARCLTSPQAYENQEQLKDDDSDLILN 595          
BLAST of slc9a-2 vs. Ensembl Mouse
Match: Slc9a7 (solute carrier family 9 (sodium/hydrogen exchanger), member 7 [Source:MGI Symbol;Acc:MGI:2444530])

HSP 1 Score: 480.715 bits (1236), Expect = 3.165e-159
Identity = 274/602 (45.51%), Postives = 390/602 (64.78%), Query Frame = 3
Query:   84 EQSREEKVQQNHKTDXXXXXXXXXXXXXXXXXXXXFKHKRLRFVHETSCSLIYGLILGVIF-YNLPIDVNKVTTTLQMPQSKTNCAYQLPPDNIILEMNLLNRTSPYTFKYRHVLNDHESDAKDLSRKATFDAEIFFNLLLPPIIFCAGYNMKKKHFFENLGAIASFAFLGTILSSLTIGGLCYG---LSRTITSISDSIGFGECLLFGSFISATDPVTVLAIFNDINIEVDLYAFVFGESVLNDAVAIVLVNSVEQYGKIA-NNGEFNPFAILIAAKSFMTVFLGALSIGCVVGICTALVTKYTYLRDHPLLETSLFFLMSYCSFLIAEVAGASGIVASLFCGITQAHYTYNNLSEESQKWTKGIFELMSFLSENFVFVYIGVSNFTFRDHNWQPRFICIAIFAIIVGRAVNVYILSAMLNLGRKNKIKFNHQHMLMFAGVRGAMAFALAIRNTSSKVRQMFFSTTLVIVMVTVFICGGLTLPMINFLKIRIGKD-------NE----------ITDSIPEPADDT--TISDEQVLDLNERHKKK--AFLIRMFAKLDCQFIKPLLTHSPPLLIDTCPLCCFTFAKFLTTSEQISRNSHLR 1811
            E + E++ +++H+ DS+ LL+F++LL ++++TIW+FKH+R+RF+HET  ++IYGLI+GVI  Y  P       +     + +      +       E  L    SP        +N+ E +  D+ RK TFD E+FFN+LLPPIIF AGY++KK+HFF NLG+I ++AFLGT +S   IG L YG   L + +  +SD   + +CL FG+ ISATDPVTVLAIFN+++ +VDLYA +FGESVLNDAVAIVL +S+  Y     N   F+  A   +   F+ +F G+ ++G V G+ TALVTK+T L   PLLET+LFFLMS+ +FL+AE  G +G+VA LFCGITQAHYTYNNLS ES+  +K +FE++ FL+ENF+F Y+G++ FTF+ H + P FI  A  AI +GRA ++Y LS  LNLGR++KI +N QHM+MF+G+RGAMAFALAIR+T+S  RQM F+TTL+IV  TV++ GG T PM+++L IR+G +       NE            D  P P +D+   +  + +  +     K+  A++ R++   D  ++KP+LTHS P L  T P  C   A+ LT+ +       LR
Sbjct:   56 ELATEKEAEESHRQDSVSLLTFILLLTLTILTIWLFKHRRVRFLHETGLAMIYGLIVGVILRYGTPATSGHDKSLSCTQEDRAFSTLLVNVSGKFFEYTLKGEISPGK------INNVEQN--DMLRKVTFDPEVFFNILLPPIIFHAGYSLKKRHFFRNLGSILAYAFLGTAVSCFIIGNLMYGVVKLMKIVGQLSDKFYYTDCLFFGAIISATDPVTVLAIFNELHADVDLYALLFGESVLNDAVAIVLSSSIVAYQPAGLNTHAFDAAAFFKSVGIFLGIFSGSFTMGAVTGVVTALVTKFTKLHCFPLLETALFFLMSWSTFLLAEACGFTGVVAVLFCGITQAHYTYNNLSVESRSRSKQLFEVLHFLAENFIFSYMGLALFTFQKHVFSPIFIIGAFVAIFLGRAAHIYPLSFFLNLGRRHKIGWNFQHMMMFSGLRGAMAFALAIRDTASYARQMMFTTTLLIVFFTVWVIGGGTTPMLSWLNIRVGVEELSEEDQNENRWQYFRVGVDPDQDPPPNNDSFQVLQGDGMDSVGGSRTKQESAWIFRLWYIFDHNYLKPILTHSGPPLTTTLPAWCGLLARCLTSPQVYDNQEPLR 649          
BLAST of slc9a-2 vs. Ensembl Mouse
Match: Slc9a9 (solute carrier family 9 (sodium/hydrogen exchanger), member 9 [Source:MGI Symbol;Acc:MGI:2679732])

HSP 1 Score: 476.863 bits (1226), Expect = 1.041e-158
Identity = 250/541 (46.21%), Postives = 358/541 (66.17%), Query Frame = 3
Query:  189 FKHKRLRFVHETSCSLIYGLILGVI--FYNLPIDVNKVTTTLQMPQSKTNCAYQLPPDNIILEMNLLNRTSPYTFKYRHVLNDHE---SDAKDLSRKATFDAEIFFNLLLPPIIFCAGYNMKKKHFFENLGAIASFAFLGTILSSLTIGGLCYGLSRTITSI----SDSIGFGECLLFGSFISATDPVTVLAIFNDINIEVDLYAFVFGESVLNDAVAIVLVNSVEQYGKIANNGEFNPFAILIAAKSFMTVFLGALSIGCVVGICTALVTKYTYLRDHPLLETSLFFLMSYCSFLIAEVAGASGIVASLFCGITQAHYTYNNLSEESQKWTKGIFELMSFLSENFVFVYIGVSNFTFRDHNWQPRFICIAIFAIIVGRAVNVYILSAMLNLGRKNKIKFNHQHMLMFAGVRGAMAFALAIRNTSSKVRQMFFSTTLVIVMVTVFICGGLTLPMINFLKIRIGKDNEITDSIPEPADDTTISDEQVLDLNERHKKKAFLIRMFAKLDCQFIKPLLTHSPPLLIDTCPLCCFTFAKFLTTSE 1784
            FK+ R RF+HET  +++YGLI+G+I  +   P D++  T          NC       + +L +N+ ++   Y +KY+  +N H         +  K TFD EIFFN+LLPPIIF AGY++KK+HFF+NLG+I ++AFLGT +S + IG + YG  + +       S    F +CL FGS +SATDPVTVLAIF++++++ DLY  +FGESVLNDAVAIVL  S+  Y    N   F+  A   +  +F+ +F G+ ++G    + TAL+TK+T LR+ P+LET LFFL+S+ +FL AE AG +GIVA LFCG+TQAHYTYNNLS +S+  TK +FE M+FL+EN +F Y+G++ FTF++H +   FI  A  AI V RA N+Y LS +LNLGRK KI +N QHM+MF+G+RGA+AFALAIRNT S+ +QM F+TTL++V  TV++ GG T PM+ +L+IR+G D  + +S+ E  + ++  +   LD N    + A L RM+   D +++KP+LTHS P L  T P  C   ++ LT+ +
Sbjct:   41 FKNHRFRFLHETGGAMVYGLIMGLILRYATAPTDIDSGTVY--------NCGNLFFSPSTLL-VNITDQV--YEYKYQREINQHNISPHQGNAILEKMTFDPEIFFNVLLPPIIFHAGYSLKKRHFFQNLGSILTYAFLGTAISCVVIGLIMYGFVKAMVHAGQLKSGDFHFTDCLFFGSLMSATDPVTVLAIFHELHVDPDLYTLLFGESVLNDAVAIVLTYSISIYSPKENPNAFDTAAFFQSVGNFLGIFAGSFAMGSAYAVVTALLTKFTKLREFPMLETGLFFLLSWSAFLSAEAAGLTGIVAVLFCGVTQAHYTYNNLSSDSKLRTKQLFEFMNFLAENVIFCYMGLALFTFQNHIFNALFILGAFLAIFVARACNIYPLSFLLNLGRKQKIPWNFQHMMMFSGLRGAIAFALAIRNTESQPKQMMFTTTLLLVFFTVWVFGGGTTPMLTWLQIRVGVD--LDESLKE--EPSSQQEANKLDKNMTKTESAQLFRMWYGFDHKYLKPILTHSGPPLTTTLPAWCGPVSRLLTSPQ 566          
BLAST of slc9a-2 vs. Ensembl Mouse
Match: Slc9a7 (solute carrier family 9 (sodium/hydrogen exchanger), member 7 [Source:MGI Symbol;Acc:MGI:2444530])

HSP 1 Score: 451.825 bits (1161), Expect = 2.255e-150
Identity = 247/492 (50.20%), Postives = 344/492 (69.92%), Query Frame = 3
Query:   84 EQSREEKVQQNHKTDXXXXXXXXXXXXXXXXXXXXFKHKRLRFVHETSCSLIYGLILGVIF-YNLPIDVNKVTTTLQMPQSKTNCAYQLPPDNIILEMNLLNRTSPYTFKYRHVLNDHESDAKDLSRKATFDAEIFFNLLLPPIIFCAGYNMKKKHFFENLGAIASFAFLGTILSSLTIGGLCYG---LSRTITSISDSIGFGECLLFGSFISATDPVTVLAIFNDINIEVDLYAFVFGESVLNDAVAIVLVNSVEQYGKIA-NNGEFNPFAILIAAKSFMTVFLGALSIGCVVGICTALVTKYTYLRDHPLLETSLFFLMSYCSFLIAEVAGASGIVASLFCGITQAHYTYNNLSEESQKWTKGIFELMSFLSENFVFVYIGVSNFTFRDHNWQPRFICIAIFAIIVGRAVNVYILSAMLNLGRKNKIKFNHQHMLMFAGVRGAMAFALAIRNTSSKVRQMFFSTTLVIVMVTVFICGGLTLPMINFLKIR 1544
            E + E++ +++H+ DS+ LL+F++LL ++++TIW+FKH+R+RF+HET  ++IYGLI+GVI  Y  P       +     + +      +       E  L    SP        +N+ E +  D+ RK TFD E+FFN+LLPPIIF AGY++KK+HFF NLG+I ++AFLGT +S   IG L YG   L + +  +SD   + +CL FG+ ISATDPVTVLAIFN+++ +VDLYA +FGESVLNDAVAIVL +S+  Y     N   F+  A   +   F+ +F G+ ++G V G+ TALVTK+T L   PLLET+LFFLMS+ +FL+AE  G +G+VA LFCGITQAHYTYNNLS ES+  +K +FE++ FL+ENF+F Y+G++ FTF+ H + P FI  A  AI +GRA ++Y LS  LNLGR++KI +N QHM+MF+G+RGAMAFALAIR+T+S  RQM F+TTL+IV  TV++ GG T PM+++L IR
Sbjct:   56 ELATEKEAEESHRQDSVSLLTFILLLTLTILTIWLFKHRRVRFLHETGLAMIYGLIVGVILRYGTPATSGHDKSLSCTQEDRAFSTLLVNVSGKFFEYTLKGEISPGK------INNVEQN--DMLRKVTFDPEVFFNILLPPIIFHAGYSLKKRHFFRNLGSILAYAFLGTAVSCFIIGNLMYGVVKLMKIVGQLSDKFYYTDCLFFGAIISATDPVTVLAIFNELHADVDLYALLFGESVLNDAVAIVLSSSIVAYQPAGLNTHAFDAAAFFKSVGIFLGIFSGSFTMGAVTGVVTALVTKFTKLHCFPLLETALFFLMSWSTFLLAEACGFTGVVAVLFCGITQAHYTYNNLSVESRSRSKQLFEVLHFLAENFIFSYMGLALFTFQKHVFSPIFIIGAFVAIFLGRAAHIYPLSFFLNLGRRHKIGWNFQHMMMFSGLRGAMAFALAIRDTASYARQMMFTTTLLIVFFTVWVIGGGTTPMLSWLNIR 539          
BLAST of slc9a-2 vs. UniProt/SwissProt
Match: sp|Q92581|SL9A6_HUMAN (Sodium/hydrogen exchanger 6 OS=Homo sapiens OX=9606 GN=SLC9A6 PE=1 SV=2)

HSP 1 Score: 486.878 bits (1252), Expect = 2.166e-161
Identity = 271/607 (44.65%), Postives = 390/607 (64.25%), Query Frame = 3
Query:   51 SKCEALNEKILEQSREEKVQQNHKTDXXXXXXXXXXXXXXXXXXXXFKHKRLRFVHETSCSLIYGLILGVIFY---NLPIDVNKVTTTLQMPQSKTNCAYQLPPDNIILEMNLLNRTSPYTFKYRHVLNDHESDAKDLSRKATFDAEIFFNLLLPPIIFCAGYNMKKKHFFENLGAIASFAFLGTILSSLTIGGLCYG---LSRTITSISDSIGFGECLLFGSFISATDPVTVLAIFNDINIEVDLYAFVFGESVLNDAVAIVLVNSVEQYGKIANNGE-FNPFAILIAAKSFMTVFLGALSIGCVVGICTALVTKYTYLRDHPLLETSLFFLMSYCSFLIAEVAGASGIVASLFCGITQAHYTYNNLSEESQKWTKGIFELMSFLSENFVFVYIGVSNFTFRDHNWQPRFICIAIFAIIVGRAVNVYILSAMLNLGRKNKIKFNHQHMLMFAGVRGAMAFALAIRNTSSKVRQMFFSTTLVIVMVTVFICGGLTLPMINFLKIRIGKDNEITD-SIPEPADDTTISDEQVLDLNERHKKK---AFLIRMFAKLDCQFIKPLLTHSPPLLIDTCPLCCFTFAKFLTTSEQISRNSHLRISKNNISMD 1838
             +  A++E+I+    E++ +++H+ DS  LL F++LL ++++TIW+FKH+R RF+HET  ++IYGL++G++     ++P DVN VT +         C  Q  P  +++                                 TFD E+FFN+LLPPIIF AGY++K++HFF NLG+I ++AFLGT +S   IG + YG   L +    ++    F +CLLFG+ +SATDPVTVLAIF+++ ++V+LYA +FGESVLNDAVAIVL +S+  Y    +N   F+  A+  +   F+ +F G+ ++G   G+ TALVTK+T LR+  LLET LFFLMS+ +FL+AE  G +G+VA LFCGITQAHYTYNNLS ESQ  TK +FEL++FL+ENF+F Y+G++ FTF++H + P F+  A  AI +GRA N+Y LS +LNLGR++KI  N QHM+MFAG+RGAMAFALAIR+T++  RQM FSTTL+IV  TV++ GG T  M++ L IR+G D++     +PE               NER   K   A+L RM+   D  ++KPLLTHS P L  T P CC   A+ LT+ +       L+   +++ ++
Sbjct:   48 GEARAMDEEIVS---EKQAEESHRQDSANLLIFILLLTLTILTIWLFKHRRARFLHETGLAMIYGLLVGLVLRYGIHVPSDVNNVTLS---------CEVQSSPTTLLV---------------------------------TFDPEVFFNILLPPIIFYAGYSLKRRHFFRNLGSILAYAFLGTAISCFVIGSIMYGCVTLMKVTGQLAGDFYFTDCLLFGAIVSATDPVTVLAIFHELQVDVELYALLFGESVLNDAVAIVLSSSIVAYQPAGDNSHTFDVTAMFKSIGIFLGIFSGSFAMGAATGVVTALVTKFTKLREFQLLETGLFFLMSWSTFLLAEAWGFTGVVAVLFCGITQAHYTYNNLSTESQHRTKQLFELLNFLAENFIFSYMGLTLFTFQNHVFNPTFVVGAFVAIFLGRAANIYPLSLLLNLGRRSKIGSNFQHMMMFAGLRGAMAFALAIRDTATYARQMMFSTTLLIVFFTVWVFGGGTTAMLSCLHIRVGVDSDQEHLGVPE---------------NERRTTKAESAWLFRMWYNFDHNYLKPLLTHSGPPLTTTLPACCGPIARCLTSPQAYENQEQLKDDDSDLILN 594          
BLAST of slc9a-2 vs. UniProt/SwissProt
Match: sp|Q8BLV3|SL9A7_MOUSE (Sodium/hydrogen exchanger 7 OS=Mus musculus OX=10090 GN=Slc9a7 PE=1 SV=1)

HSP 1 Score: 480.715 bits (1236), Expect = 2.214e-158
Identity = 274/602 (45.51%), Postives = 390/602 (64.78%), Query Frame = 3
Query:   84 EQSREEKVQQNHKTDXXXXXXXXXXXXXXXXXXXXFKHKRLRFVHETSCSLIYGLILGVIF-YNLPIDVNKVTTTLQMPQSKTNCAYQLPPDNIILEMNLLNRTSPYTFKYRHVLNDHESDAKDLSRKATFDAEIFFNLLLPPIIFCAGYNMKKKHFFENLGAIASFAFLGTILSSLTIGGLCYG---LSRTITSISDSIGFGECLLFGSFISATDPVTVLAIFNDINIEVDLYAFVFGESVLNDAVAIVLVNSVEQYGKIA-NNGEFNPFAILIAAKSFMTVFLGALSIGCVVGICTALVTKYTYLRDHPLLETSLFFLMSYCSFLIAEVAGASGIVASLFCGITQAHYTYNNLSEESQKWTKGIFELMSFLSENFVFVYIGVSNFTFRDHNWQPRFICIAIFAIIVGRAVNVYILSAMLNLGRKNKIKFNHQHMLMFAGVRGAMAFALAIRNTSSKVRQMFFSTTLVIVMVTVFICGGLTLPMINFLKIRIGKD-------NE----------ITDSIPEPADDT--TISDEQVLDLNERHKKK--AFLIRMFAKLDCQFIKPLLTHSPPLLIDTCPLCCFTFAKFLTTSEQISRNSHLR 1811
            E + E++ +++H+ DS+ LL+F++LL ++++TIW+FKH+R+RF+HET  ++IYGLI+GVI  Y  P       +     + +      +       E  L    SP        +N+ E +  D+ RK TFD E+FFN+LLPPIIF AGY++KK+HFF NLG+I ++AFLGT +S   IG L YG   L + +  +SD   + +CL FG+ ISATDPVTVLAIFN+++ +VDLYA +FGESVLNDAVAIVL +S+  Y     N   F+  A   +   F+ +F G+ ++G V G+ TALVTK+T L   PLLET+LFFLMS+ +FL+AE  G +G+VA LFCGITQAHYTYNNLS ES+  +K +FE++ FL+ENF+F Y+G++ FTF+ H + P FI  A  AI +GRA ++Y LS  LNLGR++KI +N QHM+MF+G+RGAMAFALAIR+T+S  RQM F+TTL+IV  TV++ GG T PM+++L IR+G +       NE            D  P P +D+   +  + +  +     K+  A++ R++   D  ++KP+LTHS P L  T P  C   A+ LT+ +       LR
Sbjct:   56 ELATEKEAEESHRQDSVSLLTFILLLTLTILTIWLFKHRRVRFLHETGLAMIYGLIVGVILRYGTPATSGHDKSLSCTQEDRAFSTLLVNVSGKFFEYTLKGEISPGK------INNVEQN--DMLRKVTFDPEVFFNILLPPIIFHAGYSLKKRHFFRNLGSILAYAFLGTAVSCFIIGNLMYGVVKLMKIVGQLSDKFYYTDCLFFGAIISATDPVTVLAIFNELHADVDLYALLFGESVLNDAVAIVLSSSIVAYQPAGLNTHAFDAAAFFKSVGIFLGIFSGSFTMGAVTGVVTALVTKFTKLHCFPLLETALFFLMSWSTFLLAEACGFTGVVAVLFCGITQAHYTYNNLSVESRSRSKQLFEVLHFLAENFIFSYMGLALFTFQKHVFSPIFIIGAFVAIFLGRAAHIYPLSFFLNLGRRHKIGWNFQHMMMFSGLRGAMAFALAIRDTASYARQMMFTTTLLIVFFTVWVIGGGTTPMLSWLNIRVGVEELSEEDQNENRWQYFRVGVDPDQDPPPNNDSFQVLQGDGMDSVGGSRTKQESAWIFRLWYIFDHNYLKPILTHSGPPLTTTLPAWCGLLARCLTSPQVYDNQEPLR 649          
BLAST of slc9a-2 vs. UniProt/SwissProt
Match: sp|Q8BZ00|SL9A9_MOUSE (Sodium/hydrogen exchanger 9 OS=Mus musculus OX=10090 GN=Slc9a9 PE=2 SV=1)

HSP 1 Score: 476.863 bits (1226), Expect = 7.284e-158
Identity = 250/541 (46.21%), Postives = 358/541 (66.17%), Query Frame = 3
Query:  189 FKHKRLRFVHETSCSLIYGLILGVI--FYNLPIDVNKVTTTLQMPQSKTNCAYQLPPDNIILEMNLLNRTSPYTFKYRHVLNDHE---SDAKDLSRKATFDAEIFFNLLLPPIIFCAGYNMKKKHFFENLGAIASFAFLGTILSSLTIGGLCYGLSRTITSI----SDSIGFGECLLFGSFISATDPVTVLAIFNDINIEVDLYAFVFGESVLNDAVAIVLVNSVEQYGKIANNGEFNPFAILIAAKSFMTVFLGALSIGCVVGICTALVTKYTYLRDHPLLETSLFFLMSYCSFLIAEVAGASGIVASLFCGITQAHYTYNNLSEESQKWTKGIFELMSFLSENFVFVYIGVSNFTFRDHNWQPRFICIAIFAIIVGRAVNVYILSAMLNLGRKNKIKFNHQHMLMFAGVRGAMAFALAIRNTSSKVRQMFFSTTLVIVMVTVFICGGLTLPMINFLKIRIGKDNEITDSIPEPADDTTISDEQVLDLNERHKKKAFLIRMFAKLDCQFIKPLLTHSPPLLIDTCPLCCFTFAKFLTTSE 1784
            FK+ R RF+HET  +++YGLI+G+I  +   P D++  T          NC       + +L +N+ ++   Y +KY+  +N H         +  K TFD EIFFN+LLPPIIF AGY++KK+HFF+NLG+I ++AFLGT +S + IG + YG  + +       S    F +CL FGS +SATDPVTVLAIF++++++ DLY  +FGESVLNDAVAIVL  S+  Y    N   F+  A   +  +F+ +F G+ ++G    + TAL+TK+T LR+ P+LET LFFL+S+ +FL AE AG +GIVA LFCG+TQAHYTYNNLS +S+  TK +FE M+FL+EN +F Y+G++ FTF++H +   FI  A  AI V RA N+Y LS +LNLGRK KI +N QHM+MF+G+RGA+AFALAIRNT S+ +QM F+TTL++V  TV++ GG T PM+ +L+IR+G D  + +S+ E  + ++  +   LD N    + A L RM+   D +++KP+LTHS P L  T P  C   ++ LT+ +
Sbjct:   41 FKNHRFRFLHETGGAMVYGLIMGLILRYATAPTDIDSGTVY--------NCGNLFFSPSTLL-VNITDQV--YEYKYQREINQHNISPHQGNAILEKMTFDPEIFFNVLLPPIIFHAGYSLKKRHFFQNLGSILTYAFLGTAISCVVIGLIMYGFVKAMVHAGQLKSGDFHFTDCLFFGSLMSATDPVTVLAIFHELHVDPDLYTLLFGESVLNDAVAIVLTYSISIYSPKENPNAFDTAAFFQSVGNFLGIFAGSFAMGSAYAVVTALLTKFTKLREFPMLETGLFFLLSWSAFLSAEAAGLTGIVAVLFCGVTQAHYTYNNLSSDSKLRTKQLFEFMNFLAENVIFCYMGLALFTFQNHIFNALFILGAFLAIFVARACNIYPLSFLLNLGRKQKIPWNFQHMMMFSGLRGAIAFALAIRNTESQPKQMMFTTTLLLVFFTVWVFGGGTTPMLTWLQIRVGVD--LDESLKE--EPSSQQEANKLDKNMTKTESAQLFRMWYGFDHKYLKPILTHSGPPLTTTLPAWCGPVSRLLTSPQ 566          
BLAST of slc9a-2 vs. UniProt/SwissProt
Match: sp|Q96T83|SL9A7_HUMAN (Sodium/hydrogen exchanger 7 OS=Homo sapiens OX=9606 GN=SLC9A7 PE=1 SV=1)

HSP 1 Score: 476.093 bits (1224), Expect = 1.577e-156
Identity = 277/606 (45.71%), Postives = 388/606 (64.03%), Query Frame = 3
Query:   84 EQSREEKVQQNHKTDXXXXXXXXXXXXXXXXXXXXFKHKRLRFVHETSCSLIYGLILGVIF-YNLPIDVNKVTTTLQMPQSKTNCAYQLPPDNIILEMNLLNRTSPYTFKYRHVLNDHESDAKDLSRKATFDAEIFFNLLLPPIIFCAGYNMKKKHFFENLGAIASFAFLGTILSSLTIGGLCYG---LSRTITSISDSIGFGECLLFGSFISATDPVTVLAIFNDINIEVDLYAFVFGESVLNDAVAIVLVNSVEQYGKIA-NNGEFNPFAILIAAKSFMTVFLGALSIGCVVGICTALVTKYTYLRDHPLLETSLFFLMSYCSFLIAEVAGASGIVASLFCGITQAHYTYNNLSEESQKWTKGIFELMSFLSENFVFVYIGVSNFTFRDHNWQPRFICIAIFAIIVGRAVNVYILSAMLNLGRKNKIKFNHQHMLMFAGVRGAMAFALAIRNTSSKVRQMFFSTTLVIVMVTVFICGGLTLPMINFLKIRIGKD-------NE----------ITDSIPEPADDTTISDEQVLD--------LNERHKKKAFLIRMFAKLDCQFIKPLLTHSPPLLIDTCPLCCFTFAKFLTTSEQISRNSHLR 1811
            E + E++ +++H+ DS+ LL+F++LL ++++TIW+FKH+R+RF+HET  ++IYGLI+GVI  Y  P    +  +     + +      +       E  L    SP        +N  E +  D+ RK TFD E+FFN+LLPPIIF AGY++KK+HFF NLG+I ++AFLGT +S   IG L YG   L + +  +SD   + +CL FG+ ISATDPVTVLAIFN+++ +VDLYA +FGESVLNDAVAIVL +S+  Y     N   F+  A   +   F+ +F G+ ++G V G+  A VTK+T L   PLLET+LFFLMS+ +FL+AE  G +G+VA LFCGITQAHYTYNNLS ES+  TK +FE++ FL+ENF+F Y+G++ FTF+ H + P FI  A  AI +GRA ++Y LS  LNLGR++KI +N QHM+MF+G+RGAMAFALAIR+T+S  RQM F+TTL+IV  TV+I GG T PM+++L IR+G +       NE            D  P P +D+     QVL          N   ++ A++ R++   D  ++KP+LTHS P L  T P  C   A+ LT+ +       LR
Sbjct:   56 ELATEKEAEESHRQDSVSLLTFILLLTLTILTIWLFKHRRVRFLHETGLAMIYGLIVGVILRYGTPATSGRDKSLSCTQEDRAFSTLLVNVSGKFFEYTLKGEISPGK------INSVEQN--DMLRKVTFDPEVFFNILLPPIIFHAGYSLKKRHFFRNLGSILAYAFLGTAVSCFIIGNLMYGVVKLMKIMGQLSDKFYYTDCLFFGAIISATDPVTVLAIFNELHADVDLYALLFGESVLNDAVAIVLSSSIVAYQPAGLNTHAFDAAAFFKSVGIFLGIFSGSFTMGAVTGV-NANVTKFTKLHCFPLLETALFFLMSWSTFLLAEACGFTGVVAVLFCGITQAHYTYNNLSVESRSRTKQLFEVLHFLAENFIFSYMGLALFTFQKHVFSPIFIIGAFVAIFLGRAAHIYPLSFFLNLGRRHKIGWNFQHMMMFSGLRGAMAFALAIRDTASYARQMMFTTTLLIVFFTVWIIGGGTTPMLSWLNIRVGVEEPSEEDQNEHHWQYFRVGVDPDQDPPPNNDSF----QVLQGDGPDSARGNRTKQESAWIFRLWYSFDHNYLKPILTHSGPPLTTTLPAWCGLLARCLTSPQVYDNQEPLR 648          
BLAST of slc9a-2 vs. UniProt/SwissProt
Match: sp|Q8IVB4|SL9A9_HUMAN (Sodium/hydrogen exchanger 9 OS=Homo sapiens OX=9606 GN=SLC9A9 PE=1 SV=1)

HSP 1 Score: 468.389 bits (1204), Expect = 1.193e-154
Identity = 254/576 (44.10%), Postives = 370/576 (64.24%), Query Frame = 3
Query:  189 FKHKRLRFVHETSCSLIYGLILGVI--FYNLPIDVNKVTTTLQMPQSKTNCAYQLPPDNIILEMNLLNRTSPYTFKY---RHVLNDHESDAKDLSRKATFDAEIFFNLLLPPIIFCAGYNMKKKHFFENLGAIASFAFLGTILSSLTIGGLCYGLSRTITSISD----SIGFGECLLFGSFISATDPVTVLAIFNDINIEVDLYAFVFGESVLNDAVAIVLVNSVEQYGKIANNGEFNPFAILIAAKSFMTVFLGALSIGCVVGICTALVTKYTYLRDHPLLETSLFFLMSYCSFLIAEVAGASGIVASLFCGITQAHYTYNNLSEESQKWTKGIFELMSFLSENFVFVYIGVSNFTFRDHNWQPRFICIAIFAIIVGRAVNVYILSAMLNLGRKNKIKFNHQHMLMFAGVRGAMAFALAIRNTSSKVRQMFFSTTLVIVMVTVFICGGLTLPMINFLKIRIGKDNEITDSIPEPADDTTISDE-QVLDLNERHKKKAFLIRMFAKLDCQFIKPLLTHSPPLLIDTCPLCCFTFAKFLTTSEQISRNSHLRISKNNISMDMTGDNMAYKSDRDLTS 1886
            FK+ R RF+HET  +++YGLI+G+I  +   P D+   T          +C  +L      L +N+ ++   Y +K    +H +N H+ +A  +  K TFD EIFFN+LLPPIIF AGY++KK+HFF+NLG+I ++AFLGT +S + IG + YG  + +            F +CL FGS +SATDPVTVLAIF++++++ DLY  +FGESVLNDAVAIVL  S+  Y    N   F+  A   +  +F+ +F G+ ++G    I TAL+TK+T L + P+LET LFFL+S+ +FL AE AG +GIVA LFCG+TQAHYTYNNLS +S+  TK +FE M+FL+EN +F Y+G++ FTF++H +   FI  A  AI V RA N+Y LS +LNLGRK KI +N QHM+MF+G+RGA+AFALAIRNT S+ +QM F+TTL++V  TV++ GG T PM+ +L+IR+G D  + +++ E  D ++   E   LD N    + A L RM+   D +++KP+LTHS P L  T P  C   ++ LT+ +        ++ ++++   +  D +A       +S
Sbjct:   41 FKNHRFRFLHETGGAMVYGLIMGLILRYATAPTDIESGTVY--------DCV-KLTFSPSTLLVNITDQVYEYKYKREISQHNINPHQGNA--ILEKMTFDPEIFFNVLLPPIIFHAGYSLKKRHFFQNLGSILTYAFLGTAISCIVIGLIMYGFVKAMIHAGQLKNGDFHFTDCLFFGSLMSATDPVTVLAIFHELHVDPDLYTLLFGESVLNDAVAIVLTYSISIYSPKENPNAFDAAAFFQSVGNFLGIFAGSFAMGSAYAIITALLTKFTKLCEFPMLETGLFFLLSWSAFLSAEAAGLTGIVAVLFCGVTQAHYTYNNLSSDSKIRTKQLFEFMNFLAENVIFCYMGLALFTFQNHIFNALFILGAFLAIFVARACNIYPLSFLLNLGRKQKIPWNFQHMMMFSGLRGAIAFALAIRNTESQPKQMMFTTTLLLVFFTVWVFGGGTTPMLTWLQIRVGVD--LDENLKE--DPSSQHQEANNLDKNMTKAESARLFRMWYSFDHKYLKPILTHSGPPLTTTLPEWCGPISRLLTSPQAYGE----QLKEDDVECIVNQDELAINYQEQASS 597          
BLAST of slc9a-2 vs. TrEMBL
Match: A0A0H3YIW8 (Sodium/hydrogen exchanger OS=Schmidtea mediterranea OX=79327 GN=slc9a-2 PE=2 SV=1)

HSP 1 Score: 1295.03 bits (3350), Expect = 0.000e+0
Identity = 677/677 (100.00%), Postives = 677/677 (100.00%), Query Frame = 3
Query:   45 MVSKCEALNEKILEQSREEKVQQNHKTDXXXXXXXXXXXXXXXXXXXXFKHKRLRFVHETSCSLIYGLILGVIFYNLPIDVNKVTTTLQMPQSKTNCAYQLPPDNIILEMNLLNRTSPYTFKYRHVLNDHESDAKDLSRKATFDAEIFFNLLLPPIIFCAGYNMKKKHFFENLGAIASFAFLGTILSSLTIGGLCYGLSRTITSISDSIGFGECLLFGSFISATDPVTVLAIFNDINIEVDLYAFVFGESVLNDAVAIVLVNSVEQYGKIANNGEFNPFAILIAAKSFMTVFLGALSIGCVVGICTALVTKYTYLRDHPLLETSLFFLMSYCSFLIAEVAGASGIVASLFCGITQAHYTYNNLSEESQKWTKGIFELMSFLSENFVFVYIGVSNFTFRDHNWQPRFICIAIFAIIVGRAVNVYILSAMLNLGRKNKIKFNHQHMLMFAGVRGAMAFALAIRNTSSKVRQMFFSTTLVIVMVTVFICGGLTLPMINFLKIRIGKDNEITDSIPEPADDTTISDEQVLDLNERHKKKAFLIRMFAKLDCQFIKPLLTHSPPLLIDTCPLCCFTFAKFLTTSEQISRNSHLRISKNNISMDMTGDNMAYKSDRDLTSFNPGLPXXXXXXXXXXXXXHFKKHLSDQEFILTDTDDNAGYIEGEESGLYIQEYSAIPNTNSV 2075
            MVSKCEALNEKILEQSREEKVQQNHKTDSLILLSFLILLIVSVITIWIFKHKRLRFVHETSCSLIYGLILGVIFYNLPIDVNKVTTTLQMPQSKTNCAYQLPPDNIILEMNLLNRTSPYTFKYRHVLNDHESDAKDLSRKATFDAEIFFNLLLPPIIFCAGYNMKKKHFFENLGAIASFAFLGTILSSLTIGGLCYGLSRTITSISDSIGFGECLLFGSFISATDPVTVLAIFNDINIEVDLYAFVFGESVLNDAVAIVLVNSVEQYGKIANNGEFNPFAILIAAKSFMTVFLGALSIGCVVGICTALVTKYTYLRDHPLLETSLFFLMSYCSFLIAEVAGASGIVASLFCGITQAHYTYNNLSEESQKWTKGIFELMSFLSENFVFVYIGVSNFTFRDHNWQPRFICIAIFAIIVGRAVNVYILSAMLNLGRKNKIKFNHQHMLMFAGVRGAMAFALAIRNTSSKVRQMFFSTTLVIVMVTVFICGGLTLPMINFLKIRIGKDNEITDSIPEPADDTTISDEQVLDLNERHKKKAFLIRMFAKLDCQFIKPLLTHSPPLLIDTCPLCCFTFAKFLTTSEQISRNSHLRISKNNISMDMTGDNMAYKSDRDLTSFNPGLPINVADNINVDINNHFKKHLSDQEFILTDTDDNAGYIEGEESGLYIQEYSAIPNTNSV
Sbjct:    1 MVSKCEALNEKILEQSREEKVQQNHKTDSLILLSFLILLIVSVITIWIFKHKRLRFVHETSCSLIYGLILGVIFYNLPIDVNKVTTTLQMPQSKTNCAYQLPPDNIILEMNLLNRTSPYTFKYRHVLNDHESDAKDLSRKATFDAEIFFNLLLPPIIFCAGYNMKKKHFFENLGAIASFAFLGTILSSLTIGGLCYGLSRTITSISDSIGFGECLLFGSFISATDPVTVLAIFNDINIEVDLYAFVFGESVLNDAVAIVLVNSVEQYGKIANNGEFNPFAILIAAKSFMTVFLGALSIGCVVGICTALVTKYTYLRDHPLLETSLFFLMSYCSFLIAEVAGASGIVASLFCGITQAHYTYNNLSEESQKWTKGIFELMSFLSENFVFVYIGVSNFTFRDHNWQPRFICIAIFAIIVGRAVNVYILSAMLNLGRKNKIKFNHQHMLMFAGVRGAMAFALAIRNTSSKVRQMFFSTTLVIVMVTVFICGGLTLPMINFLKIRIGKDNEITDSIPEPADDTTISDEQVLDLNERHKKKAFLIRMFAKLDCQFIKPLLTHSPPLLIDTCPLCCFTFAKFLTTSEQISRNSHLRISKNNISMDMTGDNMAYKSDRDLTSFNPGLPINVADNINVDINNHFKKHLSDQEFILTDTDDNAGYIEGEESGLYIQEYSAIPNTNSV 677          
BLAST of slc9a-2 vs. TrEMBL
Match: A0A267G2N7 (Sodium/hydrogen exchanger OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig031846g1 PE=3 SV=1)

HSP 1 Score: 596.275 bits (1536), Expect = 0.000e+0
Identity = 315/607 (51.89%), Postives = 424/607 (69.85%), Query Frame = 3
Query:   60 EALNEKILEQSREEKVQQNHKTDXXXXXXXXXXXXXXXXXXXXFKHKRLRFVHETSCSLIYGLILGVI--FYNLPID--VNKVTTTLQMPQSKTNCAYQLPPDNII---LEMNLLNRTSPYTFKYRHVLNDHESDAKDLSRKATFDAEIFFNLLLPPIIFCAGYNMKKKHFFENLGAIASFAFLGTILSSLTIGGLCYGLSRTITSISDSIGFGECLLFGSFISATDPVTVLAIFNDINIEVDLYAFVFGESVLNDAVAIVLVNSVEQYGKIANN-GEFNPFAILIAAKSFMTVFLGALSIGCVVGICTALVTKYTYLRDHPLLETSLFFLMSYCSFLIAEVAGASGIVASLFCGITQAHYTYNNLSEESQKWTKGIFELMSFLSENFVFVYIGVSNFTFRDHNWQPRFICIAIFAIIVGRAVNVYILSAMLNLGRKNKIKFNHQHMLMFAGVRGAMAFALAIRNTSSKVRQMFFSTTLVIVMVTVFICGGLTLPMINFLKIRIGKDNEITDSIPEPADDTTISDEQVLDLNERHKKKAFLIRMFAKLDCQFIKPLLTHSPPLLIDTCPLCCFTFAKFLTTSEQISRNSHLRISKNNISMDMTGDNM 1856
            E + +K +E+S+E +V+ NH +DSL LL +L LLIV+++T+W+FKH+RLR++HET  ++IYGL++G I  + + P +  V +   T  +P S       LPP+ ++   LE+   N++  Y + Y+  L  +E  +  L  KATF+ E+FFN++LPPIIFCAGY+MK+KHFF N+GAI + AF+GT +S + +G L YG++R  T I  SI F ECLLFG+ ISATDPVTVLAIFND+N++VDLYA VFGESVLNDAVAIVL  S+E+YG +A + G     AIL A  SF+ VF GAL IG  +G  TAL+TKYT +RDHPLLE+SLF LMSY +FL AE A ++GIVA LFCGI QAHYTYNNLS ES++ TK  FEL++FL+ENF F+YIGVS FT+  H W P FI  A  AI++GRA+NVY L  +LNLGR+N+I  N  HMLMF+G+RGA+AFALAIRNTSS VR+M  STTL+IV+ TV +CG LT  M+ +L+IR+G + E      E     + ++  +     R   +A+  R +  LD + +KPLLTH+ PLL +TCP CC   A+ LTT EQ+++ S        +  D+  DN+
Sbjct:    4 EEIIDKSVEKSQESRVETNHVSDSLTLLLYLGLLIVTLLTVWLFKHRRLRYIHETGLAVIYGLLVGAIIRYGSQPSEFSVRRFNATGSLPGSDA-----LPPEKVLVTMLEIGDNNQSRVYEYDYKRRLYGNEVRSPILDEKATFNPEVFFNIILPPIIFCAGYSMKRKHFFRNIGAILTLAFIGTTISCVVVGSLVYGITRLSTGIGSSILFNECLLFGALISATDPVTVLAIFNDLNVDVDLYALVFGESVLNDAVAIVLSQSIEKYGALAASAGGIQGEAILKAVLSFLGVFFGALGIGSAMGCLTALITKYTRVRDHPLLESSLFILMSYSTFLAAEAARSTGIVAVLFCGICQAHYTYNNLSRESKESTKNFFELLNFLAENFTFLYIGVSTFTYSSHLWDPVFIFAAFVAILLGRALNVYPLCLLLNLGRRNRIGANKMHMLMFSGLRGAIAFALAIRNTSSSVRKMMLSTTLLIVIATVLLCGSLTTQMLQWLRIRVGVEEEAPKRNYEDIQSGSEAEIAMASAANRGSNRAWFARSWHGLDNRLLKPLLTHARPLLTETCPRCCLPLAQLLTTDEQLTQAS--------VQRDLIADNL 597          
BLAST of slc9a-2 vs. TrEMBL
Match: A0A267GH55 (Sodium/hydrogen exchanger OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig030381g2 PE=3 SV=1)

HSP 1 Score: 592.038 bits (1525), Expect = 0.000e+0
Identity = 314/607 (51.73%), Postives = 422/607 (69.52%), Query Frame = 3
Query:   60 EALNEKILEQSREEKVQQNHKTDXXXXXXXXXXXXXXXXXXXXFKHKRLRFVHETSCSLIYGLILGVI--FYNLPID--VNKVTTTLQMPQSKTNCAYQLPPDNII---LEMNLLNRTSPYTFKYRHVLNDHESDAKDLSRKATFDAEIFFNLLLPPIIFCAGYNMKKKHFFENLGAIASFAFLGTILSSLTIGGLCYGLSRTITSISDSIGFGECLLFGSFISATDPVTVLAIFNDINIEVDLYAFVFGESVLNDAVAIVLVNSVEQYGKIANN-GEFNPFAILIAAKSFMTVFLGALSIGCVVGICTALVTKYTYLRDHPLLETSLFFLMSYCSFLIAEVAGASGIVASLFCGITQAHYTYNNLSEESQKWTKGIFELMSFLSENFVFVYIGVSNFTFRDHNWQPRFICIAIFAIIVGRAVNVYILSAMLNLGRKNKIKFNHQHMLMFAGVRGAMAFALAIRNTSSKVRQMFFSTTLVIVMVTVFICGGLTLPMINFLKIRIGKDNEITDSIPEPADDTTISDEQVLDLNERHKKKAFLIRMFAKLDCQFIKPLLTHSPPLLIDTCPLCCFTFAKFLTTSEQISRNSHLRISKNNISMDMTGDNM 1856
            E + +K +E+S+E +V+ NH +DSL LL +L LLIV+++T+W+FKH RLR++HET  ++IYGL++G I  + + P +  V +   T  +P S       LPP+ ++   LE+   N++  Y + Y+  L  +E  +  L  KATF+ E+FFN++LPPIIFCAGY+MK+KHFF N+GAI + AF+GT +S + +G L YG++R  T I  SI F ECLLFG+ ISATDPVTVLAIFND+N++VDLYA VFGESVLNDAVAIVL  S+E+YG +A + G     AIL A  SF+ VF GAL I   +G  TAL+TKYT +RDHPLLE+SLF LMSY +FL AE A ++GIVA LFCGI QAHYTYNNLS ES++ TK  FEL++FL+ENF F+YIGVS FT+  H W P FI  A  AI++GRA+NVY L  +LNLGR+N+I  N  HMLMF+G+RGA+AFALAIRNTSS VR+M  STTL+IV+ TV +CG LT  M+ +L+IR+G + E      E     + ++  +     R   +A+  R +  LD + +KPLLTH+ PLL +TCP CC   A+ LTT EQ+++ S        +  D+  DN+
Sbjct:    4 EEIIDKSVEKSQESRVETNHVSDSLTLLLYLGLLIVTLLTVWLFKHHRLRYIHETGLAVIYGLLVGAIIRYGSQPSEFSVRRFNATGSLPGSDA-----LPPEKVLVTMLEIGDNNQSRVYEYDYKRRLYGNEVRSPILDEKATFNPEVFFNIILPPIIFCAGYSMKRKHFFRNIGAILTLAFIGTTISCVVVGSLVYGITRLSTGIGSSILFNECLLFGALISATDPVTVLAIFNDLNVDVDLYALVFGESVLNDAVAIVLSQSIEKYGALAASAGGIQGEAILKAVLSFLGVFFGALGISSAMGCLTALITKYTRVRDHPLLESSLFILMSYSTFLAAEAARSTGIVAVLFCGICQAHYTYNNLSRESKESTKNFFELLNFLAENFTFLYIGVSTFTYSSHLWDPVFIFAAFVAILLGRALNVYPLCLLLNLGRRNRIGANKMHMLMFSGLRGAIAFALAIRNTSSSVRKMMLSTTLLIVIATVLLCGSLTTQMLQWLRIRVGVEEEAPKRNYEDIQSGSEAEIAMASAANRGSNRAWFARSWHGLDNRLLKPLLTHARPLLTETCPRCCLPLAQLLTTDEQLTQAS--------VQRDLIADNL 597          
BLAST of slc9a-2 vs. TrEMBL
Match: A0A267FNB6 (Sodium/hydrogen exchanger OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig003932g1 PE=3 SV=1)

HSP 1 Score: 573.933 bits (1478), Expect = 0.000e+0
Identity = 319/633 (50.39%), Postives = 427/633 (67.46%), Query Frame = 3
Query:   72 EKILEQSREEKVQQNHKTDXXXXXXXXXXXXXXXXXXXXFKHKRLRFVHETSCSLIYGLILGVI--FYNLPIDVNKVT-TTLQMPQSK----------TNCAYQLPPDNIILEMNLL----NRTSPYTFKYRHVLNDHESDAKDLSRKATFDAEIFFNLLLPPIIFCAGYNMKKKHFFENLGAIASFAFLGTILSSLTIGGLCYGLSRTITSISDSIGFGECLLFGSFISATDPVTVLAIFNDINIEVDLYAFVFGESVLNDAVAIVLVNSVEQYGKIA-NNGEFNPFAILIAAKSFMTVFLGALSIGCVVGICTALVTKYTYLRDHPLLETSLFFLMSYCSFLIAEVAGASGIVASLFCGITQAHYTYNNLSEESQKWTKGIFELMSFLSENFVFVYIGVSNFTFRDHNWQPRFICIAIFAIIVGRAVNVYILSAMLNLGRKNKIKFNHQHMLMFAGVRGAMAFALAIRNTSSKVRQMFFSTTLVIVMVTVFICGGLTLPMINFLKIRIGKDNEITDSIPEPADDTT---------------------ISDEQVLD-----LNERHKKKAFLIRMFAKLDCQFIKPLLTHSPPLLIDTCPLCCFTFAKFLTTSEQISRNSHLRISKNNISMD 1838
            EK +E+S+ E+V+ NH +DSL LL +L LL++S++TIW+FKH R RF+HETS ++IYGLI+G I  + + P +++  T T L  P                A  LPP+ ++L M  L    NRT  Y + Y   L +   +A  LS KATF++E+FF+++LPPIIFCAGY+MK+KHFF N+GAI + AF+GT +S   +G + YGL+R   S+S SI F +CLLFG+ ISATDPVTVLAIFND+N++VDLYA VFGESVLNDAVAIVL  SVE+Y  +A  +  F   AI+ +  SF+ VF GAL IG  +G  TAL+TKYT +R+HPLLE +LF LMSY +FL AE A ++GIVA LFCGI QAHYTYNNLSE++++ TK  FEL++FL+ENF F+YIGV+ FT+R H W   F+  A  AI++GRA+N+Y L  +LNLGR+ +I  N  HMLMF+G+RGA+AFALAIRNTS+  R+M FSTTLVIV+ TV + GGL   M+++L+IR+G + E +D     AD                        + +EQ +         RHK +  L R++  LD +F+KPLLTH+ PLL +TCP  C   A+ LTT EQ++R S  R   +N SMD
Sbjct:   12 EKSVEKSQAERVEANHISDSLTLLLYLGLLVLSLLTIWLFKHMRFRFIHETSLAIIYGLIVGAIIRYSSNPREISVRTFTLLGNPTGSLSNNVTGAPAVTTADPLPPEKVLLSMLELGSSGNRTRVYEYDYARRLLNRNVNAPVLSEKATFNSEVFFHVILPPIIFCAGYSMKRKHFFSNIGAILTLAFVGTTISCAVVGSVVYGLTRLSRSLSGSILFTDCLLFGAIISATDPVTVLAIFNDLNVDVDLYALVFGESVLNDAVAIVLAQSVEKYDSLAAGSATFEGGAIVTSVLSFLGVFFGALGIGSAMGCLTALITKYTLVREHPLLECTLFILMSYSTFLAAEAAQSTGIVAVLFCGICQAHYTYNNLSEQTKRSTKTFFELLNFLAENFTFLYIGVTTFTYRSHVWDLGFVATAFAAILLGRALNIYPLCCLLNLGRRCRIGANKMHMLMFSGLRGAIAFALAIRNTSTDTRKMLFSTTLVIVIATVLLGGGLATQMLHWLRIRVGVEGE-SDKEQAGADAANSNSPGGVEAAADAPDDFDAAEVGEEQAVSGSLCRSGARHKYEGRLTRLWHLLDIRFLKPLLTHARPLLTETCPPICLPLARLLTTDEQLTRASVHRDLFSN-SMD 642          
BLAST of slc9a-2 vs. TrEMBL
Match: A0A1S3H9X6 (Sodium/hydrogen exchanger OS=Lingula unguis OX=7574 GN=LOC106153488 PE=3 SV=1)

HSP 1 Score: 567 bits (1460), Expect = 0.000e+0
Identity = 305/618 (49.35%), Postives = 430/618 (69.58%), Query Frame = 3
Query:   81 LEQSREEKVQQNHKTDXXXXXXXXXXXXXXXXXXXXFKHKRLRFVHETSCSLIYGLILGVIFYNLPIDVNKVTTTLQMPQSKTNCAYQLPPDNIILEMNLLNR--------TSPYTFKYRHVLNDHESDAKDLSRKATFDAEIFFNLLLPPIIFCAGYNMKKKHFFENLGAIASFAFLGTILSSLTIGGLCYGLSRTITSISD--------SIGFGECLLFGSFISATDPVTVLAIFNDINIEVDLYAFVFGESVLNDAVAIVLVNSVEQYGKIANNGEFNPF---AILIAAKSFMTVFLGALSIGCVVGICTALVTKYTYLRDHPLLETSLFFLMSYCSFLIAEVAGASGIVASLFCGITQAHYTYNNLSEESQKWTKGIFELMSFLSENFVFVYIGVSNFTFRDHNWQPRFICIAIFAIIVGRAVNVYILSAMLNLGRKNKIKFNHQHMLMFAGVRGAMAFALAIRNTSSKVRQMFFSTTLVIVMVTVFICGGLTLPMINFLKIRIGKDNEITDSIPEPADDTTISDEQVLDLNERHKKKAFLIRMFAKLDCQFIKPLLTHSPPLLIDTCPLCCFTFAKFLTTSEQISRNSHLRISKNNISMDMTGDNMAYKSDRD 1877
            L+++ E KV+++H+ DSL LL FLILL ++V+TIW+FKH+RLRFVHET   ++YGLI+GVI         K+     +P+ ++   +  PPDNI LE++L +         T  Y + ++ ++ + ES   ++  KATFD EIFFN+LLPPIIF AGY+MK++HFF N GAI +FAFLGT +S + +GG+ YG +R + + S         + G  +CL FG+ ISATDPVT+LAIF+D+N++VDLYA VFGESVLNDAVAIVL  +VE+Y  +   G  +     A+L +  +F+ +F GA +IG  +G  TAL+TKYT +RD+PLLET+LFFLMSY +FL AE    +GIVA LFCGI QAHYTYNNLS+ES+  TK +FEL++FL+ENFVF+YIGV+ FTF  H W P FI  A+ AIIVGR +NVY LS +LNLGRKNKI  N QHM+MF+G+RGA+AFALAIRNT +  R++ F+TTL+IV++TV +CGG T  M+ +L+IR+G ++E +++    A  ++ +D     +  +  +KA+L+  + K D +F+KPLLTH+ P L +T P CC  FA FLTT +Q+++    R   ++  M +  + + Y +D +
Sbjct:   20 LDENIENKVKESHRIDSLNLLIFLILLTMTVLTIWLFKHRRLRFVHETGLGILYGLIVGVIIRYTSTTEQKLWQNFTLPE-ESPFNFSHPPDNIHLEVSLFSDVANNTQLITQEYLYSFKGLVYNAES--TEIEDKATFDPEIFFNVLLPPIIFHAGYSMKRRHFFRNFGAIVTFAFLGTAVSCMIVGGILYGFTRLMVTYSSLWKQWGLTNFGLTDCLFFGALISATDPVTILAIFHDLNVDVDLYALVFGESVLNDAVAIVLAGAVEKYSDVRATGISDAVDYKAVLESLGNFLGIFCGAFAIGSFMGCITALLTKYTQIRDYPLLETTLFFLMSYSTFLTAESLSLTGIVAVLFCGICQAHYTYNNLSQESKVRTKQLFELLNFLAENFVFIYIGVAIFTFNRHRWDPGFIFAALLAIIVGRGLNVYPLSFLLNLGRKNKIPMNFQHMMMFSGLRGAIAFALAIRNTLTPARELMFTTTLLIVILTVILCGGFTTQMLQWLRIRVGVEDE-SEAQNFQAVRSSPTDAAPPPMRIQESEKAWLVMKWYKFDQKFMKPLLTHARPPLTETLPACCGRFAMFLTTEQQLAQAEPGRSDDSDEDMIIDENELTYGADNN 633          
BLAST of slc9a-2 vs. Ensembl Cavefish
Match: slc9a6a (solute carrier family 9 member A6 [Source:NCBI gene;Acc:103029133])

HSP 1 Score: 505.368 bits (1300), Expect = 2.818e-169
Identity = 279/613 (45.51%), Postives = 400/613 (65.25%), Query Frame = 3
Query:   57 CEALNEKILEQSREEKVQQNHKTDXXXXXXXXXXXXXXXXXXXXFKHKRLRFVHETSCSLIYGLILGVIFY---NLPIDVNKVTTTLQMPQSKTNCAYQLPPDNIILEMNLLNRTSPYTFKYRHVLND-HESDAKDLSRKATFDAEIFFNLLLPPIIFCAGYNMKKKHFFENLGAIASFAFLGTILSSLTIGGLCYG---LSRTITSISDSIGFGECLLFGSFISATDPVTVLAIFNDINIEVDLYAFVFGESVLNDAVAIVLVNSVEQYGKIANNGE-FNPFAILIAAKSFMTVFLGALSIGCVVGICTALVTKYTYLRDHPLLETSLFFLMSYCSFLIAEVAGASGIVASLFCGITQAHYTYNNLSEESQKWTKGIFELMSFLSENFVFVYIGVSNFTFRDHNWQPRFICIAIFAIIVGRAVNVYILSAMLNLGRKNKIKFNHQHMLMFAGVRGAMAFALAIRNTSSKVRQMFFSTTLVIVMVTVFICGGLTLPMINFLKIRIGKDNEITDSIPEPADDTTISDEQVLDLNERHKKK---AFLIRMFAKLDCQFIKPLLTHSPPLLIDTCPLCCFTFAKFLTTSEQISRNSHLRISKNNISMDMTGDNMAY 1862
            C A +  +     E+K +++H+ DS  LL F++LL ++++TIW+FKH+R RF+HET  ++IYGL++GV+     ++P D+N VT +  +  S              L +N+  +   YT K     N+ ++    ++ RK TFD E+FFN+LLPPIIF AGY++K++HFF N+G+I ++AF+GT++S   IG L YG   L + I  +     F +CL FG+ +SATDPVTVLAIFN++ ++ DLYA +FGESVLNDAVA+VL +S+  Y    +N   F   A+L +   F+ VF G+ ++G   G+ TALVTK+T LRD  LLET+LFFLMS+ +FL+AE  G +G+VA LFCGITQAHYT+NNLS ESQ  TK +FEL++FL+ENF+F Y+G++ FTF++H + P FI  A  AI +GRA N+Y LS +LNLGR+NKI  N QHM+MFAG+RGAM FAL+IR+T++  RQM FSTTL++V  TV++CGG T  M++   IR+G D +   SI             VLD  ER   K   A+L R++   D  ++KP+LTHS P L  T P CC   A+ LT+ +       L+   +++ ++    N+ Y
Sbjct:   32 CGAEDSAMENIVTEKKAEESHRQDSADLLIFIMLLTLTILTIWLFKHRRFRFLHETGLAMIYGLLVGVVLRYGIHVPRDINNVTMSCHVNSSPAT-----------LLVNVSGKFYEYTLKGEISANEINDVQDNEMLRKVTFDPEVFFNILLPPIIFHAGYSLKRRHFFRNMGSILAYAFVGTVVSCFIIGLLMYGCVTLMKQIGQLGGDFFFTDCLFFGAIVSATDPVTVLAIFNELQVDFDLYALLFGESVLNDAVAVVLSSSIVAYQPEGDNSHTFEAMALLKSFGIFLGVFSGSFALGVATGVVTALVTKFTKLRDFQLLETALFFLMSWSTFLLAEACGFTGVVAVLFCGITQAHYTFNNLSPESQDRTKQLFELLNFLAENFIFSYMGLTLFTFQNHVFNPIFIVGAFLAIFLGRAANIYPLSFLLNLGRRNKISSNFQHMMMFAGLRGAMTFALSIRDTATYARQMMFSTTLLVVFFTVWVCGGGTTQMLSCQHIRVGVDTDQDSSI-------------VLDGTERRSTKQESAWLFRIWYNFDHNYLKPILTHSGPPLTATLPACCGPLARCLTSPQAYENEGQLKDDDSDLILNDGDINLTY 620          
BLAST of slc9a-2 vs. Ensembl Cavefish
Match: slc9a7 (solute carrier family 9 member 7 [Source:ZFIN;Acc:ZDB-GENE-050913-8])

HSP 1 Score: 490.345 bits (1261), Expect = 3.115e-163
Identity = 277/609 (45.48%), Postives = 405/609 (66.50%), Query Frame = 3
Query:   84 EQSREEKVQQNHKTDXXXXXXXXXXXXXXXXXXXXFKHKRLRFVHETSCSLIYGLILGVIF-YNLPIDVNKVTTTLQMPQSKTNCAYQLPPDNIILEMNLLNRTSPYTFKYRHVLNDHE---SDAKDLSRKATFDAEIFFNLLLPPIIFCAGYNMKKKHFFENLGAIASFAFLGTILSSLTIGGLCYG---LSRTITSISDSIGFGECLLFGSFISATDPVTVLAIFNDINIEVDLYAFVFGESVLNDAVAIVLVNSVEQYGKI-ANNGEFNPFAILIAAKSFMTVFLGALSIGCVVGICTALVTKYTYLRDHPLLETSLFFLMSYCSFLIAEVAGASGIVASLFCGITQAHYTYNNLSEESQKWTKGIFELMSFLSENFVFVYIGVSNFTFRDHNWQPRFICIAIFAIIVGRAVNVYILSAMLNLGRKNKIKFNHQHMLMFAGVRGAMAFALAIRNTSSKVRQMFFSTTLVIVMVTVFICGGLTLPMINFLKI--------------RIGKD-----NEITDSIPEPADDTTISDEQVLDLNERHKKKAFLIRMFAKLDCQFIKPLLTHSPPLLIDTCPLCCFTFAKFLTTSEQISRNSHLRISKNNI 1829
            E + E++ +++H+ DS+ LL+F++LL ++++TIW+FKH+R+RF+HET  ++IYGL++GVI  Y +P       +T    ++  +C+ +  P + +L +N+  +   YT K    +N HE    +  D+ RK TFD E+FFN+LLPPIIF AGY++KK+HFF NLG+I ++AFLGT +S   IG L YG   L + +  ++D   + +CL FG+ ISATDPVTVLAIFN+++ +VDLYA +FGESV+NDAVAIVL +S+  Y    AN   F+  A   +   F+ +F G+ ++G V G+ TAL++ +  L   PLLET+LFFLMS+ +FL+AE  G +G+VA LFCGITQAHYTYNNLSEES K TK +FE++ FL+ENF+F Y+G++ FTF++H + P FI  A  AI +GRA N+Y LS +LNLGR++KI  N QHM+MFAG+RGAMAFALAIR+T++  RQM F+TTL+IV  TV++ GG T PM+++L I              R+G D     +   DS      D +  + Q    ++  ++ A+L R++   D  ++KP+LTHS P L  T P CC   A  LT+ +    +  LR + +++
Sbjct:   46 ELATEKEAEESHRQDSVNLLTFILLLTLTILTIWLFKHRRVRFLHETGLAMIYGLLVGVILRYGIP-------STSYHNKTPPSCSLKEGPVSTLL-LNVSGKFFEYTLKGE--INSHEIHNVEQNDMLRKVTFDPEVFFNILLPPIIFHAGYSLKKRHFFRNLGSIITYAFLGTAISCFVIGNLMYGVVKLMQVVGQLTDKFYYTDCLFFGAIISATDPVTVLAIFNELHADVDLYALLFGESVMNDAVAIVLSSSIVAYQPSGANTHTFDASAFFKSVGIFLGIFSGSFAMGAVTGVVTALIS-FKSLHCFPLLETALFFLMSWSTFLLAEACGFTGVVAVLFCGITQAHYTYNNLSEESTKRTKQLFEVLHFLAENFIFSYMGLALFTFQNHVFSPIFIVGAFVAIFIGRASNIYPLSFLLNLGRRHKIGGNFQHMMMFAGLRGAMAFALAIRDTATYARQMMFTTTLLIVFFTVWVFGGGTTPMLSWLHIRSVLIFSFVFFFCFRVGVDPDQDLHPCGDSFQVLQGDGSQQEGQ----SKTKQESAWLFRLWYTFDHNYLKPILTHSGPPLTTTLPACCGPLAHCLTSPQAYENSEQLRDTDSDL 639          
BLAST of slc9a-2 vs. Ensembl Cavefish
Match: slc9a6a (solute carrier family 9 member A6 [Source:NCBI gene;Acc:103029133])

HSP 1 Score: 490.345 bits (1261), Expect = 4.326e-163
Identity = 278/649 (42.84%), Postives = 401/649 (61.79%), Query Frame = 3
Query:   57 CEALNEKILEQSREEKVQQNHKTDXXXXXXXXXXXXXXXXXXXXFKHKRLRFVHETSCSLIYGLILGVIFY---NLPIDVNKVTTTLQMPQSKTNCAYQLPPDNIILEMNLLNRTSPYTFKYRHVLND-HESDAKDLSRKATFDAEIFFNLLLPPIIFCAGYNMKKKHFFENLGAIASFAFLGTILSSLTIGGLCYG---LSRTITSISDSIGFGECLLFGSFISATDPVTVLAIFNDINIEVDLYAFVFGESVLNDAVAIVLVNSVEQYGKIANNGE-------------------------------------FNPFAILIAAKSFMTVFLGALSIGCVVGICTALVTKYTYLRDHPLLETSLFFLMSYCSFLIAEVAGASGIVASLFCGITQAHYTYNNLSEESQKWTKGIFELMSFLSENFVFVYIGVSNFTFRDHNWQPRFICIAIFAIIVGRAVNVYILSAMLNLGRKNKIKFNHQHMLMFAGVRGAMAFALAIRNTSSKVRQMFFSTTLVIVMVTVFICGGLTLPMINFLKIRIGKDNEITDSIPEPADDTTISDEQVLDLNERHKKK---AFLIRMFAKLDCQFIKPLLTHSPPLLIDTCPLCCFTFAKFLTTSEQISRNSHLRISKNNISMDMTGDNMAY 1862
            C A +  +     E+K +++H+ DS  LL F++LL ++++TIW+FKH+R RF+HET  ++IYGL++GV+     ++P D+N VT +  +  S              L +N+  +   YT K     N+ ++    ++ RK TFD E+FFN+LLPPIIF AGY++K++HFF N+G+I ++AF+GT++S   IG L YG   L + I  +     F +CL FG+ +SATDPVTVLAIFN++ ++ DLYA +FGESVLNDAVA+VL + +  +G+    G+                                     F   A+L +   F+ VF G+ ++G   G+ TALVTK+T LRD  LLET+LFFLMS+ +FL+AE  G +G+VA LFCGITQAHYT+NNLS ESQ  TK +FEL++FL+ENF+F Y+G++ FTF++H + P FI  A  AI +GRA N+Y LS +LNLGR+NKI  N QHM+MFAG+RGAM FAL+IR+T++  RQM FSTTL++V  TV++CGG T  M++   IR+G D +   SI             VLD  ER   K   A+L R++   D  ++KP+LTHS P L  T P CC   A+ LT+ +       L+   +++ ++    N+ Y
Sbjct:   32 CGAEDSAMENIVTEKKAEESHRQDSADLLIFIMLLTLTILTIWLFKHRRFRFLHETGLAMIYGLLVGVVLRYGIHVPRDINNVTMSCHVNSSPAT-----------LLVNVSGKFYEYTLKGEISANEINDVQDNEMLRKVTFDPEVFFNILLPPIIFHAGYSLKRRHFFRNMGSILAYAFVGTVVSCFIIGLLMYGCVTLMKQIGQLGGDFFFTDCLFFGAIVSATDPVTVLAIFNELQVDFDLYALLFGESVLNDAVAVVLSSILPNHGRHGGVGQHSHGGVAQCVKGGNQTQRPPLNGSIVAYQPEGDNSHTFEAMALLKSFGIFLGVFSGSFALGVATGVVTALVTKFTKLRDFQLLETALFFLMSWSTFLLAEACGFTGVVAVLFCGITQAHYTFNNLSPESQDRTKQLFELLNFLAENFIFSYMGLTLFTFQNHVFNPIFIVGAFLAIFLGRAANIYPLSFLLNLGRRNKISSNFQHMMMFAGLRGAMTFALSIRDTATYARQMMFSTTLLVVFFTVWVCGGGTTQMLSCQHIRVGVDTDQDSSI-------------VLDGTERRSTKQESAWLFRIWYNFDHNYLKPILTHSGPPLTATLPACCGPLARCLTSPQAYENEGQLKDDDSDLILNDGDINLTY 656          
BLAST of slc9a-2 vs. Ensembl Cavefish
Match: slc9a6b (solute carrier family 9 member 6b [Source:ZFIN;Acc:ZDB-GENE-080226-2])

HSP 1 Score: 469.159 bits (1206), Expect = 1.279e-155
Identity = 265/587 (45.14%), Postives = 388/587 (66.10%), Query Frame = 3
Query:   45 MVSKCEALNEKILEQSREEKVQQNHKTDXXXXXXXXXXXXXXXXXXXXFKHKRLRFVHETSCSLIYGLILGVIFYNLPIDVNKVTTTLQMPQSKTNCAYQLPPDNIILEMNLLNRTSPYTFKYRHVLNDHESDAKD--LSRKATFDAEIFFNLLLPPIIFCAGYNMKKKHFFENLGAIASFAFLGTILSSLTIGGLCYGLSRTITSISDSIG---FGECLLFGSFISATDPVTVLAIFNDINIEVDLYAFVFGESVLNDAVAIVLVNSVEQYGKIANNGE-FNPFAILIAAKSFMTVFLGALSIGCVVGICTALVTKYTYLRDHPLLETSLFFLMSYCSFLIAEVAGASGIVASLFCGITQAHYTYNNLSEESQKWTKGIFELMSFLSENFVFVYIGVSNFTFRDHNWQPRFICIAIFAIIVGRAVNVYILSAMLNLGRKNKIKFNHQHMLMFAGVRGAMAFALAIRNTSSKVRQMFFSTTLVIVMVTVFICGGLTLPMINFLKIRIGKDNEITDSIPEPADDTTISDEQVLDLNERHKKKAFLIRMFAKLDCQFIKPLLTHSPPLLIDTCPLCCFTFAKFLTTSEQ 1787
            ++S CE     +++   E + +++H+ +S I L F +LL  +++T W+FKH RLR +HET  ++IYGL++GVI   L   V+     +  P +   C +   P +++L  N+  R   YT          E DA +  + +K TFD E+FFN+LLPPIIF AGY++K+++FF NLG+I S+AF+GT++SS  IG + YG    ++++    G   F +CL FG+ ISATDPVTVLAIFND+ ++VDLYA + GESVLNDAVAIVL +S+  Y    ++   F   AIL++   F+ V  G+L +G   G  TALVTK T LR+ PLLET+LFFLMS+ +FL+AE    +G+VA LFCGITQAHYT +NLS ES+K T+ + EL++FL+E+F+F Y+G++ F++++H + P FI  +  AI++GRA N+Y LS +LNLGR N+I  N QH++MFAG+RGAMAFAL+IR+TS+  RQM FSTTL+IV  TV++ GG T P+++ + IR+G + +  + I E           + D+       A+ IR++ K D  ++KPLLTHS P L  + P CC   A+ L +S++
Sbjct:   30 VLSVCECEGPGLVDAVSERRAEESHRQNSAIALLFTLLLTATILTTWLFKHHRLRLLHETGLAMIYGLLMGVI---LRFGVHVQPDLIDAPLT---CVFNSSPRSLLL--NISGRLFEYTLSGEASDTPRE-DAPNSQILKKVTFDPEVFFNILLPPIIFHAGYSLKRRYFFRNLGSILSYAFVGTVISSFVIGLVMYGFVACMSAVGQLGGDFFFTDCLFFGAIISATDPVTVLAIFNDLKVDVDLYALLLGESVLNDAVAIVLSSSIVAYQPSGSSSHSFEGEAILVSLGVFLGVLSGSLVLGTATGFITALVTKLTRLRNFPLLETTLFFLMSWSTFLLAEACNITGVVAVLFCGITQAHYTRSNLSAESKKRTEELSELLNFLAESFIFSYMGLTLFSYQNHVFNPAFISGSFLAILLGRAANIYPLSFLLNLGRSNRISNNFQHVMMFAGLRGAMAFALSIRDTSTYARQMMFSTTLLIVFFTVWVFGGGTTPVLSKMNIRVGVEEDEEECITE-----------LDDMVSGICSAAWPIRLWYKFDHNYLKPLLTHSGPPLSGSLPACCAPVARCLASSQE 596          
BLAST of slc9a-2 vs. Ensembl Cavefish
Match: slc9a6b (solute carrier family 9 member 6b [Source:ZFIN;Acc:ZDB-GENE-080226-2])

HSP 1 Score: 466.463 bits (1199), Expect = 1.502e-154
Identity = 264/587 (44.97%), Postives = 385/587 (65.59%), Query Frame = 3
Query:   45 MVSKCEALNEKILEQSREEKVQQNHKTDXXXXXXXXXXXXXXXXXXXXFKHKRLRFVHETSCSLIYGLILGVIFYNLPIDVNKVTTTLQMPQSKTNCAYQLPPDNIILEMNLLNRTSPYTFKYRHVLNDHESDAKD--LSRKATFDAEIFFNLLLPPIIFCAGYNMKKKHFFENLGAIASFAFLGTILSSLTIGGLCYGLSRTITSISDSIG---FGECLLFGSFISATDPVTVLAIFNDINIEVDLYAFVFGESVLNDAVAIVLVNSVEQYGKIANNGE-FNPFAILIAAKSFMTVFLGALSIGCVVGICTALVTKYTYLRDHPLLETSLFFLMSYCSFLIAEVAGASGIVASLFCGITQAHYTYNNLSEESQKWTKGIFELMSFLSENFVFVYIGVSNFTFRDHNWQPRFICIAIFAIIVGRAVNVYILSAMLNLGRKNKIKFNHQHMLMFAGVRGAMAFALAIRNTSSKVRQMFFSTTLVIVMVTVFICGGLTLPMINFLKIRIGKDNEITDSIPEPADDTTISDEQVLDLNERHKKKAFLIRMFAKLDCQFIKPLLTHSPPLLIDTCPLCCFTFAKFLTTSEQ 1787
            ++S CE     +++   E + +++H+ +S I L F +LL  +++T W+FKH RLR +HET  ++IYGL++GVI   L   V+     +  P +   C +   P +++L  N+  R   YT          E DA +  + +K TFD E+FFN+LLPPIIF AGY++K+++FF NLG+I S+AF+GT++SS  IG + YG    ++++    G   F +CL FG+ ISATDPVTVLAIFND+ ++VDLYA + GESVLNDAVAIVL +S+  Y    ++   F   AIL++   F+ V  G+L +G   G  TALVTK T LR+ PLLET+LFFLMS+ +FL+AE    +G+VA LFCGITQAHYT +NLS ES+K T+ + EL++FL+E+F+F Y+G++ F++++H + P FI  +  AI++GRA N+Y LS +LNLGR N+I  N QH++MFAG+RGAMAFAL+IR+TS+  RQM FSTTL+IV  TV++ GG T P+++ + IR    +            T I   ++ D+       A+ IR++ K D  ++KPLLTHS P L  + P CC   A+ L +S++
Sbjct:   30 VLSVCECEGPGLVDAVSERRAEESHRQNSAIALLFTLLLTATILTTWLFKHHRLRLLHETGLAMIYGLLMGVI---LRFGVHVQPDLIDAPLT---CVFNSSPRSLLL--NISGRLFEYTLSGEASDTPRE-DAPNSQILKKVTFDPEVFFNILLPPIIFHAGYSLKRRYFFRNLGSILSYAFVGTVISSFVIGLVMYGFVACMSAVGQLGGDFFFTDCLFFGAIISATDPVTVLAIFNDLKVDVDLYALLLGESVLNDAVAIVLSSSIVAYQPSGSSSHSFEGEAILVSLGVFLGVLSGSLVLGTATGFITALVTKLTRLRNFPLLETTLFFLMSWSTFLLAEACNITGVVAVLFCGITQAHYTRSNLSAESKKRTEELSELLNFLAESFIFSYMGLTLFSYQNHVFNPAFISGSFLAILLGRAANIYPLSFLLNLGRSNRISNNFQHVMMFAGLRGAMAFALSIRDTSTYARQMMFSTTLLIVFFTVWVFGGGTTPVLSKMNIRYEHTH------------TNIHITELDDMVSGICSAAWPIRLWYKFDHNYLKPLLTHSGPPLSGSLPACCAPVARCLASSQE 595          
BLAST of slc9a-2 vs. Ensembl Sea Lamprey
Match: slc9a3.1 (solute carrier family 9 member A3, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-060503-545])

HSP 1 Score: 144.436 bits (363), Expect = 2.422e-36
Identity = 104/381 (27.30%), Postives = 184/381 (48.29%), Query Frame = 3
Query:  468 TFDAEIFFNLLLPPIIFCAGYNMKKKHFFENLGAIASFAFLGTILSSLTIGGLCYGLSRTITSISDSIGFGECLLFGSFISATDPVTVLAIFN-DINIEVDLYAFVFGESVLNDAVAIVLVNSVEQYGKIANNGEFNPFAILIAAKSFMTVFLGALSIGCVVGICTALVTKYTYLRDHPLLETSLFFLMSYCSFLIAEVAGASGIVASLFCGITQAHYTYNNLSEESQKWTKGIFELMSFLSENFVFVYIGVSNFTFRDHNWQPRFICIAIFAIIVGRAVNVYILSAMLNLGRKNKIKFNHQHMLMFAGVRGAMAFALAIRNTSSKV--RQMFFSTTLVIVMVTVFICGGLTLPMINFLKIRIGKDNE--ITDSIPEPADD 1595
            T     FF  LLPPI+  A Y M  +  F+NLG I  +A +GT+ ++   G   YG       +  S+   +  +F     + + V++LA++  +I I        F  +++ND    VL    + + ++           +    SF+ V LG  ++G V     +LVT+ T  +    +E    FL +Y ++L AE+   S I+A  FCGI    Y   N+S +SQ   K   ++++  +E  +F+++G+S        W   FI + +  + V R + V  L+ +LN  R   +    Q ++ + G+RGA+AFAL        V  +++F S T+++V  TV + G    P++ +LK++  ++ E  +T+ + E A D
Sbjct:   74 TLTPTAFFFYLLPPIVLDASYTMPNRLLFDNLGTILVYAVVGTLWNAAATGLSLYGAHLAGALVIMSVNLVDYGIFNDIFCSIENVSILALYETEIQIMPLSLIHTFNRTIINDLSNKVLYKVFDTFVEVGAEN-IQTVDYMKGFASFLVVSLGGTAVGVVFAFMLSLVTRCT--KHVHAIEPGFVFLFAYLAYLSAEMLSLSAILAITFCGICCKKYVDANISVQSQTTIKFTMKMLASGAETIIFMFLGISAVDTHKWTWNTAFILLTLIFVSVYRVIGVVALTWLLNRFRMVPLGPIEQAVMSYGGLRGAVAFALVALLDEGHVPEKRLFVSATIIVVFFTVIVQGLTIKPLVKWLKVKRSEEREPTLTEELHERAFD 451          
BLAST of slc9a-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000903.1 (pep scaffold:Pmarinus_7.0:GL477267:34875:46041:-1 gene:ENSPMAG00000000825.1 transcript:ENSPMAT00000000903.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 133.265 bits (334), Expect = 7.380e-36
Identity = 82/205 (40.00%), Postives = 121/205 (59.02%), Query Frame = 3
Query:  477 AEIFFNLLLPPIIFCAGYNMKKKHFFENLGAIASFAFLGTILSSLTIGGLCYGLSRTITSIS-DSIGFGECLLFGSFISATDPVTVLAIFNDINIEVDLYAFVFGESVLNDAVAIVLVNSVEQYGKIANNGEFNPFAILIAAKSFMTVFLGALSIGCVVGICTALVTKYTYLRDHPLLETSLF-FLMSYCSFLIAEVAGASGIVA 1085
            A++FF  LLPPI+  AGY M  + F +NLG I  +A LGT+ +   +G   + +   + S+   S+G    LLF S ISA DPV VLA+F +I++   L+  VFGES+LNDAV +VL N    +  +      +   +L+ A  F+ V LG + IG ++G+  AL T+++   DH  +   LF FL SY ++LIAE+   SGI+A
Sbjct:    3 AQVFFLYLLPPIVLDAGYFMPVRPFLDNLGTILWYAVLGTLWNVFGVGLTLHAVCALVPSLGLASLGLVHLLLFASLISAVDPVAVLAVFEEIHVNEQLHILVFGESLLNDAVTVVLYNLFRAFSTMKVVTSVD---VLLGATKFLVVGLGGVLIGALLGMVAALTTRFS---DHTRVIEPLFVFLYSYLAYLIAEMFQLSGIMA 201          
BLAST of slc9a-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001296.1 (pep scaffold:Pmarinus_7.0:GL497132:72:2488:-1 gene:ENSPMAG00000001170.1 transcript:ENSPMAT00000001296.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 46.2098 bits (108), Expect = 2.115e-6
Identity = 22/55 (40.00%), Postives = 34/55 (61.82%), Query Frame = 3
Query:  480 EIFFNLLLPPIIFCAGYNMKKKHFFENLGAIASFAFLGTILSSLTIGGLCYGLSR 644
            ++FF  LLPPI+  AGY M  + FFEN+G I  +A +GT+ ++  I    Y + +
Sbjct:   70 DVFFFYLLPPIVLDAGYFMPIRPFFENVGTILWYALVGTLWNAFGIAFSLYAICQ 124          
BLAST of slc9a-2 vs. Ensembl Yeast
Match: NHX1 (Na+/H+ and K+/H+ exchanger; required for intracellular sequestration of Na+ and K+; located in the vacuole and late endosome compartments; required for osmotolerance to acute hypertonic shock and for vacuolar fusion; ortholog of human NHE9, which is linked to autism [Source:SGD;Acc:S000002864])

HSP 1 Score: 227.639 bits (579), Expect = 2.576e-65
Identity = 159/476 (33.40%), Postives = 248/476 (52.10%), Query Frame = 3
Query:  195 HKRLRFVHETSCSLIYGLILGVIFYNLPIDVNKVTTTLQMPQSKTNCAYQLPPDNIILEMNLLNRTSPYTFKYRHVLNDHESDAKDLSRKATFDAEIFFNLLLPPIIFCAGYNMKKKHFFENLGAIASFAFLGTILSSLTIGGLCY-----GLSRTITSISDSIGFGECLLFGSFISATDPVTVLAIFNDINIEVDLYAFVFGESVLNDAVAIVLVNSVEQYGKIANNGEFNPFA-ILIAAKSFMTVFLGALSIGCVVGICTALVTKYTYLRDHPLLETSLFFLMSYCSFLIAEVAGASGIVASLFCGITQAHYTYNNLSEESQKWTKGIFELMSFLSENFVFVYIGVSNFTFRDHNWQPRFICIAIFAIIVGRAVNVYILSAML------------------NLGRKNKIKFNHQHMLMFAGVRGAMAFALAIRNTSSKVRQMFFSTTLVIVMVTVFICGGLTLPMINFLKIRIG 1550
             KR+R VHET  S+ YG+++G+I                                         R SP      H + D            TF++  FFN+LLPPII  +GY + + +FF N+ +I  FA  GT +S++ IG + Y     GL       S  I F + +  G+ +SATDPVT+L+IFN   ++  LY  +FGES+LNDA++IV+  + +++     +G+   F+ +   A  F+  F  +L IG ++GI  AL+ K+T++R +P +E+ L  L++Y S+  +     SGIV+ LFCGIT  HY Y N+S  SQ   K IF+L++ LSENF+F+Y+G+  FT  +  ++P  I +A  +I V R   V+ LS  +                  N+   ++I +N+Q M  +AG+RGA+  ALA+     + +    +T LV+V++TV I GG T  M+  L I+ G
Sbjct:   83 QKRIRAVHETVLSIFYGMVIGLII----------------------------------------RMSP-----GHYIQD----------TVTFNSSYFFNVLLPPIILNSGYELNQVNFFNNMLSILIFAIPGTFISAVVIGIILYIWTFLGLE------SIDISFADAMSVGATLSATDPVTILSIFNAYKVDPKLYTIIFGESLLNDAISIVMFETCQKF-----HGQPATFSSVFEGAGLFLMTFSVSLLIGVLIGILVALLLKHTHIRRYPQIESCLILLIAYESYFFSNGCHMSGIVSLLFCGITLKHYAYYNMSRRSQITIKYIFQLLARLSENFIFIYLGLELFTEVELVYKPLLIIVAAISICVARWCAVFPLSQFVNWIYRVKTIRSMSGITGENISVPDEIPYNYQMMTFWAGLRGAVGVALAL-GIQGEYKFTLLATVLVVVVLTVIIFGGTTAGMLEVLNIKTG 491          
BLAST of slc9a-2 vs. Ensembl Nematostella
Match: EDO40671 (Sodium/hydrogen exchanger [Source:UniProtKB/TrEMBL;Acc:A7S6K9])

HSP 1 Score: 451.825 bits (1161), Expect = 8.646e-151
Identity = 250/529 (47.26%), Postives = 339/529 (64.08%), Query Frame = 3
Query:  189 FKHKRLRFVHETSCSLIYGLILG-VIFYNLPIDVNKVTTTLQMPQSKTNCAYQLPPDNIILEMNLLNRTSPYTFKYRHVLNDHESDAKDLSRKATFDAEIFFNLLLPPIIFCAGYNMKKKHFFENLGAIASFAFLGTILSSLTIGGLCYGLSRTITSISDSIGFGECLLFGSFISATDPVTVLAIFNDINIEVDLYAFVFGESVLNDAVAIVLVNSVEQYGKIANNGEFNPFAILIAAKSFMTVFLGALSIGCVVGICTALVTKYTYLRDHPLLETSLFFLMSYCSFLIAEVAGASGIVASLFCGITQAHYTYNNLSEESQKWTKGIFELMSFLSENFVFVYIGVSNFTFRDHNWQPRFICIAIFAIIVGRAVNVYILSAMLNLGRKNKIKFNHQHMLMFAGVRGAMAFALAIRNTSSKVRQMFFSTTLVIVMVTVFICGGLTLPMINFLKIRIGKDNEITDSIPEPADDTTISDEQVLDLNERHKKKAFLIRMFAKLDCQFIKPLLTHSPPLLIDTCPLCCFTFAKFL 1772
            FK KR RF+HET   +IYG+I G VI Y   I  +  T    MP +K            I+ M + N T  Y++K    +   E    +L  KA FD EIFF +LLPPIIF AGY+MKK+ FF N+GAI ++AF GT +S +  G + Y  ++  T   D   F ECLLFG+ ISATDPVT+LAIF+D++++VDLYA VFGESV+NDAVAIVL  S+E Y     +G F       +   F+ VF G+  +G ++G+ TAL+TK T + D PLLET+LFFL+S+ +FL+AE AG +GIVA LFCGI+QAHYTYNNLS+ES+  TK IF L++FL+ENF+F Y+G+S FTF  H W+P FI      I +GR +N+Y LS +LNLGR  KI +N QHM+ F+G+RGA+AFALA+RNT S  RQM  +T L+IV++TV I GG TL ++++LKIR+G + E  +  P+     T+  +          ++A++ R++   +   I PL T   P L D  P CC   A+ L
Sbjct:   36 FKVKRFRFLHETGVCMIYGMITGLVIKYAGGIKKSHYTVNCTMPGAKD-----------IIWMQVQNGTR-YSYKLSGPVLPTEGGG-ELEEKAVFDPEIFFFVLLPPIIFFAGYDMKKRFFFRNIGAILAYAFAGTTISCMVFGVIVYAYTKFATVYKD-FDFLECLLFGALISATDPVTILAIFHDLHVDVDLYALVFGESVMNDAVAIVLFRSIESYLLDNASGVFQVDKFFSSVGVFIGVFSGSFFLGFLMGLVTALITKLTKISDFPLLETALFFLLSWSTFLMAEAAGLTGIVAVLFCGISQAHYTYNNLSDESKHNTKQIFALLNFLAENFIFSYMGLSVFTFEYHQWKPGFIAWCFIGIAIGRFLNIYPLSFLLNLGRNRKIPYNLQHMMFFSGLRGAVAFALAMRNTESVPRQMMLTTVLMIVLITVVINGGSTLSVLSYLKIRVGVNPE-EEEQPKFLPVCTVRSQTA------QFERAWIFRLWYNFEVSSIGPLFTGVGPPLKDVLPGCCQPLARIL 543          
BLAST of slc9a-2 vs. Ensembl Nematostella
Match: EDO43052 (Sodium/hydrogen exchanger [Source:UniProtKB/TrEMBL;Acc:A7RZU4])

HSP 1 Score: 433.721 bits (1114), Expect = 6.180e-144
Identity = 247/551 (44.83%), Postives = 359/551 (65.15%), Query Frame = 3
Query:   93 REEKVQQNHKTDXXXXXXXXXXXXXXXXXXXXFKHKRLRFVHETSCSLIYGLILGVIFYNLPIDVNKVTTTLQMPQSK--TNCAYQLPPDNIILEMNLLNRTSPYTFKYRHVLNDHESDAKD----LSRKATFDAEIFFNLLLPPIIFCAGYNMKKKHFFENLGAIASFAFLGTILSSLTIGGLCYGLSRTITSISDSIGFGECLLFGSFISATDPVTVLAIFNDINIEVDLYAFVFGESVLNDAVAIVLVNSVEQYGKIANNG----EFNPFAILIAAKSFMTVFLGALSIGCVVGICTALVTKYTYLRDHPLLETSLFFLMSYCSFLIAEVAGASGIVASLFCGITQAHYTYNNLSEESQKWTKGIFELMSFLSENFVFVYIGVSNFTFRDHNWQPRFICIAIFAIIVGRAVNVYILSAMLNLGRKNKIKFNHQHMLMFAGVRGAMAFALAIRNTSSKVRQMFFSTTLVIVMVTVFICGGLTLPMINFLKIRIGKDNEITDSIPEPADDTTISDEQVLDLNERHKK----KAFLIRMFAKLDCQFIKPL 1703
            RE++++ +H TDSL ++  + LLIV ++ IW+FK +RL+F+HET  ++I G+++G +     +  +K   ++++      TN      P ++ + +N     + YT+    +    ++ A D    +  +ATF+ EIFF +LLPPIIF AGY+M+K++FF NLGAI ++AF GT +S    G L YG +   T ++    + ECLLFG+ ISATDPVTVLAIF+DI+++VD+YA VFGESVLNDAVAIVL  ++E Y  +A N     EF+  +   A   F+ +F G+  IGC +    ALVTK T L   P+LET+L FLMSYC+FL+AE+A  SGIVA LFCGITQ HYTY NL++ES+  T    EL++F++ENF+F YIG+S F F  H W P FI  +  AI VGR +N+Y L+  LNLGR   I  N QHM+ F+G+RGA+AFALA+RNT S  RQM  +TTL+IV+V+V + GG+TLP++ FL IR G D +  ++         I+D       +R +K    KA+L+R ++++D +++ P+
Sbjct:    3 REDEMEHSHNTDSLSIMILIGLLIVDILVIWLFKIRRLKFIHETGVAMIIGVVVGALIKYSEVGHHKQPLSVKIKNCNNLTNA-----PQSVWVNIN----GTEYTYNLMGIRFPAQTQAPDETNEIESRATFNPEIFFYVLLPPIIFYAGYSMQKRYFFRNLGAILTYAFFGTTISCFATGSLIYGFN-VWTGVTKDFDYPECLLFGALISATDPVTVLAIFHDIHVDVDMYALVFGESVLNDAVAIVLYRAIESY--LAYNPREMREFDLMSCAQALSDFVAIFTGSFVIGCSMSCINALVTKLTKLGSFPILETALLFLMSYCTFLMAEIANWSGIVAVLFCGITQQHYTYKNLTDESRARTLQTLELLNFMAENFIFTYIGLSVFAFTSHQWNPGFIGWSFLAIFVGRFLNIYPLTFFLNLGRTRTIPANFQHMMFFSGLRGAIAFALAVRNTVSIPRQMMLTTTLIIVIVSVIVFGGITLPVLQFLNIRSGVDEQEEETRARRLSLIDINDPTASTPQDRLEKKIYEKAWLVRAWSRVDSKYLTPM 541          
BLAST of slc9a-2 vs. Ensembl Nematostella
Match: EDO34103 (Sodium/hydrogen exchanger [Source:UniProtKB/TrEMBL;Acc:A7SQC1])

HSP 1 Score: 217.238 bits (552), Expect = 1.872e-62
Identity = 134/371 (36.12%), Postives = 215/371 (57.95%), Query Frame = 3
Query:  471 FDAEIFFNLLLPPIIFCAGYNMKKKHFFENLGAIASFAFLGTILSSLTIGGLCYGL-SRTITSISDSIG--FGECLLFGSFISATDPVTVLAIFNDINIEVDLYAFVFGESVLNDAVAIVLVNSVEQYGKIANNGEFNPFAILIAAKSFMTVFLGALSIGCVVGICTALVTKYTYLRDH-PLLETSLFFLMSYCSFLIAEVAGASGIVASLFCGITQAHYTYNNLSEESQKWTKGIFELMSFLSENFVFVYIGVSNFTFRDHNWQPRFICIAIFAIIVGRAVNVYILSAMLN-LGRKNKIKFNHQHMLMFAGVRGAMAFALAIRNTSSKV--RQMFFSTTLVIVMVTVFICGGLTLPMINFLKIRIGKDNE 1562
            F ++IFF  +LPPI+  AGY ++ + FF+N+G I  FA +GT+ ++ T+GGL +     T+  +S  IG      L+FG  ISA DPV VLA+F ++N+ V LY  VFGES+LNDAV +VL +  E   K++   E     IL+   +F+ V LG   +G + G  TA VTKYT   DH  ++E    F+MSY ++L AE+   SGI++ + C I    Y   N+S +S    K   +++S  SE  +F+++G++  T+ DH W    + + +  I V RA+ V  L+ + N  GR NK+    Q ++ + G+RGA++F+LAI         + M  +TT+V+V+ T+F+ G    P++  L +++ +  +
Sbjct:   83 FSSDIFFLFMLPPIVLEAGYFLQDRAFFDNIGTILLFAVVGTLFNAFTVGGLLFHFPGFTLYGVSHIIGIPLMHYLVFGVLISAVDPVAVLAVFEEVNVNVMLYIIVFGESLLNDAVTVVLYHLFE---KLSEMDEVTHKEILLGFANFLVVSLGGTLMGVLWGFFTAFVTKYT---DHVRVIEPIFVFIMSYMAYLCAEMFHLSGILSIVTCAIVMKPYVEMNISRKSHTTIKYFMKMLSSCSETLIFLFLGIALVTY-DHVWSTELVFLTLLFISVYRAIGVVFLTYLANRFGRLNKLSGVDQFIMCYGGIRGAVSFSLAILLNPKHFPDKGMLVTTTIVVVIFTIFVQGTTIKPIVKALNVKLQEHKK 446          
BLAST of slc9a-2 vs. Ensembl Nematostella
Match: EDO49297 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RH57])

HSP 1 Score: 59.3066 bits (142), Expect = 4.813e-9
Identity = 58/227 (25.55%), Postives = 108/227 (47.58%), Query Frame = 3
Query:  768 LYAFVFGESVLNDAVAIVLVNSVEQYGKIANNGEFNPFAILIAAKSFMTVFLGALSIGCVVGICTALVTKYTYLRDHPLLETSLFFLMSYCSFLIA-EVAGASGIVASLFCGITQAHYTYNNLSEESQKWTKGIFELMSFLSENFVFVYIGVSNFTFRDHNWQP---RFICIAIFAIIVGRAVNVYILSAML-NLGRKNKIKFNHQHMLM--FAGVRGAMAFALAIR 1427
            L   + GES+LND +AIV+        KI  N  F+          F  V +G    G   G  T    +  +  +  ++E ++  + +Y +F I  EV G SG++A +  GI + +    ++S E + +    +E++++L+   +F+  GV       H+++P     + +    I V RA+ +  LS +L ++G      F  Q  ++  + G+RGA+  ALA++
Sbjct:   11 LATIIEGESLLNDGMAIVMY-------KIFYNLSFSSLTPTEIGLYFPRVAVGGYFFGLAAGKITVFWLQRVF--NDAMVEITITLVSTYLTFYIGEEVLGISGVIAVVILGI-EVNAQKTSISPEVEVFLHRFWEMLAYLANTLIFIMAGVVIVEQTLHSFEPFDAFLLVVDYLGITVIRALVISSLSPILMHIG----YGFTWQTAVVVCWGGLRGAVGLALALQ 223          
BLAST of slc9a-2 vs. Ensembl Medaka
Match: slc9a6b (sodium/hydrogen exchanger 6 [Source:NCBI gene;Acc:101156110])

HSP 1 Score: 511.146 bits (1315), Expect = 2.249e-171
Identity = 289/665 (43.46%), Postives = 422/665 (63.46%), Query Frame = 3
Query:   96 EEKVQQNHKTDXXXXXXXXXXXXXXXXXXXXFKHKRLRFVHETSCSLIYGLILGVIF---YNLPIDVNKVTTTLQMPQSKTNCAYQLPPDNIILEMNLLNRTSPYTFKYR-HVLNDHESDAKDLSRKATFDAEIFFNLLLPPIIFCAGYNMKKKHFFENLGAIASFAFLGTILSSLTIGGLCYGL---SRTITSISDSIGFGECLLFGSFISATDPVTVLAIFNDINIEVDLYAFVFGESVLNDAVAIVLVNSVEQYGKIANNGE-FNPFAILIAAKSFMTVFLGALSIGCVVGICTALVTKYTYLRDHPLLETSLFFLMSYCSFLIAEVAGASGIVASLFCGITQAHYTYNNLSEESQKWTKGIFELMSFLSENFVFVYIGVSNFTFRDHNWQPRFICIAIFAIIVGRAVNVYILSAMLNLGRKNKIKFNHQHMLMFAGVRGAMAFALAIRNTSSKVRQMFFSTTLVIVMVTVFICGGLTLPMINFLKIRIGKDNEITDSIPEPADDTTISDEQVLDLNERHKKKAFLIRMFAKLDCQFIKPLLTHSPPLLIDTCPLCCFTFAKFLTTSEQISRNSHLRISKNNISMDMTGDNMAYKSDRDLTSFNPGLPXXXXXXXXXXXXXHFKKHLSDQEFILTDTDDNAGYIEGEESGLYIQEYSAIPNT 2066
            E   +++H+ DS  LL F++LL ++++TIW+FKH+R RF+HET  ++IYGL++GVI     ++P  ++ VT +         CA    P  +++  N+  R   YT K        H+    ++ RK TFD E+FFN+LLPPIIF AGY++K++HFF N+G+I ++AF+GT++S   IG + YG     + +  +     F +CL FG+ +SATDPVTVLAIFND+ ++VDLYA +FGESVLNDAVAIVL +S+  Y    +N   F   A+L +   F+ VF G+ ++G   G+ TA VTK+T LRD PLLET+LFFLMS+ +FL+AE  G +G+VA LFCGITQAHYTYNNLS ESQ+ TK +FEL++FL+ENF+F Y+G++ F+F+ H + P FI  A  A+ VGRA N+Y LS +LNLGR+NKI  N QH++MFAG+RGAM FAL+IR+T++  RQM FSTTL+IV  TV+ICGG T PM++F+ IR+G D++   +       ++ +++  L    +H + A+  R++   D  ++KPLLTHS P L  T P CC   A+ LT+ +       L    ++  M+    +  Y +D  +++   G       +        F + + DQE  LTD D     I G    L +++ +  P+T
Sbjct:   45 ERMAEESHRQDSANLLIFILLLTLTILTIWLFKHRRFRFLHETGLAMIYGLLVGVILRYGVHVPESISNVTLS---------CAVNASPATLLV--NVSGRFYEYTLKGEIRQGRGHQMQDDEMLRKVTFDPEVFFNILLPPIIFHAGYSLKRRHFFRNIGSILAYAFIGTVISCFVIGLIMYGFVSFMKVVGQLGGDFYFTDCLFFGAIVSATDPVTVLAIFNDLKVDVDLYALLFGESVLNDAVAIVLSSSIVAYQPAGDNSHSFEAMAMLKSFGVFLGVFSGSFALGVSTGVMTAFVTKFTKLRDFPLLETALFFLMSWSTFLLAEACGFTGVVAVLFCGITQAHYTYNNLSPESQERTKQLFELLNFLAENFIFSYMGLTLFSFQSHVFNPLFIIGAFVAVFVGRAANIYPLSLLLNLGRRNKIGLNFQHVMMFAGLRGAMTFALSIRDTATYARQMMFSTTLLIVFFTVWICGGGTTPMLSFMSIRVGVDSDQEHT-------SSAAEDGSLRRCTKH-ESAWPFRIWYNFDHNYLKPLLTHSGPPLTATLPACCGPLARCLTSPQAYENEGQLHDDDSDFIMNDASVSSMY-ADVTVSTDASGSHTVNHKHSFSSGGGRFNEGM-DQELALTDQDVT---IRGTRLVLPVEDSAEPPST 685          
BLAST of slc9a-2 vs. Ensembl Medaka
Match: slc9a6a (solute carrier family 9 member A6 [Source:NCBI gene;Acc:101165319])

HSP 1 Score: 505.368 bits (1300), Expect = 2.419e-169
Identity = 280/601 (46.59%), Postives = 404/601 (67.22%), Query Frame = 3
Query:   96 EEKVQQNHKTDXXXXXXXXXXXXXXXXXXXXFKHKRLRFVHETSCSLIYGLILGVIFY---NLPIDVNKVTTTLQMPQSKTNCAYQLPPDNIILEMNLLNRTSPYTFKYRHVLNDHESDAKD--LSRKATFDAEIFFNLLLPPIIFCAGYNMKKKHFFENLGAIASFAFLGTILSSLTIGGLCYG---LSRTITSISDSIGFGECLLFGSFISATDPVTVLAIFNDINIEVDLYAFVFGESVLNDAVAIVLVNSVEQYGKIANNGE-FNPFAILIAAKSFMTVFLGALSIGCVVGICTALVTKYTYLRDHPLLETSLFFLMSYCSFLIAEVAGASGIVASLFCGITQAHYTYNNLSEESQKWTKGIFELMSFLSENFVFVYIGVSNFTFRDHNWQPRFICIAIFAIIVGRAVNVYILSAMLNLGRKNKIKFNHQHMLMFAGVRGAMAFALAIRNTSSKVRQMFFSTTLVIVMVTVFICGGLTLPMINFLKIRIGKDNEITDSIPEPADDTTISDEQVLDLNERHKKK---AFLIRMFAKLDCQFIKPLLTHSPPLLIDTCPLCCFTFAKFLTTSEQISRNSHLRISKNNISMDMTGDNMAY 1862
            E+K +++H+ DS+ LL F++LL ++++TIW+FKH+R RF+HET  ++IYGLI+GVI     +LP DV+ V+ +  +  S        PP  +I   N+  +   YT K     N+ + D +D  + RK TFD E+FFN+LLPPIIF AGY++K++HFF N+G+I +FAFLGT++S   IG L YG   L + +  +     F +CL FG+ +SATDPVTVLAIFN+++++ DLYA +FGESVLNDAVA+VL +S+  Y    +N   F   A+L +   F+ VF G+ ++G   G+ TALVTK+T LRD  LLET+LFFLMS+ +FL+AE  G +G+V+ LFCGITQAHYTYNNLS ESQ  TK +FEL++FL+ENF+F Y+G++ FTF++H + P FI  A  A+ +GRA N+Y LS +LNLGR+ KI+ N QHM+MFAG+RGAM FAL+IR+T++  R+M FSTTL++V  TV+ICGG T+ M++  +IR+G D++  +S+               D +ER   K   A+L R++   D  ++KP+LTHS P L  T P CC   A+FLT+ +       L+   +++ +     N+ Y
Sbjct:   50 EKKAEESHRQDSVDLLIFILLLTLTILTIWLFKHRRFRFLHETGLAMIYGLIVGVILRYAIHLPRDVSNVSKSCYVNAS--------PPTLLI---NVSGKFYEYTLKGEISANEVK-DVQDNEMLRKVTFDPEVFFNILLPPIIFHAGYSLKRRHFFRNMGSILAFAFLGTVISCFFIGLLMYGCVTLMKQVGQLHGDFFFTDCLFFGAIVSATDPVTVLAIFNELHVDADLYALLFGESVLNDAVAVVLSSSIVAYQPQGDNSHTFEATALLKSFGMFLGVFSGSFALGVATGVFTALVTKFTKLRDFQLLETALFFLMSWSTFLLAEACGFTGVVSVLFCGITQAHYTYNNLSAESQDRTKQLFELLNFLAENFIFSYMGLTLFTFQNHVFNPMFIVGAFLAVFLGRAANIYPLSLLLNLGRRYKIRSNFQHMMMFAGLRGAMTFALSIRDTATYARRMMFSTTLLVVFFTVWICGGGTMQMLSCQRIRVGVDSDQDNSM------------SFTDGSERRSTKQESAWLFRIWYNFDHNYLKPILTHSGPPLTATLPPCCGPLARFLTSPQAYENEGQLKDDDSDLILTDGDINLTY 626          
BLAST of slc9a-2 vs. Ensembl Medaka
Match: slc9a7 (solute carrier family 9 member A7 [Source:NCBI gene;Acc:101167864])

HSP 1 Score: 495.738 bits (1275), Expect = 1.338e-165
Identity = 283/625 (45.28%), Postives = 408/625 (65.28%), Query Frame = 3
Query:   42 IMVSKCEALNEKILE-QSREEKVQQNHKTDXXXXXXXXXXXXXXXXXXXXFKHKRLRFVHETSCSLIYGLILGVIF-YNLPIDVNKVTTTLQMPQSKTNCAYQLPPDNIILEMNLLNRTSPYTFKYR-HVLNDHESDAKDLSRKATFDAEIFFNLLLPPIIFCAGYNMKKKHFFENLGAIASFAFLGTILSSLTIGGLCYG---LSRTITSISDSIGFGECLLFGSFISATDPVTVLAIFNDINIEVDLYAFVFGESVLNDAVAIVLVNSVEQYG-KIANNGEFNPFAILIAAKSFMTVFLGALSIGCVVGICTALVTKYTYLRDHPLLETSLFFLMSYCSFLIAEVAGASGIVASLFCGITQAHYTYNNLSEESQKWTKGIFELMSFLSENFVFVYIGVSNFTFRDHNWQPRFICIAIFAIIVGRAVNVYILSAMLNLGRKNKIKFNHQHMLMFAGVRGAMAFALAIRNTSSKVRQMFFSTTLVIVMVTVFICGGLTLPMINFLKIRIGKDNEITDSIPEPADDT----TISDEQVLDLNERHKKKAFLIRMFAKLDCQFIKPLLTHSPPLLIDTCPLCCFTFAKFLTTSEQISRNSHLRISKNNISMDMTGDNMAYKSDRDLT 1883
            I++S    L  ++ E    E++ +++H+ DS+ LL+F++LL ++++TIW+FKH+R+RF+HET  ++IYGL++GVI  Y +P        T    ++  +C+ +  P + +L +N+  +   YT K   +    H  +  D+ RK TFD E+FFN+LLPPIIF AGY++KK++FF NLG+I ++AFLGT +S   IG + YG   L + +  ++D   + +CL FG+ ISATDPVTVLAIFND++ + DLYA +FGESV+NDAVAIVL +S+  Y    AN   F+  A   +   F+ +F G+  +G   G+ TALVTK+T L   PLLET+LFFLMS+ +FL+AE  G +G+VA LFCGITQAHYTYNNLS ES K TK +FE++ FL+ENF+F Y+G++ FTF++H + P FI  A  AI +GRA+N+Y LS  LNLGR+ KI+ N QHM+MFAG+RGAMAFALAIR+T++  RQM F+TTL+IV  TV++ GG T PM+++L IR+G D    D   +P+ D+         Q    ++  ++ A+L R +   D  ++KP+LTHS P L  T P  C   A  LTT +    +  LR   +++            SD DLT
Sbjct:   23 ILLSAAPGLRAEMEEIDGTEKEAEESHRQDSVSLLTFILLLTLTILTIWLFKHRRVRFLHETGLAMIYGLLVGVILRYGIP-------ATSYHNKTPPSCSLKEGPASTLL-LNVSGKFFEYTLKGEINSREIHNVEQNDMLRKVTFDPELFFNILLPPIIFHAGYSLKKRNFFRNLGSIITYAFLGTAISCFVIGNMMYGVVTLMKAVGQLTDKFYYTDCLFFGAIISATDPVTVLAIFNDLHADGDLYALLFGESVMNDAVAIVLSSSIVAYQPSSANTHIFDAAAFFKSVGVFLGIFSGSFVMGATTGVVTALVTKFTKLHCFPLLETALFFLMSWSTFLLAEACGFTGVVAVLFCGITQAHYTYNNLSAESTKRTKQLFEVLHFLAENFIFSYMGLTLFTFQNHIFSPIFIIGAFVAIFIGRALNIYPLSFFLNLGRRVKIRGNFQHMMMFAGLRGAMAFALAIRDTATYARQMMFTTTLLIVFFTVWVFGGGTTPMLSWLHIRVGVD---PDQDLQPSADSFQVLQGEGSQGDGQSKTKQESAWLFRFWYNFDHNYLKPILTHSGPPLTSTLPGYCGPLASCLTTPQAYENHDELRDPDSDL----------IHSDADLT 626          
BLAST of slc9a-2 vs. Ensembl Medaka
Match: slc9a6b (sodium/hydrogen exchanger 6 [Source:NCBI gene;Acc:101156110])

HSP 1 Score: 491.115 bits (1263), Expect = 1.446e-164
Identity = 268/573 (46.77%), Postives = 384/573 (67.02%), Query Frame = 3
Query:   96 EEKVQQNHKTDXXXXXXXXXXXXXXXXXXXXFKHKRLRFVHETSCSLIYGLILGVIF---YNLPIDVNKVTTTLQMPQSKTNCAYQLPPDNIILEMNLLNRTSPYTFKYR-HVLNDHESDAKDLSRKATFDAEIFFNLLLPPIIFCAGYNMKKKHFFENLGAIASFAFLGTILSSLTIGGLCYGL---SRTITSISDSIGFGECLLFGSFISATDPVTVLAIFNDINIEVDLYAFVFGESVLNDAVAIVLVNSVEQYGKIANNGE-FNPFAILIAAKSFMTVFLGALSIGCVVGICTALVTK--YTYLRDHPLLETSLFFLMSYCSFLIAEVAGASGIVASLFCGITQAHYTYNNLSEESQKWTKGIFELMSFLSENFVFVYIGVSNFTFRDHNWQPRFICIAIFAIIVGRAVNVYILSAMLNLGRKNKIKFNHQHMLMFAGVRGAMAFALAIRNTSSKVRQMFFSTTLVIVMVTVFICGGLTLPMINFLKIRIGKDNEITDSIPEPADDTTISDEQVLDLNERHKKKAFLIRMFAKLDCQFIKPLLTHSPPLLIDTCPLCCFTFAKFLTTSE 1784
            E   +++H+ DS  LL F++LL ++++TIW+FKH+R RF+HET  ++IYGL++GVI     ++P  ++ VT +         CA    P  +++  N+  R   YT K        H+    ++ RK TFD E+FFN+LLPPIIF AGY++K++HFF N+G+I ++AF+GT++S   IG + YG     + +  +     F +CL FG+ +SATDPVTVLAIFND+ ++VDLYA +FGESVLNDAVAIVL +S+  Y    +N   F   A+L +   F+ VF G+ ++G   G+ TA ++   +T LRD PLLET+LFFLMS+ +FL+AE  G +G+VA LFCGITQAHYTYNNLS ESQ+ TK +FEL++FL+ENF+F Y+G++ F+F+ H + P FI  A  A+ VGRA N+Y LS +LNLGR+NKI  N QH++MFAG+RGAM FAL+IR+T++  RQM FSTTL+IV  TV+ICGG T PM++F+ IRI         +  P   ++ +++  L    +H + A+  R++   D  ++KPLLTHS P L  T P CC   A+ LT+ +
Sbjct:   45 ERMAEESHRQDSANLLIFILLLTLTILTIWLFKHRRFRFLHETGLAMIYGLLVGVILRYGVHVPESISNVTLS---------CAVNASPATLLV--NVSGRFYEYTLKGEIRQGRGHQMQDDEMLRKVTFDPEVFFNILLPPIIFHAGYSLKRRHFFRNIGSILAYAFIGTVISCFVIGLIMYGFVSFMKVVGQLGGDFYFTDCLFFGAIVSATDPVTVLAIFNDLKVDVDLYALLFGESVLNDAVAIVLSSSIVAYQPAGDNSHSFEAMAMLKSFGVFLGVFSGSFALGVSTGVMTAFISFHFFTKLRDFPLLETALFFLMSWSTFLLAEACGFTGVVAVLFCGITQAHYTYNNLSPESQERTKQLFELLNFLAENFIFSYMGLTLFSFQSHVFNPLFIIGAFVAVFVGRAANIYPLSLLLNLGRRNKIGLNFQHVMMFAGLRGAMTFALSIRDTATYARQMMFSTTLLIVFFTVWICGGGTTPMLSFMSIRI--------ILTLPVWQSSAAEDGSLRRCTKH-ESAWPFRIWYNFDHNYLKPLLTHSGPPLTATLPACCGPLARCLTSPQ 597          
BLAST of slc9a-2 vs. Ensembl Medaka
Match: SLC9A9 (sodium/hydrogen exchanger 9 [Source:NCBI gene;Acc:101157820])

HSP 1 Score: 340.887 bits (873), Expect = 5.309e-107
Identity = 208/583 (35.68%), Postives = 324/583 (55.57%), Query Frame = 3
Query:  189 FKHKRLRFVHETSCSLIYGLILGVIFYNLPIDVNKVTTTLQMPQSKTNCAYQLPPDNIILEMNLLNRTSPYTFKYRHVLNDHESDAKDLSRKATFDAEIFFNLLLPPIIFCAGYNMKKKHFFENLGAIASFAFLGTILSSLTIGGLCYGLSRTITSISDSIG----FGECLLFGSFISATDPVTVLAIFNDINIEVDLYAFVFGESVLNDAVAIVLVNSVEQYGKIANNGEFNPFAILIAAKSFMTVFLGALSIGCVVGICTALVTKYTYLRDHPLLETSLFFLMSYCSFLIAEVAGASGIVASLFCGITQAHYTYNNLSEESQKWTKGIFELMSFLSENFVFVYIGVSNFTFRDHNWQPRFICIAIFAIIVGRAVNVYILSAMLNLGRKNKIKFNHQHMLMFAGVRGAMAFALAIRNTSSKVRQMFFSTTLVIVMVTVFICGGLTLPMINFLKIRIGKDNEITDSIPEPADDTTISDEQVLDLNERHKKKAFLIRMFAKLDCQFIKPLLTHSPPLLIDTCPLCCFTFAKFLTTS---EQISRNSHLRISKNNISMDM-----TGDNMAYKSDRDLTSFNPGL 1901
             K  + R V+ET  ++ YG++LGV    L  D  +      +      C               LN T P+            S     S+  TF+ ++ FN+ LPPIIF   Y + +K F  NLG++ +FAF GT++S L IG   YG +R +  +  +        +CLLFG+  SATDPV++L + +D+ +++DL+  +FGESVLNDAVAIVL +++  Y +      F+P A L +  SF+ + +G+  +G +  I TAL+TK+T LR+ PLLETS+  L+S+ SFL AE +G SGIVA LFCG++QA YT  NLS E +  TK +FE+ SFL E F++ Y+G    TF  H ++  FI  AI  + + RA N+Y LS +LNLGR NKI  + QH ++FAG+RGA+AF+LA+R+T ++ +Q   +TTL++   T+++ G    P+++ L IR+G+D+E         D    S E  +   +  +       ++  LD +++KP+LTH  P L +  P  C  FA+  + +   E   +   + +  + +++D      T D+   +   DL   + GL
Sbjct:   32 LKQFKYRLVNETGGAMFYGMLLGVAVRYLQFDGAQ-----GIKNHTCTCTD-------------LNATPPFVMVNISSQGHWSSPLDSTSQMGTFNLDVLFNVFLPPIIFYGAYTLDQKRFIANLGSVLTFAFFGTLISCLCIGVCMYGFTRLMVLLGQAADGDYVLIDCLLFGAITSATDPVSILGLLSDLRVDLDLHTLLFGESVLNDAVAIVLTHAIATYDRKGTGHAFDPSAFLHSVGSFLGILIGSFCMGFIFTIITALLTKFTRLRESPLLETSVVLLLSWSSFLSAEASGLSGIVAVLFCGLSQARYTILNLSAEGRSRTKQLFEVFSFLGEIFIYSYMGYILLTFPPHVFKALFISGAILTVFISRACNIYPLSFLLNLGRTNKITCSFQHFMVFAGLRGAVAFSLAVRDTETEAKQTILTTTLLLAGFTIWLLGAAADPLLHALDIRMGEDSE--------EDSKDFSSEVSMRGPDTARG------LWHNLDHKYLKPMLTHCGPPLTELLPQWCGVFARIFSPTHVQEDEEQFCEMELHTSPLNLDKSEPPPTPDDSGSEPHDDLLEGDLGL 582          
BLAST of slc9a-2 vs. Planmine SMEST
Match: SMESG000028983.1 (SMESG000028983.1)

HSP 1 Score: 1294.26 bits (3348), Expect = 0.000e+0
Identity = 676/677 (99.85%), Postives = 677/677 (100.00%), Query Frame = 3
Query:   45 MVSKCEALNEKILEQSREEKVQQNHKTDXXXXXXXXXXXXXXXXXXXXFKHKRLRFVHETSCSLIYGLILGVIFYNLPIDVNKVTTTLQMPQSKTNCAYQLPPDNIILEMNLLNRTSPYTFKYRHVLNDHESDAKDLSRKATFDAEIFFNLLLPPIIFCAGYNMKKKHFFENLGAIASFAFLGTILSSLTIGGLCYGLSRTITSISDSIGFGECLLFGSFISATDPVTVLAIFNDINIEVDLYAFVFGESVLNDAVAIVLVNSVEQYGKIANNGEFNPFAILIAAKSFMTVFLGALSIGCVVGICTALVTKYTYLRDHPLLETSLFFLMSYCSFLIAEVAGASGIVASLFCGITQAHYTYNNLSEESQKWTKGIFELMSFLSENFVFVYIGVSNFTFRDHNWQPRFICIAIFAIIVGRAVNVYILSAMLNLGRKNKIKFNHQHMLMFAGVRGAMAFALAIRNTSSKVRQMFFSTTLVIVMVTVFICGGLTLPMINFLKIRIGKDNEITDSIPEPADDTTISDEQVLDLNERHKKKAFLIRMFAKLDCQFIKPLLTHSPPLLIDTCPLCCFTFAKFLTTSEQISRNSHLRISKNNISMDMTGDNMAYKSDRDLTSFNPGLPXXXXXXXXXXXXXHFKKHLSDQEFILTDTDDNAGYIEGEESGLYIQEYSAIPNTNSV 2075
            MVSKCEALNEKILEQSREEKVQQNHKTDSLILLSFLILLIVSVITIWIFKHKRLRFVHETSCSLIYGLILGVIFYNLPIDVNKVTTTLQMPQSKTNCAYQLPPDNIILEMNLLNRTSPYTFKYRHVLNDHESDAKDLSRKATFDAEIFFNLLLPPIIFCAGYNMKKKHFFENLGAIAS+AFLGTILSSLTIGGLCYGLSRTITSISDSIGFGECLLFGSFISATDPVTVLAIFNDINIEVDLYAFVFGESVLNDAVAIVLVNSVEQYGKIANNGEFNPFAILIAAKSFMTVFLGALSIGCVVGICTALVTKYTYLRDHPLLETSLFFLMSYCSFLIAEVAGASGIVASLFCGITQAHYTYNNLSEESQKWTKGIFELMSFLSENFVFVYIGVSNFTFRDHNWQPRFICIAIFAIIVGRAVNVYILSAMLNLGRKNKIKFNHQHMLMFAGVRGAMAFALAIRNTSSKVRQMFFSTTLVIVMVTVFICGGLTLPMINFLKIRIGKDNEITDSIPEPADDTTISDEQVLDLNERHKKKAFLIRMFAKLDCQFIKPLLTHSPPLLIDTCPLCCFTFAKFLTTSEQISRNSHLRISKNNISMDMTGDNMAYKSDRDLTSFNPGLPINVADNINVDINNHFKKHLSDQEFILTDTDDNAGYIEGEESGLYIQEYSAIPNTNSV
Sbjct:    1 MVSKCEALNEKILEQSREEKVQQNHKTDSLILLSFLILLIVSVITIWIFKHKRLRFVHETSCSLIYGLILGVIFYNLPIDVNKVTTTLQMPQSKTNCAYQLPPDNIILEMNLLNRTSPYTFKYRHVLNDHESDAKDLSRKATFDAEIFFNLLLPPIIFCAGYNMKKKHFFENLGAIASYAFLGTILSSLTIGGLCYGLSRTITSISDSIGFGECLLFGSFISATDPVTVLAIFNDINIEVDLYAFVFGESVLNDAVAIVLVNSVEQYGKIANNGEFNPFAILIAAKSFMTVFLGALSIGCVVGICTALVTKYTYLRDHPLLETSLFFLMSYCSFLIAEVAGASGIVASLFCGITQAHYTYNNLSEESQKWTKGIFELMSFLSENFVFVYIGVSNFTFRDHNWQPRFICIAIFAIIVGRAVNVYILSAMLNLGRKNKIKFNHQHMLMFAGVRGAMAFALAIRNTSSKVRQMFFSTTLVIVMVTVFICGGLTLPMINFLKIRIGKDNEITDSIPEPADDTTISDEQVLDLNERHKKKAFLIRMFAKLDCQFIKPLLTHSPPLLIDTCPLCCFTFAKFLTTSEQISRNSHLRISKNNISMDMTGDNMAYKSDRDLTSFNPGLPINVADNINVDINNHFKKHLSDQEFILTDTDDNAGYIEGEESGLYIQEYSAIPNTNSV 677          
BLAST of slc9a-2 vs. Planmine SMEST
Match: SMESG000035898.1 (SMESG000035898.1)

HSP 1 Score: 256.914 bits (655), Expect = 7.265e-75
Identity = 148/395 (37.47%), Postives = 229/395 (57.97%), Query Frame = 3
Query:  459 RKATFDAEIFFNLLLPPIIFCAGYNMKKKHFFENLGAIASFAFLGTILSSLTIGGLCYGLSRTITSISDSIGFGECLLFGSFISATDPVTVLAIFNDINIEVDLYAFVFGESVLNDAVAIVLVNSVEQYGKIANNGEFNPFAILIAAKSFMTVFLGALSIGCVVGICTALVTKYTYLRDHPLLETSLFFLMSYCSFLIAEVAGASGIVASLFCGITQAHYTYNNLSEESQKWTKGIFELMSFLSENFVFVYIGVSNFTFRDHNWQPRFICIAIFAIIVGRAVNVYILSAMLNLGRKNKIKFNHQHMLMFAGVRGAMAFALA--IRNTSSKVRQMFFSTTLVIVMVTVFICGGLTLPMINFLKIRIGKDNEITDSIPEPADDTTISDEQVLDLNER 1637
            ++  F   +FF + LPPIIF +GYN+ K +FF+N+G+I  FA LGT++S++ IGG  Y     I +++  +   E   FGS ISA DPV  LAIF  ++++  LY  VFGES+LNDAV+IVL+ ++    K     E     I  A   F+  FL + ++G   G+ +AL+ K+  LR  P LE  +  +  +  + +AE    SGI+A LF GI  +HYT+ NLS  +Q   + IF  ++F++E  VF Y+G++ F+F+ H  +P  I   +   +VGRAVN++ LS +LN  R  KI   +Q ++ F+G+RGA+AFAL   +   S +  Q+  +TTL++V+ ++   GGLTLP + F+       +   DS  E  DD  +   ++   N R
Sbjct:   86 QEEEFPPMVFFLVFLPPIIFESGYNLHKGNFFQNIGSILVFAILGTVISTIVIGGGLYLCG--IANLAYRLSIFESFGFGSLISAVDPVATLAIFKAMDVDPILYMLVFGESILNDAVSIVLMTTIMNLDKPEFQNEAALKLIGQAIGGFLGTFLASAALGIAFGLISALILKWIDLRKTPSLEVGIMLVFCFAPYCLAEGIKLSGIMAILFDGIVMSHYTHRNLSPITQMTVQQIFRTLAFMAETIVFAYLGLAIFSFK-HRAEPALIGWILVLCLVGRAVNIFPLSYLLNFFRDIKITKKNQVVMWFSGLRGAIAFALVLHLEGISQETSQVLITTTLIVVLCSIIFLGGLTLPFMKFINWFTACSSSNIDSDSE--DDLYVPSAKLKSRNRR 475          
BLAST of slc9a-2 vs. Planmine SMEST
Match: SMESG000013689.1 (SMESG000013689.1)

HSP 1 Score: 208.764 bits (530), Expect = 2.243e-57
Identity = 150/481 (31.19%), Postives = 248/481 (51.56%), Query Frame = 3
Query:  432 HESDAKDLSRKATFDAEIFFNLLLPPIIFCAGYNMKKKHFFENLGAIASFAFLGTILSSLTIGGLCYGLSRT----ITSISDSIGFGECLLFGSFISATDPVTVLAIFNDINIEVDLYAFVFGESVLNDAVAIVLVNSVEQYGKIANNGEFNPFAILIAAKSFMTVFLGALSIGCVVGICTALVTKYTYLRDHPLLETSLFFLMSYCSFLIAEVAGASGIVASLFCGITQAHYTYNNLSEESQKWTKGIFELMSFLSENFVFVYIGVSNFTFRDHNWQPRFICIAIFAIIVGRAVNVYILSAMLNLGR--KNKIKFNHQHMLMFAGVRGAMAFALAI-----------RNTSSKVRQMFFSTTLVIVMVTVFICGGLTLPMINFLKIRIGKD------NEITDSIPEPADDTTISDEQVLDLNERHKKKAFLIRMFAKLDCQFIKPLLTHSPPLLIDTCPLCCFTFAKFLTTSEQISRNSH 1805
            HE +  D+S K T   E+FF +LLPPI+  + Y M  + F   LG +  FA  GTILS   IG   +GL +     +  ++D +     LLF SFI A DPV VLAIF D+ ++ +LY  +FGES+LNDAV IVL + +++   I   G+ N   I +   SF TV LG L +G + G+ + L+T++   R+   +   +    +Y S++IA     SGI++ + CGI QA Y + N+ +  Q   +   EL + +SE+ +FVY+G+  F          F   A F  ++ R + +++L  ++N  +  + KI +    +  + G+RGA+AF+LA                 +++ +F  TTL+I+++TV + G    P+   LK++  +       NE+ +++ E   + T + E ++D   R+   ++LI++ A  D  +I+P L + P         C     K L   EQ+S   H
Sbjct:   83 HEVEL-DVSVKLT--PELFFLILLPPIVLDSAYQMYNRTFGNILGIVLIFAVFGTILSFAIIGMSLFGLQKLNNNFLPDVNDKLM--AILLFSSFIVAVDPVAVLAIFKDLKVDKELYYMIFGESLLNDAVTIVLYDIIKELMII---GDTNVKNISLGFVSFFTVSLGGLLVGVITGVLSVLLTRFQSKRE---IHCVMIIATAYLSYIIAYSIHWSGIMSIIGCGIVQAAYGFRNIEKSMQLTVRNFVELTAGVSESIIFVYLGIEFFKVEKVFDHIEFQISAFFLCLIARFIVIFVLRLLINFAKVDQRKISWTEMFIAAYGGLRGAVAFSLATLIIPEIVWKGDTENRKEMKMLFVKTTLMIIILTVAVMGTTIKPLAKLLKVKSEEKKILSVYNELNNAVIE---NLTATLEGIIDQKGRN---SYLIQL-ANFDNLYIRPWLVNEP---------CDNKVFKILKRLEQVSLALH 536          
BLAST of slc9a-2 vs. Planmine SMEST
Match: SMESG000069099.1 (SMESG000069099.1)

HSP 1 Score: 191.045 bits (484), Expect = 3.397e-51
Identity = 138/433 (31.87%), Postives = 239/433 (55.20%), Query Frame = 3
Query:  468 TFDAEIFFNLLLPPIIFCAGYNMKKKHFFENLGAIASFAFLGTILSSLTIG-GLCY-----GLSRTITSISDSIGFGECLLFGSFISATDPVTVLAIFNDINIEVDLYAFVFGESVLNDAVAIVLVNS---VEQYGKIANNGEFNPFAILIAAKSFMTVFLGALSIGCVVGICTALVTKYTYLRDHPLLETSLFFLMSYCSFLIAEVAGASGIVASLFCGITQAHYTYNNLSEESQKWTKGIFELMSFLSENFVFVYIGVSNFTFRDHNWQPRFICIAIFAIIVGRAVNVYILSAMLNLGRKN--KIKFNHQHMLMFAGVRGAMAFALAIR-NTSSKVRQMFFSTTLVIVMVTVFICGGLTL-PMINFLKIRIGKDNEIT--DSIPEPADDTTISD-EQVLDLNERHKKKAFLIRMFAKLDCQFIKPLLTHSP 1718
            + +++ FFNLLLPPII  A + M  + F  N+  +  FA + T+L+ + IG GL Y     GLS +++ ++ S  +    +F + I A DPV VLAIF +I+++ +LY  VFGES+LND V++VL  +   + ++ KI  N       ++    SF+ V LG   IGC++ + T L+T++TY    PL E  L  L  Y S+L+A +   SGI++ +  G+ QA Y + N++++S    K + +++S +SE  +F+++GVS      H     F   ++F  + GR +   +LS M+N    N  KI +N Q ++ + G+RG +A+ LA+  +++  V +     T + ++       G+T+ P++  L+I I K +E++    I E A D  ++  E+++ +  R+    F    FA +D  +I+P L   P
Sbjct:  104 SINSDRFFNLLLPPIILEASFAMYHRTFASNIVGVLVFAVIATMLNFVFIGLGLTYISHYRGLSLSVSQVNISTFW----VFSALIVAVDPVAVLAIFQEIHVDNNLYYLVFGESLLNDGVSVVLYETMIILSRFDKITIN------ELVRTVISFLLVCLGGGVIGCIISVFTCLMTRFTY--KTPLTEPVLVMLFGYLSYLLAGMIKWSGIISMIVYGVFQATYGFQNITQKSLILIKRLSKILSNVSEAVIFIHLGVS--VTDTHISLTSFTFWSVFLCLYGRYIFTLLLSGMINYFDFNIRKIAWNEQFIIAYGGLRGGIAYCLALLIDSTVPVSKHDIQQTTIFIIFFTIFFMGMTMKPLVTLLQIEIAKPDELSLFVQISESAIDHLLAGMEEIIGMKGRNAIHEF----FANIDEIYIRPFLQRDP 518          
BLAST of slc9a-2 vs. Planmine SMEST
Match: SMESG000006858.1 (SMESG000006858.1)

HSP 1 Score: 190.274 bits (482), Expect = 4.661e-51
Identity = 136/384 (35.42%), Postives = 211/384 (54.95%), Query Frame = 3
Query:  468 TFDAEIFFNLLLPPIIFCAGYNMKKKHFFENLGAIASFAFLGTILSSLTIGGLCYGLSRTITSISD----SIGFGECLLFGSFISATDPVTVLAIFNDINIEVDLYAFVFGESVLNDAVAIVLVNSVEQYGKIANNGEFNPFAILIAAKSFMTVFLGALSIGCVVGICTALVTKYTYLRDHPLLETSLFFLMSYCSFLIAEVAGASGIVASLFCGITQAHYTYNNLSEESQKWTKGIFELMSFLSENFVFVYIGVSNFTFRDHNWQPRFICIAIFAIIVGRAVNVYILSAMLNLG--RKNKIKFNHQHMLMFAGVRGAMAFALAIRNTSSKV-----------RQMFFSTTLVIVMVTVFICGGLTLPMINFLKIRIGKDNEIT 1568
            T +  +FF +LLPPI+  + Y M  + F+   G    +A LGTI + L IG   YG++    S+      ++     LLF S I A DPV VLAIFNDI +E +LY  VFGES+LNDAV +VL + ++ +         +   I +   SF TV LG L IG + GI T LVT+   + D+   E ++  L+ Y S+++A+    SGI+A + CGI QA YT+NN+S ES    + I E+ + LSE  +F+++G S  +  +  W   F+  ++F  IV RAV   +L+ + NL      KI      ++++ G+RGA+A+ LA+   + K+           R++  +TTL I++ TV   G    P++  LKI+I K  +++
Sbjct:   96 TMNPNLFFLILLPPIVLNSAYEMTTRSFYRVFGICIMYAVLGTIFNFLLIGFTLYGVTTGGVSVYGGPELNLTLRPILLFSSLIVAVDPVAVLAIFNDIGVEQELYFIVFGESLLNDAVTVVLYDIMKAF---LGTEPISSLQIGLGIISFFTVSLGGLLIGLIFGIITCLVTR---IYDNK-FEVAVIILLGYISYILADTIMWSGIIAIIGCGIVQAEYTFNNISPESLIVLRNIVEMWANLSEGVIFLFLGES-LSHIEKGWHSGFVFWSLFICIVARAVVCGLLALVNNLVNLEDRKISMTELIVIVYGGLRGAVAYCLAVLIDAEKLDGTTDADKSFNRELQITTTLFIILFTVGAHGLTMKPLVKLLKIKIAKVEDLS 471          
The following BLAST results are available for this feature:
BLAST of slc9a-2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC9A63.942e-16845.74solute carrier family 9 member A6 [Source:HGNC Sym... [more]
SLC9A61.622e-16745.95solute carrier family 9 member A6 [Source:HGNC Sym... [more]
SLC9A61.622e-16745.95solute carrier family 9 member A6 [Source:HGNC Sym... [more]
SLC9A61.622e-16745.95solute carrier family 9 member A6 [Source:HGNC Sym... [more]
SLC9A61.622e-16745.95solute carrier family 9 member A6 [Source:HGNC Sym... [more]
back to top
BLAST of slc9a-2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nhx-53.545e-13742.71Sodium/hydrogen exchanger [Source:UniProtKB/TrEMB... [more]
nhx-55.302e-13742.71Sodium/hydrogen exchanger [Source:UniProtKB/TrEMB... [more]
nhx-84.497e-6036.16Sodium/hydrogen exchanger [Source:UniProtKB/TrEMB... [more]
nhx-89.452e-6036.12Sodium/hydrogen exchanger [Source:UniProtKB/TrEMB... [more]
nhx-91.177e-5530.46Probable Na(+)/H(+) antiporter nhx-9 [Source:UniP... [more]
back to top
BLAST of slc9a-2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nhe32.872e-15845.92gene:FBgn0028703 transcript:FBtr0273250[more]
Nhe34.354e-15845.92gene:FBgn0028703 transcript:FBtr0300327[more]
Nhe31.185e-15745.47gene:FBgn0028703 transcript:FBtr0333348[more]
Nhe32.217e-15745.47gene:FBgn0028703 transcript:FBtr0273248[more]
Nhe31.807e-15544.69gene:FBgn0028703 transcript:FBtr0273247[more]
back to top
BLAST of slc9a-2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc9a6a7.704e-17245.96solute carrier family 9 member A6 [Source:ZFIN;Acc... [more]
slc9a6a1.438e-16845.39solute carrier family 9 member A6 [Source:ZFIN;Acc... [more]
slc9a75.263e-16844.10solute carrier family 9 member 7 [Source:ZFIN;Acc:... [more]
slc9a77.416e-16844.03solute carrier family 9 member 7 [Source:ZFIN;Acc:... [more]
slc9a6b8.249e-16545.07solute carrier family 9 member 6b [Source:ZFIN;Acc... [more]
back to top
BLAST of slc9a-2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC9A62.991e-17146.55solute carrier family 9, subfamily A (NHE6, cation... [more]
SLC9A61.627e-16545.72solute carrier family 9, subfamily A (NHE6, cation... [more]
SLC9A61.682e-16544.72solute carrier family 9, subfamily A (NHE6, cation... [more]
SLC9A61.961e-16545.72solute carrier family 9, subfamily A (NHE6, cation... [more]
SLC9A69.990e-16344.31solute carrier family 9, subfamily A (NHE6, cation... [more]
back to top
BLAST of slc9a-2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc9a61.167e-16846.22solute carrier family 9 (sodium/hydrogen exchanger... [more]
Slc9a66.861e-16244.96solute carrier family 9 (sodium/hydrogen exchanger... [more]
Slc9a73.165e-15945.51solute carrier family 9 (sodium/hydrogen exchanger... [more]
Slc9a91.041e-15846.21solute carrier family 9 (sodium/hydrogen exchanger... [more]
Slc9a72.255e-15050.20solute carrier family 9 (sodium/hydrogen exchanger... [more]
back to top
BLAST of slc9a-2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q92581|SL9A6_HUMAN2.166e-16144.65Sodium/hydrogen exchanger 6 OS=Homo sapiens OX=960... [more]
sp|Q8BLV3|SL9A7_MOUSE2.214e-15845.51Sodium/hydrogen exchanger 7 OS=Mus musculus OX=100... [more]
sp|Q8BZ00|SL9A9_MOUSE7.284e-15846.21Sodium/hydrogen exchanger 9 OS=Mus musculus OX=100... [more]
sp|Q96T83|SL9A7_HUMAN1.577e-15645.71Sodium/hydrogen exchanger 7 OS=Homo sapiens OX=960... [more]
sp|Q8IVB4|SL9A9_HUMAN1.193e-15444.10Sodium/hydrogen exchanger 9 OS=Homo sapiens OX=960... [more]
back to top
BLAST of slc9a-2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YIW80.000e+0100.00Sodium/hydrogen exchanger OS=Schmidtea mediterrane... [more]
A0A267G2N70.000e+051.89Sodium/hydrogen exchanger OS=Macrostomum lignano O... [more]
A0A267GH550.000e+051.73Sodium/hydrogen exchanger OS=Macrostomum lignano O... [more]
A0A267FNB60.000e+050.39Sodium/hydrogen exchanger OS=Macrostomum lignano O... [more]
A0A1S3H9X60.000e+049.35Sodium/hydrogen exchanger OS=Lingula unguis OX=757... [more]
back to top
BLAST of slc9a-2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc9a6a2.818e-16945.51solute carrier family 9 member A6 [Source:NCBI gen... [more]
slc9a73.115e-16345.48solute carrier family 9 member 7 [Source:ZFIN;Acc:... [more]
slc9a6a4.326e-16342.84solute carrier family 9 member A6 [Source:NCBI gen... [more]
slc9a6b1.279e-15545.14solute carrier family 9 member 6b [Source:ZFIN;Acc... [more]
slc9a6b1.502e-15444.97solute carrier family 9 member 6b [Source:ZFIN;Acc... [more]
back to top
BLAST of slc9a-2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
slc9a3.12.422e-3627.30solute carrier family 9 member A3, tandem duplicat... [more]
ENSPMAT00000000903.17.380e-3640.00pep scaffold:Pmarinus_7.0:GL477267:34875:46041:-1 ... [more]
ENSPMAT00000001296.12.115e-640.00pep scaffold:Pmarinus_7.0:GL497132:72:2488:-1 gene... [more]
back to top
BLAST of slc9a-2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
NHX12.576e-6533.40Na+/H+ and K+/H+ exchanger; required for intracell... [more]
back to top
BLAST of slc9a-2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO406718.646e-15147.26Sodium/hydrogen exchanger [Source:UniProtKB/TrEMB... [more]
EDO430526.180e-14444.83Sodium/hydrogen exchanger [Source:UniProtKB/TrEMB... [more]
EDO341031.872e-6236.12Sodium/hydrogen exchanger [Source:UniProtKB/TrEMB... [more]
EDO492974.813e-925.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc9a-2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc9a6b2.249e-17143.46sodium/hydrogen exchanger 6 [Source:NCBI gene;Acc:... [more]
slc9a6a2.419e-16946.59solute carrier family 9 member A6 [Source:NCBI gen... [more]
slc9a71.338e-16545.28solute carrier family 9 member A7 [Source:NCBI gen... [more]
slc9a6b1.446e-16446.77sodium/hydrogen exchanger 6 [Source:NCBI gene;Acc:... [more]
SLC9A95.309e-10735.68sodium/hydrogen exchanger 9 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of slc9a-2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000028983.10.000e+099.85SMESG000028983.1[more]
SMESG000035898.17.265e-7537.47SMESG000035898.1[more]
SMESG000013689.12.243e-5731.19SMESG000013689.1[more]
SMESG000069099.13.397e-5131.87SMESG000069099.1[more]
SMESG000006858.14.661e-5135.42SMESG000006858.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30012022
GenBankAKN21461.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012022 ID=SMED30012022|Name=slc9a-2|organism=Schmidtea mediterranea sexual|type=transcript|length=2355bp
ATATTAATCAATTTAAAAGCTTTAATTTTGAAAATAATTAAATCATGGTC
TCTAAATGTGAAGCGTTAAATGAAAAGATTTTGGAACAATCGAGAGAAGA
GAAAGTACAACAAAATCACAAAACCGATAGCCTTATTTTATTGTCATTTT
TAATATTATTAATTGTATCAGTTATTACAATATGGATTTTTAAACATAAA
AGGTTGCGATTTGTGCATGAAACGAGCTGTTCGTTAATTTATGGATTGAT
TTTGGGAGTAATTTTTTATAATTTGCCTATCGATGTTAATAAAGTGACTA
CAACTCTTCAAATGCCACAATCGAAAACCAACTGTGCTTATCAACTCCCA
CCAGATAACATTATATTAGAAATGAATTTATTAAATAGAACTTCGCCTTA
TACATTTAAATATCGGCATGTATTAAACGATCATGAATCTGACGCGAAAG
ATTTGAGTAGAAAGGCGACATTTGATGCTGAAATATTTTTTAATTTATTA
TTACCACCGATCATATTTTGCGCTGGATACAATATGAAAAAGAAACATTT
CTTTGAAAATCTCGGTGCGATTGCTAGCTTTGCCTTTTTGGGTACGATAT
TGTCTTCACTCACTATCGGTGGATTATGTTATGGTCTTTCTCGAACAATC
ACTTCCATTTCTGATTCCATCGGATTCGGAGAATGTTTACTTTTTGGTTC
TTTCATTTCTGCGACAGATCCAGTTACGGTGTTGGCAATATTCAATGACA
TTAATATTGAAGTAGATCTGTATGCCTTTGTTTTCGGAGAAAGTGTCTTA
AACGATGCTGTTGCAATAGTATTAGTAAATTCTGTAGAGCAATACGGAAA
AATTGCAAACAATGGGGAATTTAATCCGTTTGCCATTCTAATAGCAGCCA
AATCATTTATGACTGTTTTTCTTGGAGCATTATCTATTGGATGTGTTGTA
GGTATATGTACGGCTCTAGTTACGAAATATACTTATTTACGAGATCATCC
ATTACTTGAAACATCTTTATTTTTTCTAATGAGCTATTGCTCATTTTTAA
TTGCGGAAGTTGCCGGAGCTTCAGGTATTGTTGCAAGTTTATTTTGTGGC
ATCACTCAAGCTCATTATACATATAATAATTTATCAGAAGAATCTCAGAA
ATGGACCAAAGGAATTTTTGAGTTGATGAGTTTCTTATCTGAAAACTTTG
TATTTGTTTACATCGGGGTATCGAATTTTACGTTTAGGGATCATAATTGG
CAGCCACGATTTATTTGTATTGCTATATTTGCCATAATTGTCGGCCGTGC
GGTTAATGTCTACATTTTGTCTGCAATGTTAAACTTAGGAAGAAAAAATA
AAATAAAATTCAATCATCAACATATGCTCATGTTTGCTGGTGTTCGTGGA
GCGATGGCTTTTGCATTAGCTATCCGGAATACTAGTTCTAAAGTTCGTCA
AATGTTTTTCAGTACAACTCTTGTAATTGTTATGGTCACTGTGTTTATTT
GTGGGGGATTAACATTGCCGATGATTAATTTTCTAAAAATTCGAATAGGC
AAAGATAATGAAATAACAGATTCGATTCCTGAGCCAGCCGATGACACTAC
TATTAGTGATGAACAAGTTCTTGATCTAAATGAAAGGCACAAGAAAAAAG
CATTTCTTATTAGAATGTTTGCTAAACTTGATTGCCAATTTATAAAACCA
CTATTAACACACAGTCCACCTCTATTGATTGATACTTGTCCTCTTTGCTG
TTTTACTTTTGCTAAATTCCTCACAACTTCAGAACAGATTAGTAGGAATA
GTCATTTGCGAATTTCTAAAAACAACATATCCATGGACATGACTGGTGAC
AATATGGCTTATAAATCAGATAGGGATTTGACATCGTTCAATCCGGGTTT
GCCTATTAATGTCGCAGATAATATCAATGTCGATATTAACAATCATTTTA
AAAAACACTTGAGTGATCAAGAATTTATCCTAACCGATACCGATGACAAT
GCGGGATATATTGAAGGAGAGGAATCTGGTTTATATATTCAAGAATACTC
GGCGATTCCTAATACGAATTCGGTTTGAGAGAATGTGTCAATGTAGTGAT
TTGCAGAGAGTATTTCAATGACTTGACAACCCTTGTTATTATTCCATGTC
TAACTTATCACGTATTTTTGATCTCTAACATTGGACATTATATATTCCTG
TAATTGATTTGTTAGCATAAATACAATATAAAGCCATTAGAACTGATTTC
GTTATTCATTTGGAAGAAATTCATTATAACTTATTTGTGAGTTCCGATGC
ATTCCTAGTGTAAAAATCCTGTTGTTGTTTTAAATAAAATTTAATCATAA
AAAAA
back to top

protein sequence of SMED30012022-orf-1

>SMED30012022-orf-1 ID=SMED30012022-orf-1|Name=SMED30012022-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=678bp
MVSKCEALNEKILEQSREEKVQQNHKTDSLILLSFLILLIVSVITIWIFK
HKRLRFVHETSCSLIYGLILGVIFYNLPIDVNKVTTTLQMPQSKTNCAYQ
LPPDNIILEMNLLNRTSPYTFKYRHVLNDHESDAKDLSRKATFDAEIFFN
LLLPPIIFCAGYNMKKKHFFENLGAIASFAFLGTILSSLTIGGLCYGLSR
TITSISDSIGFGECLLFGSFISATDPVTVLAIFNDINIEVDLYAFVFGES
VLNDAVAIVLVNSVEQYGKIANNGEFNPFAILIAAKSFMTVFLGALSIGC
VVGICTALVTKYTYLRDHPLLETSLFFLMSYCSFLIAEVAGASGIVASLF
CGITQAHYTYNNLSEESQKWTKGIFELMSFLSENFVFVYIGVSNFTFRDH
NWQPRFICIAIFAIIVGRAVNVYILSAMLNLGRKNKIKFNHQHMLMFAGV
RGAMAFALAIRNTSSKVRQMFFSTTLVIVMVTVFICGGLTLPMINFLKIR
IGKDNEITDSIPEPADDTTISDEQVLDLNERHKKKAFLIRMFAKLDCQFI
KPLLTHSPPLLIDTCPLCCFTFAKFLTTSEQISRNSHLRISKNNISMDMT
GDNMAYKSDRDLTSFNPGLPINVADNINVDINNHFKKHLSDQEFILTDTD
DNAGYIEGEESGLYIQEYSAIPNTNSV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR018422Cation/H_exchanger_CPA1
IPR002090NHE6_7_9
IPR004709NaH_exchanger
IPR006153Cation/H_exchanger
Vocabulary: biological process
TermDefinition
GO:0006885regulation of pH
GO:0006814sodium ion transport
GO:0055085transmembrane transport
GO:0006812cation transport
GO:0006811ion transport
GO:0035725sodium ion transmembrane transport
GO:1902600hydrogen ion transmembrane transport
GO:0006810transport
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: molecular function
TermDefinition
GO:0015385sodium:proton antiporter activity
GO:0015299solute:proton antiporter activity
GO:0015297antiporter activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR004709Na+/H+ exchangerPRINTSPR01084NAHEXCHNGRcoord: 161..175
score: 49.98
coord: 218..228
score: 69.65
coord: 147..158
score: 71.5
coord: 176..184
score: 53.09
IPR004709Na+/H+ exchangerTIGRFAMTIGR00840TIGR00840coord: 140..523
e-value: 7.8E-104
score: 346.0
IPR002090Na+/H+ exchanger, isoform 6/7/9PRINTSPR01088NAHEXCHNGR6coord: 490..516
score: 25.93
coord: 22..46
score: 40.0
coord: 47..65
score: 57.89
IPR006153Cation/H+ exchangerPFAMPF00999Na_H_Exchangercoord: 37..493
e-value: 7.9E-79
score: 265.2
IPR018422Cation/H+ exchanger, CPA1 familyPANTHERPTHR10110SODIUM/HYDROGEN EXCHANGERcoord: 7..588
NoneNo IPR availablePANTHERPTHR10110:SF94SODIUM/HYDROGEN EXCHANGER 6coord: 7..588
NoneNo IPR availableTMHMMTMhelixcoord: 174..196
NoneNo IPR availableTMHMMTMhelixcoord: 472..494
NoneNo IPR availableTMHMMTMhelixcoord: 64..86
NoneNo IPR availableTMHMMTMhelixcoord: 406..428
NoneNo IPR availableTMHMMTMhelixcoord: 147..164
NoneNo IPR availableTMHMMTMhelixcoord: 30..49
NoneNo IPR availableTMHMMTMhelixcoord: 325..347
NoneNo IPR availableTMHMMTMhelixcoord: 288..310
NoneNo IPR availableTMHMMTMhelixcoord: 443..460