tph

Overview
Nametph (AGS83411.1)
Smed IDSMED30012020
Length (bp)1774
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of tph (SMED30012020) t-SNE clustered cells

Violin plots show distribution of expression levels for tph (SMED30012020) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of tph (SMED30012020) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for tph (SMED30012020) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012020

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 19

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
central nervous systemSMED30012020SMESG000000522.1 dd_Smed_v4_8392_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
posterior region of the whole animalSMED30012020SMESG000000522.1 dd_Smed_v4_8392_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pigment cup cellSMED30012020SMESG000000522.1 SMESG000000520.1 tphsmed_ncbi_20200123PMID:22451003
González-Sastre et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
eyeSMED30012020SMESG000000522.1 SMESG000000520.1 tphsmed_ncbi_20200123PMID:25558068
Reuter et al., 2015
whole organism asexual adult fluorescence in situ hybridization evidence
optic cupSMED30012020SMESG000000522.1 SMESG000000520.1 tphsmed_ncbi_20200123PMID:25725068
Owen et al., 2015
whole organism asexual adult fluorescence in situ hybridization evidence
nervous systemSMED30012020SMESG000000522.1 dd_Smed_v4_8392_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30012020SMESG000000522.1 dd_Smed_v4_8392_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30012020SMESG000000522.1 dd_Smed_v4_8392_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
non-ciliated neuronSMED30012020SMESG000000522.1 dd_Smed_v4_8392_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30012020SMESG000000522.1 OX_Smed_1.0.20528ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
optic cupSMED30012020SMESG000000522.1 SMESG000000520.1 tphsmed_ncbi_20200123PMID:28976975
Su et al., 2017
whole organism asexual adult fluorescence in situ hybridization evidence
secretory cellSMED30012020SMESG000000522.1 SMESG000000520.1 KF134114smed_ncbi_20200123PMID:23903188
Currie et al., 2013
whole organism asexual adult fluorescence in situ hybridization evidence
ventral region of the whole animalSMED30012020SMESG000000522.1 SMESG000000520.1 KF134114smed_ncbi_20200123PMID:23903188
Currie et al., 2013
whole organism asexual adult fluorescence in situ hybridization evidence
parapharyngeal regionSMED30012020SMESG000000522.1 SMESG000000520.1 KF134114smed_ncbi_20200123PMID:23903188
Currie et al., 2013
whole organism asexual adult fluorescence in situ hybridization evidence
serotonergic neuronSMED30012020SMESG000000522.1 SMESG000000520.1 KF134114smed_ncbi_20200123PMID:23903188
Currie et al., 2013
whole organism asexual adult fluorescence in situ hybridization evidence
optic cupSMED30012020SMESG000000522.1 SMESG000000520.1 tphsmed_ncbi_20200123PMID:26017970
Lambrus et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
peripheral nervous systemSMED30012020SMESG000000522.1 SMESG000000520.1 tphsmed_ncbi_20200123PMID:26017970
Lambrus et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
central nervous systemSMED30012020SMESG000000522.1 SMESG000000520.1 tphsmed_ncbi_20200123PMID:26017970
Lambrus et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
parapharyngeal regionSMED30012020SMESG000000522.1 SMESG000000520.1 tphsmed_ncbi_20200123PMID:26017970
Lambrus et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of tph vs. Ensembl Human
Match: TPH1 (tryptophan hydroxylase 1 [Source:HGNC Symbol;Acc:HGNC:12008])

HSP 1 Score: 584.334 bits (1505), Expect = 0.000e+0
Identity = 278/461 (60.30%), Postives = 352/461 (76.36%), Query Frame = 3
Query:  312 EENKTISTRRS-TSFIFGVNDNVKGLVRVLEIFEKFRVSVIHIETRKSLKNKSKFEIFIDVDCRKDEIKSLIECLQQKIDDDFHVQEVDMISSNINGIRIDTFDLAASEIGEQNIQLKNKKPGMTVDNLPWFPKYIKDLDKISNRVIMYGSELDADHPGFKDEVYRLRRNQFSEIAYSYKHGNPIPKIEYTNEEIKTWGNVYRELTKLYPTHACREFLQNLPLLQKYCGYREDNIPQLEDVSQFLKSRSGFTLRPVAGYLSSRDFLAGLAFRVFHCTQYIRHPSDPFYTPEPDCCHELMGHVPLLADSSFAQFSQEIGLASLGASEDEVQRLATCYFFTIEFGLCHQDGELRAYGAGLLSSIGELKHALSNESNIQKFDPKTVMEQECLVTTFQNAYFFTTSFEDAKDKMREFAKTIKKPFDVHYNPYTQMIETLDSTDSLTNVIDNIKGELATITNALRK 1691
            +ENK  S  R   S IF + + V GL++ L+IF++  V+++HIE+RKS +  S+FEIF+D D  ++++           +D FH     ++ S+ N + ++  D         N  LK    GM  + +PWFPK I DLD  +NRV+MYGSELDADHPGFKD VYR RR  F+++A +YKHG+PIPK+E+T EEIKTWG V++EL KLYPTHACRE+L+NLPLL KYCGYREDNIPQLEDVS FLK R+GF++RPVAGYLS RDFL+GLAFRVFHCTQY+RH SDPFYTPEPD CHEL+GHVPLLA+ SFAQFSQEIGLASLGASE+ VQ+LATCYFFT+EFGLC QDG+LR +GAGLLSSI ELKHALS  + ++ FDPK   +QECL+TTFQ+ YF + SFEDAK+KMREF KTIK+PF V YNPYT+ I+ L  T S+T+ ++ ++ +L  +++AL K
Sbjct:    6 KENKDHSLERGRASLIFSLKNEVGGLIKALKIFQEKHVNLLHIESRKSKRRNSEFEIFVDCDINREQL-----------NDIFH-----LLKSHTNVLSVNLPD---------NFTLKED--GM--ETVPWFPKKISDLDHCANRVLMYGSELDADHPGFKDNVYRKRRKYFADLAMNYKHGDPIPKVEFTEEEIKTWGTVFQELNKLYPTHACREYLKNLPLLSKYCGYREDNIPQLEDVSNFLKERTGFSIRPVAGYLSPRDFLSGLAFRVFHCTQYVRHSSDPFYTPEPDTCHELLGHVPLLAEPSFAQFSQEIGLASLGASEEAVQKLATCYFFTVEFGLCKQDGQLRVFGAGLLSSISELKHALSGHAKVKPFDPKITCKQECLITTFQDVYFVSESFEDAKEKMREFTKTIKRPFGVKYNPYTRSIQILKDTKSITSAMNELQHDLDVVSDALAK 437          
BLAST of tph vs. Ensembl Human
Match: TPH2 (tryptophan hydroxylase 2 [Source:HGNC Symbol;Acc:HGNC:20692])

HSP 1 Score: 573.163 bits (1476), Expect = 0.000e+0
Identity = 273/453 (60.26%), Postives = 346/453 (76.38%), Query Frame = 3
Query:  345 TSFIFGVNDNVKGLVRVLEIFEKFRVSVIHIETRKSLKNKSKFEIFIDVDCRKDEIKSLIECLQQKIDDDFHVQEVDMISSNINGIRIDTFDLAASEIGEQNIQLKNKKPGMTVDNLPWFPKYIKDLDKISNRVIMYGSELDADHPGFKDEVYRLRRNQFSEIAYSYKHGNPIPKIEYTNEEIKTWGNVYRELTKLYPTHACREFLQNLPLLQKYCGYREDNIPQLEDVSQFLKSRSGFTLRPVAGYLSSRDFLAGLAFRVFHCTQYIRHPSDPFYTPEPDCCHELMGHVPLLADSSFAQFSQEIGLASLGASEDEVQRLATCYFFTIEFGLCHQDGELRAYGAGLLSSIGELKHALSNESNIQKFDPKTVMEQECLVTTFQNAYFFTTSFEDAKDKMREFAKTIKKPFDVHYNPYTQMIETLDSTDSLTNVIDNIKGELATITNALRKFNIF 1703
            T+ +F + + V GLV+ L +F++ RV+++HIE+RKS +  S+ EIF+D +C K E   LI+ L+      F    V +                      +NI  + ++    ++++PWFP+ I +LDK S+RV+MYGSELDADHPGFKD VYR RR  F ++A  YK+G PIP++EYT EE KTWG V+REL+KLYPTHACRE+L+N PLL KYCGYREDN+PQLEDVS FLK RSGFT+RPVAGYLS RDFLAGLA+RVFHCTQYIRH SDP YTPEPD CHEL+GHVPLLAD  FAQFSQEIGLASLGAS+++VQ+LATCYFFTIEFGLC Q+G+LRAYGAGLLSSIGELKHALS+++ ++ FDPKT   QECL+TTFQ AYF + SFE+AK+KMR+FAK+I +PF V++NPYTQ IE L  T S+ NV+ +++ +L T+ +AL K N +
Sbjct:   64 TAVVFSLKNEVGGLVKALRLFQEKRVNMVHIESRKSRRRSSEVEIFVDCECGKTEFNELIQLLK------FQTTIVTLNPP-------------------ENIWTEEEE----LEDVPWFPRKISELDKCSHRVLMYGSELDADHPGFKDNVYRQRRKYFVDVAMGYKYGQPIPRVEYTEEETKTWGVVFRELSKLYPTHACREYLKNFPLLTKYCGYREDNVPQLEDVSMFLKERSGFTVRPVAGYLSPRDFLAGLAYRVFHCTQYIRHGSDPLYTPEPDTCHELLGHVPLLADPKFAQFSQEIGLASLGASDEDVQKLATCYFFTIEFGLCKQEGQLRAYGAGLLSSIGELKHALSDKACVKAFDPKTTCLQECLITTFQEAYFVSESFEEAKEKMRDFAKSITRPFSVYFNPYTQSIEILKDTRSIENVVQDLRSDLNTVCDALNKMNQY 487          
BLAST of tph vs. Ensembl Human
Match: PAH (phenylalanine hydroxylase [Source:HGNC Symbol;Acc:HGNC:8582])

HSP 1 Score: 471.085 bits (1211), Expect = 8.809e-162
Identity = 230/450 (51.11%), Postives = 301/450 (66.89%), Query Frame = 3
Query:  342 STSFIFGVNDNVKGLVRVLEIFEKFRVSVIHIETRKSLKNKSKFEIFIDVDCRKDEIKSLIECLQQKIDDDFHVQEVDMISSNINGIRIDTFDLAASEIGEQNIQLKNKKPGMTVDNLPWFPKYIKDLDKISNRVIMYGSELDADHPGFKDEVYRLRRNQFSEIAYSYKHGNPIPKIEYTNEEIKTWGNVYRELTKLYPTHACREFLQNLPLLQKYCGYREDNIPQLEDVSQFLKSRSGFTLRPVAGYLSSRDFLAGLAFRVFHCTQYIRHPSDPFYTPEPDCCHELMGHVPLLADSSFAQFSQEIGLASLGASEDEVQRLATCYFFTIEFGLCHQDGELRAYGAGLLSSIGELKHALSNESNIQKFDPKTVMEQECLVTTFQNAYFFTTSFEDAKDKMREFAKTIKKPFDVHYNPYTQMIETLDSTDSLTNVIDNIKGELATITNALRK 1691
            + S IF + + V  L +VL +FE+  V++ HIE+R S   K ++E F  +D R                          + +  N I+I   D+ A+      +    KK     D +PWFP+ I++LD+ +N+++ YG+ELDADHPGFKD VYR RR QF++IAY+Y+HG PIP++EY  EE KTWG V++ L  LY THAC E+    PLL+KYCG+ EDNIPQLEDVSQFL++ +GF LRPVAG LSSRDFL GLAFRVFHCTQYIRH S P YTPEPD CHEL+GHVPL +D SFAQFSQEIGLASLGA ++ +++LAT Y+FT+EFGLC Q   ++AYGAGLLSS GEL++ LS +  +   + +    Q   VT FQ  Y+   SF DAK+K+R FA TI +PF V Y+PYTQ IE LD+T  L  + D+I  E+  + +AL+K
Sbjct:   29 AISLIFSLKEEVGALAKVLRLFEENDVNLTHIESRPSRLKKDEYEFFTHLDKRS-------------------------LPALTNIIKILRHDIGATV---HELSRDKKK-----DTVPWFPRTIQELDRFANQILSYGAELDADHPGFKDPVYRARRKQFADIAYNYRHGQPIPRVEYMEEEKKTWGTVFKTLKSLYKTHACYEYNHIFPLLEKYCGFHEDNIPQLEDVSQFLQTCTGFRLRPVAGLLSSRDFLGGLAFRVFHCTQYIRHGSKPMYTPEPDICHELLGHVPLFSDRSFAQFSQEIGLASLGAPDEYIEKLATIYWFTVEFGLCKQGDSIKAYGAGLLSSFGELQYCLSEKPKLLPLELEKTAIQNYTVTEFQPLYYVAESFNDAKEKVRNFAATIPRPFSVRYDPYTQRIEVLDNTQQLKILADSINSEIGILCSALQK 445          
BLAST of tph vs. Ensembl Human
Match: PAH (phenylalanine hydroxylase [Source:HGNC Symbol;Acc:HGNC:8582])

HSP 1 Score: 470.7 bits (1210), Expect = 1.387e-161
Identity = 230/450 (51.11%), Postives = 301/450 (66.89%), Query Frame = 3
Query:  342 STSFIFGVNDNVKGLVRVLEIFEKFRVSVIHIETRKSLKNKSKFEIFIDVDCRKDEIKSLIECLQQKIDDDFHVQEVDMISSNINGIRIDTFDLAASEIGEQNIQLKNKKPGMTVDNLPWFPKYIKDLDKISNRVIMYGSELDADHPGFKDEVYRLRRNQFSEIAYSYKHGNPIPKIEYTNEEIKTWGNVYRELTKLYPTHACREFLQNLPLLQKYCGYREDNIPQLEDVSQFLKSRSGFTLRPVAGYLSSRDFLAGLAFRVFHCTQYIRHPSDPFYTPEPDCCHELMGHVPLLADSSFAQFSQEIGLASLGASEDEVQRLATCYFFTIEFGLCHQDGELRAYGAGLLSSIGELKHALSNESNIQKFDPKTVMEQECLVTTFQNAYFFTTSFEDAKDKMREFAKTIKKPFDVHYNPYTQMIETLDSTDSLTNVIDNIKGELATITNALRK 1691
            + S IF + + V  L +VL +FE+  V++ HIE+R S   K ++E F  +D R                          + +  N I+I   D+ A+      +    KK     D +PWFP+ I++LD+ +N+++ YG+ELDADHPGFKD VYR RR QF++IAY+Y+HG PIP++EY  EE KTWG V++ L  LY THAC E+    PLL+KYCG+ EDNIPQLEDVSQFL++ +GF LRPVAG LSSRDFL GLAFRVFHCTQYIRH S P YTPEPD CHEL+GHVPL +D SFAQFSQEIGLASLGA ++ +++LAT Y+FT+EFGLC Q   ++AYGAGLLSS GEL++ LS +  +   + +    Q   VT FQ  Y+   SF DAK+K+R FA TI +PF V Y+PYTQ IE LD+T  L  + D+I  E+  + +AL+K
Sbjct:   34 AISLIFSLKEEVGALAKVLRLFEENDVNLTHIESRPSRLKKDEYEFFTHLDKRS-------------------------LPALTNIIKILRHDIGATV---HELSRDKKK-----DTVPWFPRTIQELDRFANQILSYGAELDADHPGFKDPVYRARRKQFADIAYNYRHGQPIPRVEYMEEEKKTWGTVFKTLKSLYKTHACYEYNHIFPLLEKYCGFHEDNIPQLEDVSQFLQTCTGFRLRPVAGLLSSRDFLGGLAFRVFHCTQYIRHGSKPMYTPEPDICHELLGHVPLFSDRSFAQFSQEIGLASLGAPDEYIEKLATIYWFTVEFGLCKQGDSIKAYGAGLLSSFGELQYCLSEKPKLLPLELEKTAIQNYTVTEFQPLYYVAESFNDAKEKVRNFAATIPRPFSVRYDPYTQRIEVLDNTQQLKILADSINSEIGILCSALQK 450          
BLAST of tph vs. Ensembl Human
Match: TH (tyrosine hydroxylase [Source:HGNC Symbol;Acc:HGNC:11782])

HSP 1 Score: 448.358 bits (1152), Expect = 3.740e-152
Identity = 211/438 (48.17%), Postives = 292/438 (66.67%), Query Frame = 3
Query:  381 GLVRVLEIFEKFRVSVIHIETRKSLKNKS---KFEIFIDVDCRKDEIKSLIECLQQKIDDDFHVQEVDMISSNINGIRIDTFDLAASEIGEQNIQLKNKKPGMTVDNLPWFPKYIKDLDKISNRVIMYGSELDADHPGFKDEVYRLRRNQFSEIAYSYKHGNPIPKIEYTNEEIKTWGNVYRELTKLYPTHACREFLQNLPLLQKYCGYREDNIPQLEDVSQFLKSRSGFTLRPVAGYLSSRDFLAGLAFRVFHCTQYIRHPSDPFYTPEPDCCHELMGHVPLLADSSFAQFSQEIGLASLGASEDEVQRLATCYFFTIEFGLCHQDGELRAYGAGLLSSIGELKHALSNESNIQKFDPKTVMEQECLVTTFQNAYFFTTSFEDAKDKMREFAKTIKKPFDVHYNPYTQMIETLDSTDSLTNVIDNIKGELATITNAL 1685
             L R +++FE F   + H+ETR + + ++     E F+ ++ R+ ++ +L+  ++Q             +S ++            S  G +               +PWFP+ + +LDK  + V  +  +LD DHPGF D+VYR RR   +EIA+ Y+HG+PIP++EYT EEI TW  VY  L  LY THAC E L+   LL+++ GYREDNIPQLEDVS+FLK R+GF LRPVAG LS+RDFLA LAFRVF CTQYIRH S P ++PEPDCCHEL+GHVP+LAD +FAQFSQ+IGLASLGAS++E+++L+T Y+FT+EFGLC Q+GE++AYGAGLLSS GEL H LS E  I+ FDP+    Q     T+Q+ YF + SF DAKDK+R +A  I++PF V ++PYT  I+ LDS  ++   ++ ++ EL T+ +AL
Sbjct:   95 ALSRAVKVFETFEAKIHHLETRPAQRPRAGGPHLEYFVRLEVRRGDLAALLSGVRQ-------------VSEDVR-----------SPAGPK---------------VPWFPRKVSELDKCHHLVTKFDPDLDLDHPGFSDQVYRQRRKLIAEIAFQYRHGDPIPRVEYTAEEIATWKEVYTTLKGLYATHACGEHLEAFALLERFSGYREDNIPQLEDVSRFLKERTGFQLRPVAGLLSARDFLASLAFRVFQCTQYIRHASSPMHSPEPDCCHELLGHVPMLADRTFAQFSQDIGLASLGASDEEIEKLSTLYWFTVEFGLCKQNGEVKAYGAGLLSSYGELLHCLSEEPEIRAFDPEAAAVQPYQDQTYQSVYFVSESFSDAKDKLRSYASRIQRPFSVKFDPYTLAIDVLDSPQAVRRSLEGVQDELDTLAHAL 493          
BLAST of tph vs. Ensembl Celegans
Match: pah-1 (Phenylalanine-4-hydroxylase [Source:UniProtKB/Swiss-Prot;Acc:P90925])

HSP 1 Score: 451.44 bits (1160), Expect = 1.669e-154
Identity = 221/453 (48.79%), Postives = 301/453 (66.45%), Query Frame = 3
Query:  345 TSFIFGVNDNVKGLVRVLEIFEKFRVSVIHIETRKSLKNKSKFEIFIDVDCRKD--EIKSLIECLQQKIDDDFHVQEVDMISSNINGIRIDTFDLAASEIGEQNIQLKNKKPGMTVDNLPWFPKYIKDLDKISNRVIMYGSELDADHPGFKDEVYRLRRNQFSEIAYSYKHGNPIPKIEYTNEEIKTWGNVYRELTKLYPTHACREFLQNLPLLQKYCGYREDNIPQLEDVSQFLKSRSGFTLRPVAGYLSSRDFLAGLAFRVFHCTQYIRHPSDPFYTPEPDCCHELMGHVPLLADSSFAQFSQEIGLASLGASEDEVQRLATCYFFTIEFGLCHQDGELRAYGAGLLSSIGELKHALSNESNIQKFDPKTVMEQECLVTTFQNAYFFTTSFEDAKDKMREFAKTIKKPFDVHYNPYTQMIETLDSTDSLTNVIDNIKGELATITNALRKFN 1697
            T+ +F + +    L   L++F+   V++ HIE+R S  ++  +E+ ++    +D  +I+ +IE  QQK +    VQ+ +                            KNK+     D++PWFP+ I D+D+ +NR++ YG+ELDADHPGFKD  YR RR  F++IA+++KHG+ IP I YT+EEI TW  VY ELT +YP +AC+EF    PLLQ+ CG+  D IPQL+DVS FLK  +G+T+RPVAG LSSRDFLAGLAFRVFH TQYIRH S P YTPEPD CHEL+GHVPL AD  FAQFSQEIGLASLGA +D +++LAT Y+FTIEFG+C QDGE +AYGAGLLSS GEL++ALS++  +  FDP      +  +T +Q  YF   SF  AK+K++ +A TI +PF + YN YTQ +E LD   +L  +  +I+ +++T+  AL K N
Sbjct:   26 TTIVFTLREKAGALAETLKLFQAHDVNLSHIESRPSKTHEGCYEVLVEFAEAEDHRKIEGVIEHFQQKAEKKVLVQDWNT---------------------------KNKQ---NKDSVPWFPQKINDIDQFANRILSYGAELDADHPGFKDMTYRERRKFFADIAFNFKHGDKIPTITYTDEEIATWRTVYNELTVMYPKNACQEFNYIFPLLQQNCGFGPDRIPQLQDVSDFLKDCTGYTIRPVAGLLSSRDFLAGLAFRVFHSTQYIRHHSAPKYTPEPDICHELLGHVPLFADVEFAQFSQEIGLASLGAPDDVIEKLATLYWFTIEFGICQQDGEKKAYGAGLLSSFGELQYALSDKPEVVDFDPAVCCVTKYPITEYQPKYFLAESFASAKNKLKSWAATINRPFQIRYNAYTQRVEILDKVAALQRLARDIRSDISTLEEALGKVN 448          
BLAST of tph vs. Ensembl Celegans
Match: pah-1 (Phenylalanine-4-hydroxylase [Source:UniProtKB/Swiss-Prot;Acc:P90925])

HSP 1 Score: 451.44 bits (1160), Expect = 2.062e-154
Identity = 221/453 (48.79%), Postives = 301/453 (66.45%), Query Frame = 3
Query:  345 TSFIFGVNDNVKGLVRVLEIFEKFRVSVIHIETRKSLKNKSKFEIFIDVDCRKD--EIKSLIECLQQKIDDDFHVQEVDMISSNINGIRIDTFDLAASEIGEQNIQLKNKKPGMTVDNLPWFPKYIKDLDKISNRVIMYGSELDADHPGFKDEVYRLRRNQFSEIAYSYKHGNPIPKIEYTNEEIKTWGNVYRELTKLYPTHACREFLQNLPLLQKYCGYREDNIPQLEDVSQFLKSRSGFTLRPVAGYLSSRDFLAGLAFRVFHCTQYIRHPSDPFYTPEPDCCHELMGHVPLLADSSFAQFSQEIGLASLGASEDEVQRLATCYFFTIEFGLCHQDGELRAYGAGLLSSIGELKHALSNESNIQKFDPKTVMEQECLVTTFQNAYFFTTSFEDAKDKMREFAKTIKKPFDVHYNPYTQMIETLDSTDSLTNVIDNIKGELATITNALRKFN 1697
            T+ +F + +    L   L++F+   V++ HIE+R S  ++  +E+ ++    +D  +I+ +IE  QQK                           A  ++  Q+   KNK+     D++PWFP+ I D+D+ +NR++ YG+ELDADHPGFKD  YR RR  F++IA+++KHG+ IP I YT+EEI TW  VY ELT +YP +AC+EF    PLLQ+ CG+  D IPQL+DVS FLK  +G+T+RPVAG LSSRDFLAGLAFRVFH TQYIRH S P YTPEPD CHEL+GHVPL AD  FAQFSQEIGLASLGA +D +++LAT Y+FTIEFG+C QDGE +AYGAGLLSS GEL++ALS++  +  FDP      +  +T +Q  YF   SF  AK+K++ +A TI +PF + YN YTQ +E LD   +L  +  +I+ +++T+  AL K N
Sbjct:   30 TTIVFTLREKAGALAETLKLFQAHDVNLSHIESRPSKTHEGCYEVLVEFAEAEDHRKIEGVIEHFQQK---------------------------AEKKVLVQDWNTKNKQ---NKDSVPWFPQKINDIDQFANRILSYGAELDADHPGFKDMTYRERRKFFADIAFNFKHGDKIPTITYTDEEIATWRTVYNELTVMYPKNACQEFNYIFPLLQQNCGFGPDRIPQLQDVSDFLKDCTGYTIRPVAGLLSSRDFLAGLAFRVFHSTQYIRHHSAPKYTPEPDICHELLGHVPLFADVEFAQFSQEIGLASLGAPDDVIEKLATLYWFTIEFGICQQDGEKKAYGAGLLSSFGELQYALSDKPEVVDFDPAVCCVTKYPITEYQPKYFLAESFASAKNKLKSWAATINRPFQIRYNAYTQRVEILDKVAALQRLARDIRSDISTLEEALGKVN 452          
BLAST of tph vs. Ensembl Celegans
Match: tph-1 (TryPtophan Hydroxylase [Source:UniProtKB/TrEMBL;Acc:Q2V4U7])

HSP 1 Score: 439.499 bits (1129), Expect = 3.156e-150
Identity = 204/379 (53.83%), Postives = 275/379 (72.56%), Query Frame = 3
Query:  600 IRIDTFDL--AASEIGEQNIQLKNKKPGM--TVDNLPWFPKYIKDLDKISNRVIMYGSELDADHPGFKDEVYRLRRNQFSEIAYSYKHGNPIPKIEYTNEEIKTWGNVYRELTKLYPTHACREFLQNLPLLQKYCGYREDNIPQLEDVSQFLKSRSGFTLRPVAGYLSSRDFLAGLAFRVFHCTQYIRHPSDPFYTPEPDCCHELMGHVPLLADSSFAQFSQEIGLASLGASEDEVQRLATCYFFTIEFGLCHQDG-------------ELRAYGAGLLSSIGELKHALSNESNIQKFDPKTVMEQECLVTTFQNAYFFTTSFEDAKDKMREFAKTIKKPFDVHYNPYTQMIETLDSTDSLTNVIDNIKGELATITNAL 1685
            +R++  D+   +S I    I+ +  +PG         WFPK I DLD  + RVIMYG+ LDADHPGFKD  YR RR  F+E+A +YKHG PIP+ EYT+ E KTWG +YR+L +L+  HAC++FL N  LL+++CGY E+NIPQLED+ +FLK+++GF +RPVAGYLS+RDFLAGLA+RVF CTQY+RH +DPFYTPEPD  HELMGH+ L AD  FAQFSQEIGLASLGASE+++++LAT YFF+IEFGL   D                + YGAGLLSS GEL+HA+   + I +FDP  V+EQECL+TTFQ+AYF+T +FE+A+ K+R F   +K+PF V YNPYT+ +E L+++ S+   +++++ ++  +  AL
Sbjct:   47 MRLNGLDVHEVSSTIRPTAIKEQYTEPGSDDATTGSEWFPKSIYDLDICAKRVIMYGAGLDADHPGFKDTEYRQRRMMFAELALNYKHGEPIPRTEYTSSERKTWGIIYRKLRELHKKHACKQFLDNFELLERHCGYSENNIPQLEDICKFLKAKTGFRVRPVAGYLSARDFLAGLAYRVFFCTQYVRHHADPFYTPEPDTVHELMGHMALFADPDFAQFSQEIGLASLGASEEDLKKLATLYFFSIEFGLSSDDAADSPVKENGSNHERFKVYGAGLLSSAGELQHAVEGSATIIRFDPDRVVEQECLITTFQSAYFYTRNFEEAQQKLRMFTNNMKRPFIVRYNPYTESVEVLNNSRSIMLAVNSLRSDINLLAGAL 425          
BLAST of tph vs. Ensembl Celegans
Match: tph-1 (TryPtophan Hydroxylase [Source:UniProtKB/TrEMBL;Acc:Q2V4U7])

HSP 1 Score: 442.58 bits (1137), Expect = 8.089e-150
Identity = 204/379 (53.83%), Postives = 275/379 (72.56%), Query Frame = 3
Query:  600 IRIDTFDL--AASEIGEQNIQLKNKKPGM--TVDNLPWFPKYIKDLDKISNRVIMYGSELDADHPGFKDEVYRLRRNQFSEIAYSYKHGNPIPKIEYTNEEIKTWGNVYRELTKLYPTHACREFLQNLPLLQKYCGYREDNIPQLEDVSQFLKSRSGFTLRPVAGYLSSRDFLAGLAFRVFHCTQYIRHPSDPFYTPEPDCCHELMGHVPLLADSSFAQFSQEIGLASLGASEDEVQRLATCYFFTIEFGLCHQDG-------------ELRAYGAGLLSSIGELKHALSNESNIQKFDPKTVMEQECLVTTFQNAYFFTTSFEDAKDKMREFAKTIKKPFDVHYNPYTQMIETLDSTDSLTNVIDNIKGELATITNAL 1685
            +R++  D+   +S I    I+ +  +PG         WFPK I DLD  + RVIMYG+ LDADHPGFKD  YR RR  F+E+A +YKHG PIP+ EYT+ E KTWG +YR+L +L+  HAC++FL N  LL+++CGY E+NIPQLED+ +FLK+++GF +RPVAGYLS+RDFLAGLA+RVF CTQY+RH +DPFYTPEPD  HELMGH+ L AD  FAQFSQEIGLASLGASE+++++LAT YFF+IEFGL   D                + YGAGLLSS GEL+HA+   + I +FDP  V+EQECL+TTFQ+AYF+T +FE+A+ K+R F   +K+PF V YNPYT+ +E L+++ S+   +++++ ++  +  AL
Sbjct:  150 MRLNGLDVHEVSSTIRPTAIKEQYTEPGSDDATTGSEWFPKSIYDLDICAKRVIMYGAGLDADHPGFKDTEYRQRRMMFAELALNYKHGEPIPRTEYTSSERKTWGIIYRKLRELHKKHACKQFLDNFELLERHCGYSENNIPQLEDICKFLKAKTGFRVRPVAGYLSARDFLAGLAYRVFFCTQYVRHHADPFYTPEPDTVHELMGHMALFADPDFAQFSQEIGLASLGASEEDLKKLATLYFFSIEFGLSSDDAADSPVKENGSNHERFKVYGAGLLSSAGELQHAVEGSATIIRFDPDRVVEQECLITTFQSAYFYTRNFEEAQQKLRMFTNNMKRPFIVRYNPYTESVEVLNNSRSIMLAVNSLRSDINLLAGAL 528          
BLAST of tph vs. Ensembl Celegans
Match: cat-2 (Tyrosine 3-monooxygenase [Source:UniProtKB/Swiss-Prot;Acc:P90986])

HSP 1 Score: 314.309 bits (804), Expect = 4.756e-101
Identity = 161/436 (36.93%), Postives = 247/436 (56.65%), Query Frame = 3
Query:  393 VLEIFEKFRVSVIHIETRKSLKNKSKFEIFIDVDCRKDEIKSLIECLQQKIDDDFHVQEVDMISSNINGIRIDTFDLAASEIGEQNIQLKNKKPGMTVDNLPWFPKYIKDLDKISNRVIMYGSELDADHPGFKDEVYRLRRNQFSEIAYSYKHGNPIPKIEYTNEEIKTWGNVYRELTKLYPTHACREFLQNLPLLQKYCGYREDNIPQLEDVSQFLKSRSGFTLRPVAGYLSSRDFLAGLAFRVFHCTQYIRHPSDPFYTPEPDCCHELMGHVPLLADSSFAQFSQEIGLASLGASEDEVQRLATCYFFTIEFGLCHQDGELRAYGAGLLSSIGELKHALSNESNIQKFDPKTVMEQECLVTTFQNAYFFTTSFEDAKDKMREFAKTIKKPFDVHYNPYTQMIETLDSTDSLTNVIDNIKGELATITNALRKFNI 1700
            +L+     +V + H+ETR    N++  ++ +     K+++    E L Q                  N + +  F + A ++ ++  Q +            WFP++I +LD+ S  +  Y    D  HPG  D  Y  RR   ++ A  +K G+ I  ++YT EE  TW  VY +L  L+ +H C  + QNL +LQ+      D IPQ+ DV++FL+ ++GF LRP +G LS+RDFLA LAFRVF  T Y+RH   P ++PEPD  HEL+GHVP+ +D   AQ SQ+IGL SLGAS++ +++L+T Y+F +EFGLC +DG+L+A GAGLLS+ GEL HA S+    + FDP     Q+     +Q  YF   S  DA  K+R++A ++ +PF V Y+P+T+ IE ++S+  L      +  +L+ IT+A  +  I
Sbjct:   47 ILQNMSSAKVQICHVETRG---NEASHDVLLACKATKNQLIHSAELLTQ------------------NHVALTKFSIFAKKLSDEKNQSQ-----------IWFPRHISELDQCSKCITKYEPTTDPRHPGHGDVAYIARRKFLNDQALEFKFGDEIGYVDYTEEEHATWKAVYEKLGDLHLSHTCAVYRQNLKILQEEKVLTADRIPQIRDVNKFLQKKTGFELRPCSGLLSARDFLASLAFRVFQTTTYLRHHKSPHHSPEPDLIHELLGHVPMFSDPLLAQMSQDIGLMSLGASDEHIEKLSTVYWFIVEFGLCKEDGKLKAIGAGLLSAYGELMHACSDAPEHKDFDPAVTAVQKYEDDDYQPLYFVADSIHDALAKLRKYASSMDRPFSVVYDPFTKSIEAIESSADLEKAFSRLSNDLSAITHAADRMKI 450          
BLAST of tph vs. Ensembl Fly
Match: Trh (gene:FBgn0035187 transcript:FBtr0072638)

HSP 1 Score: 518.85 bits (1335), Expect = 2.823e-179
Identity = 238/452 (52.65%), Postives = 328/452 (72.57%), Query Frame = 3
Query:  348 SFIFGVNDNVKGLVRVLEIFEKFRVSVIHIETRKSLKNKSKFEIFIDVDCRKDEIKSLIECLQQKIDDDFHVQEVDMISSNINGI-RIDTFDLAASEIGEQNIQLKNKKPGMTVDNLPWFPKYIKDLDKISNRVIMYGSELDADHPGFKDEVYRLRRNQFSEIAYSYKHGNPIPKIEYTNEEIKTWGNVYRELTKLYPTHACREFLQNLPLLQKYCGYREDNIPQLEDVSQFLKSRSGFTLRPVAGYLSSRDFLAGLAFRVFHCTQYIRHPSDPFYTPEPDCCHELMGHVPLLADSSFAQFSQEIGLASLGASEDEVQRLATCYFFTIEFGLCHQ-DGELRAYGAGLLSSIGELKHALSNESNIQKFDPKTVMEQECLVTTFQNAYFFTTSFEDAKDKMREFAKTIKKPFDVHYNPYTQMIETLDSTDSLTNVIDNIKGELATITNALRKFN 1697
            S IF + + V  L R L++F++  ++V+H+E        ++ ++ +DV+C +  +  +++ L ++      V  V+  S N  G+ R  +    +S                   ++ WFP+ I DLDK  N V+MYGSELDADHPGFKD VYR RR QFS IA ++KHGNPIP+++YT EE+KTWG V+ EL +LY  HA  E++ N P L+KYCGYREDN+PQL+DVS +LK ++GF LRPVAGYLS RDFL+GLAFRVFHCTQYIRH SDPFYTPEPDCCHEL+GH+PLLA+SSFAQFSQEIGLASLGAS+ ++++LAT YFFT+EFGLC Q D   + YGAGLLSS+ EL+HA++ E+ I+KFDP+   +QEC++T++QNAY++T SFE+AK++MR FA++I++PF V YNPYT  +E L +   +T V+  ++G+L+ + +ALRK +
Sbjct:   80 SIIFTLRNQVGNLARALQVFQELGINVLHLELSPLEMATNQADVLVDVECDQRRLDQVVKMLNRE------VASVNYTSVNTQGLARAPSLSACSS---------------FDFGDMVWFPRKISDLDKAQN-VLMYGSELDADHPGFKDPVYRKRREQFSAIANNFKHGNPIPRVQYTPEEVKTWGTVFLELHRLYVLHAVPEYMDNWPELEKYCGYREDNVPQLQDVSVYLKRKTGFQLRPVAGYLSPRDFLSGLAFRVFHCTQYIRHSSDPFYTPEPDCCHELLGHMPLLANSSFAQFSQEIGLASLGASDADIEKLATLYFFTVEFGLCKQADSTFKVYGAGLLSSVAELQHAITAENKIKKFDPEVTCQQECIITSYQNAYYYTDSFEEAKEQMRAFAESIQRPFGVRYNPYTMSVEVLSNAKKITAVVSELRGDLSIVCSALRKIS 509          
BLAST of tph vs. Ensembl Fly
Match: Hn (gene:FBgn0001208 transcript:FBtr0100225)

HSP 1 Score: 471.085 bits (1211), Expect = 3.744e-162
Identity = 230/465 (49.46%), Postives = 309/465 (66.45%), Query Frame = 3
Query:  315 ENKTISTRRSTSFIFGVNDNV---KGLVRVLEIFEKFRVSVIHIETRKSLKNKSKFEIFIDVDCRKDEIKSLIECLQQKIDDDFHVQEVDMISSNINGIRIDTFDLAASEIGEQNIQLKNKKPGMTVDNLPWFPKYIKDLDKISNRVIMYGSELDADHPGFKDEVYRLRRNQFSEIAYSYKHGNPIPKIEYTNEEIKTWGNVYRELTKLYPTHACREFLQNLPLLQKYCGYREDNIPQLEDVSQFLKSRSGFTLRPVAGYLSSRDFLAGLAFRVFHCTQYIRHPSDPFYTPEPDCCHELMGHVPLLADSSFAQFSQEIGLASLGASEDEVQRLATCYFFTIEFGLCHQDGELRAYGAGLLSSIGELKHALSNESNIQKFDPKTVMEQECLVTTFQNAYFFTTSFEDAKDKMREFAKTIKKPFDVHYNPYTQMIETLDSTDSLTNVIDNIKGELATITNALRKFNI 1700
            E   I   R+T  +F   D+      L  +L IF+K  ++++HIE+R SL+    +E F++ D +   +   IE ++++              S  N I  D  D A +                    +PWFP+ I+DLD+ +N+++ YGSELDADHPGF D  YR RR  F++IAY+YKHG P+P ++YT EEI+TWG ++R LTKLY THACRE+    PLL   CG+REDNIPQLEDVS FL+  +GFTLRPVAG LSSRDFLAGLAFRVFH TQYIRHPS P YTPEPD CHELMGHVPL AD +FAQFSQEIGLASLGA +D +++L+T ++FT+E+G+C Q+GEL+AYGAGLLSS GEL++ L+++  ++ F+P+     +  +T FQ  Y+   SFE AK+K  +FA +I +PF V YN YTQ +E LDS   ++N++DNI  E   + NA+ K  +
Sbjct:   17 EGVDIKEARNTCLLFSPKDSSLSSGALANILAIFKKHDINLVHIESRSSLRVPG-YEFFVEADGKSGALGKAIEDVKEQ-------------CSYFNIISRDYKDNATA--------------------VPWFPRRIRDLDRFANQILSYGSELDADHPGFTDPEYRKRRKYFADIAYNYKHGEPLPHVDYTKEEIETWGIIFRNLTKLYKTHACREYNHVFPLLVDNCGFREDNIPQLEDVSNFLRDCTGFTLRPVAGLLSSRDFLAGLAFRVFHSTQYIRHPSKPMYTPEPDVCHELMGHVPLFADPAFAQFSQEIGLASLGAPDDYIEKLSTIFWFTVEYGVCRQEGELKAYGAGLLSSYGELEYCLTDKPQLKDFEPEVTGVTKYPITQFQPLYYVADSFETAKEKTIKFANSIPRPFGVRYNAYTQSVEVLDSKPQISNLMDNINSEFQILQNAVAKLRV 447          
BLAST of tph vs. Ensembl Fly
Match: Hn (gene:FBgn0001208 transcript:FBtr0334645)

HSP 1 Score: 471.085 bits (1211), Expect = 4.593e-162
Identity = 230/465 (49.46%), Postives = 309/465 (66.45%), Query Frame = 3
Query:  315 ENKTISTRRSTSFIFGVNDNV---KGLVRVLEIFEKFRVSVIHIETRKSLKNKSKFEIFIDVDCRKDEIKSLIECLQQKIDDDFHVQEVDMISSNINGIRIDTFDLAASEIGEQNIQLKNKKPGMTVDNLPWFPKYIKDLDKISNRVIMYGSELDADHPGFKDEVYRLRRNQFSEIAYSYKHGNPIPKIEYTNEEIKTWGNVYRELTKLYPTHACREFLQNLPLLQKYCGYREDNIPQLEDVSQFLKSRSGFTLRPVAGYLSSRDFLAGLAFRVFHCTQYIRHPSDPFYTPEPDCCHELMGHVPLLADSSFAQFSQEIGLASLGASEDEVQRLATCYFFTIEFGLCHQDGELRAYGAGLLSSIGELKHALSNESNIQKFDPKTVMEQECLVTTFQNAYFFTTSFEDAKDKMREFAKTIKKPFDVHYNPYTQMIETLDSTDSLTNVIDNIKGELATITNALRKFNI 1700
            E   I   R+T  +F   D+      L  +L IF+K  ++++HIE+R SL+    +E F++ D +   +   IE ++++              S  N I  D  D A +                    +PWFP+ I+DLD+ +N+++ YGSELDADHPGF D  YR RR  F++IAY+YKHG P+P ++YT EEI+TWG ++R LTKLY THACRE+    PLL   CG+REDNIPQLEDVS FL+  +GFTLRPVAG LSSRDFLAGLAFRVFH TQYIRHPS P YTPEPD CHELMGHVPL AD +FAQFSQEIGLASLGA +D +++L+T ++FT+E+G+C Q+GEL+AYGAGLLSS GEL++ L+++  ++ F+P+     +  +T FQ  Y+   SFE AK+K  +FA +I +PF V YN YTQ +E LDS   ++N++DNI  E   + NA+ K  +
Sbjct:   22 EGVDIKEARNTCLLFSPKDSSLSSGALANILAIFKKHDINLVHIESRSSLRVPG-YEFFVEADGKSGALGKAIEDVKEQ-------------CSYFNIISRDYKDNATA--------------------VPWFPRRIRDLDRFANQILSYGSELDADHPGFTDPEYRKRRKYFADIAYNYKHGEPLPHVDYTKEEIETWGIIFRNLTKLYKTHACREYNHVFPLLVDNCGFREDNIPQLEDVSNFLRDCTGFTLRPVAGLLSSRDFLAGLAFRVFHSTQYIRHPSKPMYTPEPDVCHELMGHVPLFADPAFAQFSQEIGLASLGAPDDYIEKLSTIFWFTVEYGVCRQEGELKAYGAGLLSSYGELEYCLTDKPQLKDFEPEVTGVTKYPITQFQPLYYVADSFETAKEKTIKFANSIPRPFGVRYNAYTQSVEVLDSKPQISNLMDNINSEFQILQNAVAKLRV 452          
BLAST of tph vs. Ensembl Fly
Match: Hn (gene:FBgn0001208 transcript:FBtr0076811)

HSP 1 Score: 471.085 bits (1211), Expect = 4.593e-162
Identity = 230/465 (49.46%), Postives = 309/465 (66.45%), Query Frame = 3
Query:  315 ENKTISTRRSTSFIFGVNDNV---KGLVRVLEIFEKFRVSVIHIETRKSLKNKSKFEIFIDVDCRKDEIKSLIECLQQKIDDDFHVQEVDMISSNINGIRIDTFDLAASEIGEQNIQLKNKKPGMTVDNLPWFPKYIKDLDKISNRVIMYGSELDADHPGFKDEVYRLRRNQFSEIAYSYKHGNPIPKIEYTNEEIKTWGNVYRELTKLYPTHACREFLQNLPLLQKYCGYREDNIPQLEDVSQFLKSRSGFTLRPVAGYLSSRDFLAGLAFRVFHCTQYIRHPSDPFYTPEPDCCHELMGHVPLLADSSFAQFSQEIGLASLGASEDEVQRLATCYFFTIEFGLCHQDGELRAYGAGLLSSIGELKHALSNESNIQKFDPKTVMEQECLVTTFQNAYFFTTSFEDAKDKMREFAKTIKKPFDVHYNPYTQMIETLDSTDSLTNVIDNIKGELATITNALRKFNI 1700
            E   I   R+T  +F   D+      L  +L IF+K  ++++HIE+R SL+    +E F++ D +   +   IE ++++              S  N I  D  D A +                    +PWFP+ I+DLD+ +N+++ YGSELDADHPGF D  YR RR  F++IAY+YKHG P+P ++YT EEI+TWG ++R LTKLY THACRE+    PLL   CG+REDNIPQLEDVS FL+  +GFTLRPVAG LSSRDFLAGLAFRVFH TQYIRHPS P YTPEPD CHELMGHVPL AD +FAQFSQEIGLASLGA +D +++L+T ++FT+E+G+C Q+GEL+AYGAGLLSS GEL++ L+++  ++ F+P+     +  +T FQ  Y+   SFE AK+K  +FA +I +PF V YN YTQ +E LDS   ++N++DNI  E   + NA+ K  +
Sbjct:   22 EGVDIKEARNTCLLFSPKDSSLSSGALANILAIFKKHDINLVHIESRSSLRVPG-YEFFVEADGKSGALGKAIEDVKEQ-------------CSYFNIISRDYKDNATA--------------------VPWFPRRIRDLDRFANQILSYGSELDADHPGFTDPEYRKRRKYFADIAYNYKHGEPLPHVDYTKEEIETWGIIFRNLTKLYKTHACREYNHVFPLLVDNCGFREDNIPQLEDVSNFLRDCTGFTLRPVAGLLSSRDFLAGLAFRVFHSTQYIRHPSKPMYTPEPDVCHELMGHVPLFADPAFAQFSQEIGLASLGAPDDYIEKLSTIFWFTVEYGVCRQEGELKAYGAGLLSSYGELEYCLTDKPQLKDFEPEVTGVTKYPITQFQPLYYVADSFETAKEKTIKFANSIPRPFGVRYNAYTQSVEVLDSKPQISNLMDNINSEFQILQNAVAKLRV 452          
BLAST of tph vs. Ensembl Fly
Match: ple (gene:FBgn0005626 transcript:FBtr0076956)

HSP 1 Score: 400.979 bits (1029), Expect = 6.952e-134
Identity = 190/477 (39.83%), Postives = 296/477 (62.05%), Query Frame = 3
Query:  264 DFEIIKGELFDLNIVMEENKTISTRRSTSFIFGVNDNVKGLVRVLEIFEKFRVSVIHIETRKSLKNKSKFEIFIDVDCRKDEIKSLIECLQQKIDDDFHVQEVDMISSNINGIRIDTFDLAASEIGEQNIQLKNKKPGMTVDNLPWFPKYIKDLDKISNRVIMYGSELDADHPGFKDEVYRLRRNQFSEIAYSYKHGNPIPKIEYTNEEIKTWGNVYRELTKLYPTHACREFLQNLPLLQKYCGYREDNIPQLEDVSQFLKSRSGFTLRPVAGYLSSRDFLAGLAFRVFHCTQYIRHPSDPFYTPEPDCCHELMGHVPLLADSSFAQFSQEIGLASLGASEDEVQRLATCYFFTIEFGLCHQDGELRAYGAGLLSSIGELKHALSNESNIQKFDPKTVMEQECLVTTFQNAYFFTTSFEDAKDKMREFAKTIKKPFDVHYNPYTQMIETLDSTDSLTNVIDNIKGELATITNALRKF 1694
            D+ + + E+   N   E +   +  +S + +  + + +  L R+L+  E F  +V H+E+R+S       ++ I +D  +  +  LI  L+Q              S + + + +         + + N+ +K           PWFPK+  +LD  ++ +  Y  +LD +HPGF D+VYR RR + +EIA++YK+G+PIP I+Y++ E+KTW +V++ +  L P HAC E+      LQ    + E  +PQL+++S FL+  +GF+LRP AG L++RDFLA LAFR+F  TQY+RH + P++TPEPD  HEL+GH+PLLAD SFAQFSQEIGLASLGAS++E+++L+T Y+FT+EFGLC + G+++AYGAGLLSS GEL HA+S++   + F+P +   Q      +Q  Y+   SFEDAKDK R +  T+ +PF+V +NP+T+ +E LDS D L  ++  +  E+  +TNA+ K 
Sbjct:   61 DYGLTEDEILLANAASESSDAEAAMQSAALVVRLKEGISSLGRILKAIETFHGTVQHVESRQSRVEGVDHDVLIKLDMTRGNLLQLIRSLRQ--------------SGSFSSMNL---------MADNNLNVKA----------PWFPKHASELDNCNHLMTKYEPDLDMNHPGFADKVYRQRRKEIAEIAFAYKYGDPIPFIDYSDVEVKTWRSVFKTVQDLAPKHACAEYRAAFQKLQDEQIFVETRLPQLQEMSDFLRKNTGFSLRPAAGLLTARDFLASLAFRIFQSTQYVRHVNSPYHTPEPDSIHELLGHMPLLADPSFAQFSQEIGLASLGASDEEIEKLSTVYWFTVEFGLCKEHGQIKAYGAGLLSSYGELLHAISDKCEHRAFEPASTAVQPYQDQEYQPIYYVAESFEDAKDKFRRWVSTMSRPFEVRFNPHTERVEVLDSVDKLETLVHQMNTEILHLTNAISKL 504          
BLAST of tph vs. Ensembl Zebrafish
Match: tph1a (tryptophan hydroxylase 1 (tryptophan 5-monooxygenase) a [Source:ZFIN;Acc:ZDB-GENE-030317-1])

HSP 1 Score: 583.563 bits (1503), Expect = 0.000e+0
Identity = 274/467 (58.67%), Postives = 350/467 (74.95%), Query Frame = 3
Query:  309 MEENKTISTRRS----TSFIFGVNDNVKGLVRVLEIFEKFRVSVIHIETRKSLKNKSKFEIFIDVDCRKDEIKSLIECLQQKIDDDFHVQEVDMISSNINGIRIDTFDLAASEIGEQNIQLKNKKPGMTVDNLPWFPKYIKDLDKISNRVIMYGSELDADHPGFKDEVYRLRRNQFSEIAYSYKHGNPIPKIEYTNEEIKTWGNVYRELTKLYPTHACREFLQNLPLLQKYCGYREDNIPQLEDVSQFLKSRSGFTLRPVAGYLSSRDFLAGLAFRVFHCTQYIRHPSDPFYTPEPDCCHELMGHVPLLADSSFAQFSQEIGLASLGASEDEVQRLATCYFFTIEFGLCHQDGELRAYGAGLLSSIGELKHALSNESNIQKFDPKTVMEQECLVTTFQNAYFFTTSFEDAKDKMREFAKTIKKPFDVHYNPYTQMIETLDSTDSLTNVIDNIKGELATITNALRKFN 1697
            +EENK   T  S     + +F + + V GLV+ L++F++  V+++HIE+RKS +  S+FEIF+D D  ++++  +I+ L++                ++N + +D  D    E  E             ++N+PWFPK I DLDK +NRV+MYGS+LDADHPGFKD VYR RR  F+++A SYKHG+PIP+IE+T EE+KTWG V+REL KLYP+HACRE+L+NLPLL K+C  REDNIPQLEDVS+FLK R+GFT+RPVAGYLS RDFLAGLAFRVFHCTQY+RH SDP YTPEPD CHEL+GHVPLLA+ SFAQFSQEIGLASLGAS+D +Q+LATCYFFT+EFGLC Q+G+LRAYGAGLLSSI ELKHALS  + I  FDP    +QEC++TTFQ+ YF + SFE+AK KMREFAKTIK+PF V YNPYTQ ++ L  T S+ NV++ ++ EL  I +AL + N
Sbjct:   41 IEENKDNKTESSETGRAAVVFSLKNEVGGLVKALKLFQENHVNLVHIESRKSKRRNSEFEIFVDCDSNREQLHEIIQLLRK----------------HVNVVEMDAPDNRLPEESE-------------MENVPWFPKKISDLDKCANRVLMYGSDLDADHPGFKDNVYRKRRKYFADLAMSYKHGDPIPRIEFTEEEVKTWGVVFRELNKLYPSHACREYLKNLPLLIKHCDSREDNIPQLEDVSRFLKERTGFTIRPVAGYLSPRDFLAGLAFRVFHCTQYVRHSSDPLYTPEPDTCHELLGHVPLLAEPSFAQFSQEIGLASLGASDDSIQKLATCYFFTVEFGLCKQEGKLRAYGAGLLSSISELKHALSGNARILPFDPNVTCKQECIITTFQDVYFMSDSFEEAKVKMREFAKTIKRPFSVRYNPYTQSVDVLKDTTSINNVVEELRHELDIIGDALSRLN 478          
BLAST of tph vs. Ensembl Zebrafish
Match: tph1a (tryptophan hydroxylase 1 (tryptophan 5-monooxygenase) a [Source:ZFIN;Acc:ZDB-GENE-030317-1])

HSP 1 Score: 583.563 bits (1503), Expect = 0.000e+0
Identity = 274/467 (58.67%), Postives = 350/467 (74.95%), Query Frame = 3
Query:  309 MEENKTISTRRS----TSFIFGVNDNVKGLVRVLEIFEKFRVSVIHIETRKSLKNKSKFEIFIDVDCRKDEIKSLIECLQQKIDDDFHVQEVDMISSNINGIRIDTFDLAASEIGEQNIQLKNKKPGMTVDNLPWFPKYIKDLDKISNRVIMYGSELDADHPGFKDEVYRLRRNQFSEIAYSYKHGNPIPKIEYTNEEIKTWGNVYRELTKLYPTHACREFLQNLPLLQKYCGYREDNIPQLEDVSQFLKSRSGFTLRPVAGYLSSRDFLAGLAFRVFHCTQYIRHPSDPFYTPEPDCCHELMGHVPLLADSSFAQFSQEIGLASLGASEDEVQRLATCYFFTIEFGLCHQDGELRAYGAGLLSSIGELKHALSNESNIQKFDPKTVMEQECLVTTFQNAYFFTTSFEDAKDKMREFAKTIKKPFDVHYNPYTQMIETLDSTDSLTNVIDNIKGELATITNALRKFN 1697
            +EENK   T  S     + +F + + V GLV+ L++F++  V+++HIE+RKS +  S+FEIF+D D  ++++  +I+ L++                ++N + +D  D    E  E             ++N+PWFPK I DLDK +NRV+MYGS+LDADHPGFKD VYR RR  F+++A SYKHG+PIP+IE+T EE+KTWG V+REL KLYP+HACRE+L+NLPLL K+C  REDNIPQLEDVS+FLK R+GFT+RPVAGYLS RDFLAGLAFRVFHCTQY+RH SDP YTPEPD CHEL+GHVPLLA+ SFAQFSQEIGLASLGAS+D +Q+LATCYFFT+EFGLC Q+G+LRAYGAGLLSSI ELKHALS  + I  FDP    +QEC++TTFQ+ YF + SFE+AK KMREFAKTIK+PF V YNPYTQ ++ L  T S+ NV++ ++ EL  I +AL + N
Sbjct:   41 IEENKDNKTESSETGRAAVVFSLKNEVGGLVKALKLFQENHVNLVHIESRKSKRRNSEFEIFVDCDSNREQLHEIIQLLRK----------------HVNVVEMDAPDNRLPEESE-------------MENVPWFPKKISDLDKCANRVLMYGSDLDADHPGFKDNVYRKRRKYFADLAMSYKHGDPIPRIEFTEEEVKTWGVVFRELNKLYPSHACREYLKNLPLLIKHCDSREDNIPQLEDVSRFLKERTGFTIRPVAGYLSPRDFLAGLAFRVFHCTQYVRHSSDPLYTPEPDTCHELLGHVPLLAEPSFAQFSQEIGLASLGASDDSIQKLATCYFFTVEFGLCKQEGKLRAYGAGLLSSISELKHALSGNARILPFDPNVTCKQECIITTFQDVYFMSDSFEEAKVKMREFAKTIKRPFSVRYNPYTQSVDVLKDTTSINNVVEELRHELDIIGDALSRLN 478          
BLAST of tph vs. Ensembl Zebrafish
Match: tph2 (tryptophan hydroxylase 2 (tryptophan 5-monooxygenase) [Source:ZFIN;Acc:ZDB-GENE-040624-4])

HSP 1 Score: 572.007 bits (1473), Expect = 0.000e+0
Identity = 272/468 (58.12%), Postives = 348/468 (74.36%), Query Frame = 3
Query:  312 EENKTISTRRSTSFIFGVNDNVKGLVRVLEIFEKFRVSVIHIETRKSLKNKSKFEIFIDVDCRKDEIKSLIECLQQKIDDDFHVQEVDMISSN----INGIRIDTFDLAASEIGEQNIQLKNKKPGMTVDNLPWFPKYIKDLDKISNRVIMYGSELDADHPGFKDEVYRLRRNQFSEIAYSYKHGNPIPKIEYTNEEIKTWGNVYRELTKLYPTHACREFLQNLPLLQKYCGYREDNIPQLEDVSQFLKSRSGFTLRPVAGYLSSRDFLAGLAFRVFHCTQYIRHPSDPFYTPEPDCCHELMGHVPLLADSSFAQFSQEIGLASLGASEDEVQRLATCYFFTIEFGLCHQDGELRAYGAGLLSSIGELKHALSNESNIQKFDPKTVMEQECLVTTFQNAYFFTTSFEDAKDKMREFAKTIKKPFDVHYNPYTQMIETLDSTDSLTNVIDNIKGELATITNALRKFNIF 1703
            EE K+       + IF + + V  LV+ L +F++  V++ HIE+R+S +  ++ EI+ + +C K E   L++ L+           V+++S N    +     D  D      G  +            + +PWFP+ I +LD+ S+RV+MYGSELDADHPGFKD+VYR RR  F E+A +YK G PIP+IEYT EE+KTWG VYRELTKLYPTHACRE+L+NLPLL K+CGYREDNIPQLEDVS FL+ RSGFT+RPVAGYLS RDFLAGLA+RVF+CTQYIRH +DP YTPEPD CHEL+GHVPLLAD  FAQFSQEIGLASLGAS+++VQ+LATCYFFTIEFGLC QDG+LR YGAGLLSSIGEL+HALS+++ ++ FDPKT   QECL+TTFQ+ YF + SFE+AK+KMREFAK+IK+PF V+YNPYTQ I+ L  T S+ NV+ +++ +L T+ +AL K N +
Sbjct:   50 EEQKSTHDLGKLAVIFSLKNEVGYLVKALRLFQEKHVNLAHIESRRSKRLTNEIEIYAECNCTKKEFNELVQHLKD---------HVNIVSYNTPQHVWSAETDCLDCVCVLGGLPD-----------GEGIPWFPQKISELDQCSHRVLMYGSELDADHPGFKDKVYRQRRKYFVEVAMNYKFGQPIPRIEYTAEEVKTWGVVYRELTKLYPTHACREYLKNLPLLTKHCGYREDNIPQLEDVSLFLRERSGFTVRPVAGYLSPRDFLAGLAYRVFNCTQYIRHSTDPLYTPEPDTCHELLGHVPLLADPKFAQFSQEIGLASLGASDEDVQKLATCYFFTIEFGLCKQDGQLRVYGAGLLSSIGELRHALSDKATVKVFDPKTTCYQECLITTFQDVYFVSESFEEAKEKMREFAKSIKRPFSVYYNPYTQSIDLLKDTRSIENVVQDLRSDLTTVCDALGKMNKY 497          
BLAST of tph vs. Ensembl Zebrafish
Match: tph2 (tryptophan hydroxylase 2 (tryptophan 5-monooxygenase) [Source:ZFIN;Acc:ZDB-GENE-040624-4])

HSP 1 Score: 571.622 bits (1472), Expect = 0.000e+0
Identity = 272/468 (58.12%), Postives = 348/468 (74.36%), Query Frame = 3
Query:  312 EENKTISTRRSTSFIFGVNDNVKGLVRVLEIFEKFRVSVIHIETRKSLKNKSKFEIFIDVDCRKDEIKSLIECLQQKIDDDFHVQEVDMISSN----INGIRIDTFDLAASEIGEQNIQLKNKKPGMTVDNLPWFPKYIKDLDKISNRVIMYGSELDADHPGFKDEVYRLRRNQFSEIAYSYKHGNPIPKIEYTNEEIKTWGNVYRELTKLYPTHACREFLQNLPLLQKYCGYREDNIPQLEDVSQFLKSRSGFTLRPVAGYLSSRDFLAGLAFRVFHCTQYIRHPSDPFYTPEPDCCHELMGHVPLLADSSFAQFSQEIGLASLGASEDEVQRLATCYFFTIEFGLCHQDGELRAYGAGLLSSIGELKHALSNESNIQKFDPKTVMEQECLVTTFQNAYFFTTSFEDAKDKMREFAKTIKKPFDVHYNPYTQMIETLDSTDSLTNVIDNIKGELATITNALRKFNIF 1703
            EE K+       + IF + + V  LV+ L +F++  V++ HIE+R+S +  ++ EI+ + +C K E   L++ L+           V+++S N    +     D  D      G  +            + +PWFP+ I +LD+ S+RV+MYGSELDADHPGFKD+VYR RR  F E+A +YK G PIP+IEYT EE+KTWG VYRELTKLYPTHACRE+L+NLPLL K+CGYREDNIPQLEDVS FL+ RSGFT+RPVAGYLS RDFLAGLA+RVF+CTQYIRH +DP YTPEPD CHEL+GHVPLLAD  FAQFSQEIGLASLGAS+++VQ+LATCYFFTIEFGLC QDG+LR YGAGLLSSIGEL+HALS+++ ++ FDPKT   QECL+TTFQ+ YF + SFE+AK+KMREFAK+IK+PF V+YNPYTQ I+ L  T S+ NV+ +++ +L T+ +AL K N +
Sbjct:   50 EEQKSTHDLGKLAVIFSLKNEVGFLVKALRLFQEKHVNLAHIESRRSKRLTNEIEIYAECNCTKKEFNELVQHLKD---------HVNIVSYNTPQHVWSAETDCLDCVCVLGGLPD-----------GEGIPWFPQKISELDQCSHRVLMYGSELDADHPGFKDKVYRQRRKYFVEVAMNYKFGQPIPRIEYTAEEVKTWGVVYRELTKLYPTHACREYLKNLPLLTKHCGYREDNIPQLEDVSLFLRERSGFTVRPVAGYLSPRDFLAGLAYRVFNCTQYIRHSTDPLYTPEPDTCHELLGHVPLLADPKFAQFSQEIGLASLGASDEDVQKLATCYFFTIEFGLCKQDGQLRVYGAGLLSSIGELRHALSDKATVKVFDPKTTCYQECLITTFQDVYFVSESFEEAKEKMREFAKSIKRPFSVYYNPYTQSIDLLKDTRSIENVVQDLRSDLTTVCDALGKMNKY 497          
BLAST of tph vs. Ensembl Zebrafish
Match: tph2 (tryptophan hydroxylase 2 (tryptophan 5-monooxygenase) [Source:ZFIN;Acc:ZDB-GENE-040624-4])

HSP 1 Score: 570.081 bits (1468), Expect = 0.000e+0
Identity = 272/468 (58.12%), Postives = 348/468 (74.36%), Query Frame = 3
Query:  312 EENKTISTRRSTSFIFGVNDNVKGLVRVLEIFEKFRVSVIHIETRKSLKNKSKFEIFIDVDCRKDEIKSLIECLQQKIDDDFHVQEVDMISSN----INGIRIDTFDLAASEIGEQNIQLKNKKPGMTVDNLPWFPKYIKDLDKISNRVIMYGSELDADHPGFKDEVYRLRRNQFSEIAYSYKHGNPIPKIEYTNEEIKTWGNVYRELTKLYPTHACREFLQNLPLLQKYCGYREDNIPQLEDVSQFLKSRSGFTLRPVAGYLSSRDFLAGLAFRVFHCTQYIRHPSDPFYTPEPDCCHELMGHVPLLADSSFAQFSQEIGLASLGASEDEVQRLATCYFFTIEFGLCHQDGELRAYGAGLLSSIGELKHALSNESNIQKFDPKTVMEQECLVTTFQNAYFFTTSFEDAKDKMREFAKTIKKPFDVHYNPYTQMIETLDSTDSLTNVIDNIKGELATITNALRKFNIF 1703
            EE K+       + IF + + V  LV+ L +F++  V++ HIE+R+S +  ++ EI+ + +C K E   L++ L+           V+++S N    +     D  D      G  +            + +PWFP+ I +LD+ S+RV+MYGSELDADHPGFKD+VYR RR  F E+A +YK G PIP+IEYT EE+KTWG VYRELTKLYPTHACRE+L+NLPLL K+CGYREDNIPQLEDVS FL+ RSGFT+RPVAGYLS RDFLAGLA+RVF+CTQYIRH +DP YTPEPD CHEL+GHVPLLAD  FAQFSQEIGLASLGAS+++VQ+LATCYFFTIEFGLC QDG+LR YGAGLLSSIGEL+HALS+++ ++ FDPKT   QECL+TTFQ+ YF + SFE+AK+KMREFAK+IK+PF V+YNPYTQ I+ L  T S+ NV+ +++ +L T+ +AL K N +
Sbjct:   23 EEQKSTHDLGKLAVIFSLKNEVGFLVKALRLFQEKHVNLAHIESRRSKRLTNEIEIYAECNCTKKEFNELVQHLKD---------HVNIVSYNTPQHVWSAETDCLDCVCVLGGLPD-----------GEGIPWFPQKISELDQCSHRVLMYGSELDADHPGFKDKVYRQRRKYFVEVAMNYKFGQPIPRIEYTAEEVKTWGVVYRELTKLYPTHACREYLKNLPLLTKHCGYREDNIPQLEDVSLFLRERSGFTVRPVAGYLSPRDFLAGLAYRVFNCTQYIRHSTDPLYTPEPDTCHELLGHVPLLADPKFAQFSQEIGLASLGASDEDVQKLATCYFFTIEFGLCKQDGQLRVYGAGLLSSIGELRHALSDKATVKVFDPKTTCYQECLITTFQDVYFVSESFEEAKEKMREFAKSIKRPFSVYYNPYTQSIDLLKDTRSIENVVQDLRSDLTTVCDALGKMNKY 470          
BLAST of tph vs. Ensembl Xenopus
Match: TPH2 (tryptophan hydroxylase 2 [Source:NCBI gene;Acc:100486097])

HSP 1 Score: 573.548 bits (1477), Expect = 0.000e+0
Identity = 275/475 (57.89%), Postives = 359/475 (75.58%), Query Frame = 3
Query:  297 LNIV-MEENKTISTRRS-----TSFIFGVNDNVKGLVRVLEIFEKFRVSVIHIETRKSLKNKSKFEIFIDVDCRKDEIKSLIECLQQKIDDDFHVQEVDMISSNINGIRIDTFDLAASEIGEQNIQLKNKKPGMTVDNLPWFPKYIKDLDKISNRVIMYGSELDADHPGFKDEVYRLRRNQFSEIAYSYKHGNPIPKIEYTNEEIKTWGNVYRELTKLYPTHACREFLQNLPLLQKYCGYREDNIPQLEDVSQFLKSRSGFTLRPVAGYLSSRDFLAGLAFRVFHCTQYIRHPSDPFYTPEPDCCHELMGHVPLLADSSFAQFSQEIGLASLGASEDEVQRLATCYFFTIEFGLCHQDGELRAYGAGLLSSIGELKHALSNESNIQKFDPKTVMEQECLVTTFQNAYFFTTSFEDAKDKMREFAKTIKKPFDVHYNPYTQMIETLDSTDSLTNVIDNIKGELATITNALRKFNIF 1703
            LN++ ++ENK   T  +     T+ I  + + V GL++ L+IF++  V++IHIE+RKS  NKS+ +++++ +C K + + L   L+          +  +IS N               I  ++ +L         + + WFP+ I +LDK SNRV+MYGSELDADHPGFKD VYR RR  F ++A  YK+G PIP++EYT EEIKTWG V++ELTKLYPTHAC+E+L+NLPLL KYCGYREDN+PQLEDV+ FLK RSGFT+RPVAGYLS RDFLAGLA+RVFHCTQYIRH SDP YTPEPD CHEL+GHVPLLAD  FAQFSQEIGLASLGAS+++VQ+LATCYFFTIEFGLC QDG+LRAYGAGLLSSIGELKHALS+++ ++ FDPKT   QEC++TTFQ++YF + SF++AK+KMREFAK+I +PF V++NPYTQ IE  ++T S+ NVI +++ +L T+++AL K N +
Sbjct:   37 LNVLRIDENKCSKTEATAETERTAVILTMKNEVGGLLQNLKIFKEKYVNIIHIESRKSKGNKSEVDMYVEFECTKKKCQELQHLLKL---------QSGIISVN-----------PVERIWRKDEEL---------EGVLWFPRKISELDKCSNRVLMYGSELDADHPGFKDNVYRQRRKYFVDVAMDYKYGQPIPRVEYTAEEIKTWGTVFKELTKLYPTHACKEYLKNLPLLTKYCGYREDNVPQLEDVAIFLKERSGFTVRPVAGYLSPRDFLAGLAYRVFHCTQYIRHGSDPLYTPEPDTCHELLGHVPLLADPKFAQFSQEIGLASLGASDEDVQKLATCYFFTIEFGLCKQDGQLRAYGAGLLSSIGELKHALSDKAIVKTFDPKTTCLQECIITTFQDSYFVSESFDEAKEKMREFAKSINRPFSVYFNPYTQSIEIFNNTRSIENVIQDLRSDLNTVSDALAKMNKY 482          
BLAST of tph vs. Ensembl Xenopus
Match: taar2 (trace amine associated receptor 2 (gene/pseudogene) [Source:Xenbase;Acc:XB-GENE-961117])

HSP 1 Score: 551.977 bits (1421), Expect = 0.000e+0
Identity = 267/462 (57.79%), Postives = 341/462 (73.81%), Query Frame = 3
Query:  312 EENKTISTRRSTSFIFGVNDNVKGLVRVLEIFEKFRVSVIHIETRKSLKNKSKFEIFIDVDCRKDEIKSLIECLQQKIDDDFHVQEVDMISSNINGIRIDTFDLAASEIGEQNIQLKNKKPGMTVDNLPWFPKYIKDLDKISNRVIMYGSELDADHPGFKDEVYRLRRNQFSEIAYSYKHGNPIPKIEYTNEEIKTWGNVYRELTKLYPTHACREFLQNLPLLQKYCGYREDNIPQLEDVSQFLKSRSGFTLRPVAGYLSSRDFLAGLAFRVFHCTQYIRHPSDPFYTPEPDCCHELMGHVPLLADSSFAQFSQEIGLASLGASEDEVQRLATCYFFTIEFGLCHQDGELRAYGAGLLSSIGELKHALSNESNIQKFDPKTVMEQECLVTTFQNAYFFTTSFEDAKDKMREFAKTIKKPFDVHYNPYTQMIETLDSTDSLTNVIDNIKGELATITNALRKFN 1697
            E N  +  R   S IF + + + GLV+ L++F++  V++IHIE+RKS +  S+FEIF+D D  ++++  +   L+       HV  + M             + +  E G      KNK        +PWFPK I DLDK +NRV+MYGS+LDADHPGFKD VYR RR  F+++A SY++G+PIP+IE+T EEI+TWG V+REL KLYPTHACRE+L+NLPLL KYCGYREDNIPQLEDVS+FL+ R+GFT+RPVAGYLS RDFLAGLAFRVFHCTQY+RH SDP YTPEPD CHEL+GHVPLLA+ SFAQFSQEIGLASLGAS++ VQ+LATCYFFT+EFGLC Q+G+L+ YGAGLLSSI ELKH+LS  +  + FDP     QEC++T+FQ  YF + SFE+AK+KMREFAKTIK+PF + YNP+TQ ++ L  T S+  V+  ++ EL  + +AL K N
Sbjct:   20 EYNDNVCERGKASVIFSLKNEIGGLVKALKLFQEKHVNLIHIESRKSKRRNSEFEIFVDCDSNREQLNEIFHLLKP------HVSVISMSPPE---------NFSVEEDG------KNK-------GVPWFPKRISDLDKCANRVLMYGSDLDADHPGFKDNVYRKRRKYFADVAMSYRYGDPIPRIEFTEEEIETWGTVFRELNKLYPTHACREYLKNLPLLSKYCGYREDNIPQLEDVSRFLRERTGFTIRPVAGYLSPRDFLAGLAFRVFHCTQYVRHSSDPLYTPEPDTCHELLGHVPLLAEPSFAQFSQEIGLASLGASDEAVQKLATCYFFTVEFGLCKQEGKLKVYGAGLLSSISELKHSLSGNAKFKPFDPMVTCNQECIITSFQELYFVSESFEEAKEKMREFAKTIKRPFGLKYNPFTQSVDLLKDTKSIAMVVSELRHELDIVNDALNKMN 453          
BLAST of tph vs. Ensembl Xenopus
Match: taar2 (trace amine associated receptor 2 (gene/pseudogene) [Source:Xenbase;Acc:XB-GENE-961117])

HSP 1 Score: 551.592 bits (1420), Expect = 0.000e+0
Identity = 264/469 (56.29%), Postives = 341/469 (72.71%), Query Frame = 3
Query:  312 EENKTISTRRSTSFIFGVNDNVKGLVRVLEIFEKFRVSVIHIETRKSLKNKSKFEIFIDVDCRKDEIKSLIECLQQKID-------DDFHVQEVDMISSNINGIRIDTFDLAASEIGEQNIQLKNKKPGMTVDNLPWFPKYIKDLDKISNRVIMYGSELDADHPGFKDEVYRLRRNQFSEIAYSYKHGNPIPKIEYTNEEIKTWGNVYRELTKLYPTHACREFLQNLPLLQKYCGYREDNIPQLEDVSQFLKSRSGFTLRPVAGYLSSRDFLAGLAFRVFHCTQYIRHPSDPFYTPEPDCCHELMGHVPLLADSSFAQFSQEIGLASLGASEDEVQRLATCYFFTIEFGLCHQDGELRAYGAGLLSSIGELKHALSNESNIQKFDPKTVMEQECLVTTFQNAYFFTTSFEDAKDKMREFAKTIKKPFDVHYNPYTQMIETLDSTDSLTNVIDNIKGELATITNALRKFN 1697
            E N  +  R   S IF + + + GLV+ L++F++  V++IHIE+RKS +  S+FEIF+D D  ++++  +   L+  +        ++F V+E DM                                    +++PWFPK I DLDK +NRV+MYGS+LDADHPGFKD VYR RR  F+++A SY++G+PIP+IE+T EEI+TWG V+REL KLYPTHACRE+L+NLPLL KYCGYREDNIPQLEDVS+FL+ R+GFT+RPVAGYLS RDFLAGLAFRVFHCTQY+RH SDP YTPEPD CHEL+GHVPLLA+ SFAQFSQEIGLASLGAS++ VQ+LATCYFFT+EFGLC Q+G+L+ YGAGLLSSI ELKH+LS  +  + FDP     QEC++T+FQ  YF + SFE+AK+KMREFAKTIK+PF + YNP+TQ ++ L  T S+  V+  ++ EL  + +AL K N
Sbjct:   24 EYNDNVCERGKASVIFSLKNEIGGLVKALKLFQEKHVNLIHIESRKSKRRNSEFEIFVDCDSNREQLNEIFHLLKPHVSVISMSPPENFSVEEDDM------------------------------------ESVPWFPKRISDLDKCANRVLMYGSDLDADHPGFKDNVYRKRRKYFADVAMSYRYGDPIPRIEFTEEEIETWGTVFRELNKLYPTHACREYLKNLPLLSKYCGYREDNIPQLEDVSRFLRERTGFTIRPVAGYLSPRDFLAGLAFRVFHCTQYVRHSSDPLYTPEPDTCHELLGHVPLLAEPSFAQFSQEIGLASLGASDEAVQKLATCYFFTVEFGLCKQEGKLKVYGAGLLSSISELKHSLSGNAKFKPFDPMVTCNQECIITSFQELYFVSESFEEAKEKMREFAKTIKRPFGLKYNPFTQSVDLLKDTKSIAMVVSELRHELDIVNDALNKMN 456          
BLAST of tph vs. Ensembl Xenopus
Match: taar2 (trace amine associated receptor 2 (gene/pseudogene) [Source:Xenbase;Acc:XB-GENE-961117])

HSP 1 Score: 551.592 bits (1420), Expect = 0.000e+0
Identity = 264/469 (56.29%), Postives = 341/469 (72.71%), Query Frame = 3
Query:  312 EENKTISTRRSTSFIFGVNDNVKGLVRVLEIFEKFRVSVIHIETRKSLKNKSKFEIFIDVDCRKDEIKSLIECLQQKID-------DDFHVQEVDMISSNINGIRIDTFDLAASEIGEQNIQLKNKKPGMTVDNLPWFPKYIKDLDKISNRVIMYGSELDADHPGFKDEVYRLRRNQFSEIAYSYKHGNPIPKIEYTNEEIKTWGNVYRELTKLYPTHACREFLQNLPLLQKYCGYREDNIPQLEDVSQFLKSRSGFTLRPVAGYLSSRDFLAGLAFRVFHCTQYIRHPSDPFYTPEPDCCHELMGHVPLLADSSFAQFSQEIGLASLGASEDEVQRLATCYFFTIEFGLCHQDGELRAYGAGLLSSIGELKHALSNESNIQKFDPKTVMEQECLVTTFQNAYFFTTSFEDAKDKMREFAKTIKKPFDVHYNPYTQMIETLDSTDSLTNVIDNIKGELATITNALRKFN 1697
            E N  +  R   S IF + + + GLV+ L++F++  V++IHIE+RKS +  S+FEIF+D D  ++++  +   L+  +        ++F V+E DM                                    +++PWFPK I DLDK +NRV+MYGS+LDADHPGFKD VYR RR  F+++A SY++G+PIP+IE+T EEI+TWG V+REL KLYPTHACRE+L+NLPLL KYCGYREDNIPQLEDVS+FL+ R+GFT+RPVAGYLS RDFLAGLAFRVFHCTQY+RH SDP YTPEPD CHEL+GHVPLLA+ SFAQFSQEIGLASLGAS++ VQ+LATCYFFT+EFGLC Q+G+L+ YGAGLLSSI ELKH+LS  +  + FDP     QEC++T+FQ  YF + SFE+AK+KMREFAKTIK+PF + YNP+TQ ++ L  T S+  V+  ++ EL  + +AL K N
Sbjct:   57 EYNDNVCERGKASVIFSLKNEIGGLVKALKLFQEKHVNLIHIESRKSKRRNSEFEIFVDCDSNREQLNEIFHLLKPHVSVISMSPPENFSVEEDDM------------------------------------ESVPWFPKRISDLDKCANRVLMYGSDLDADHPGFKDNVYRKRRKYFADVAMSYRYGDPIPRIEFTEEEIETWGTVFRELNKLYPTHACREYLKNLPLLSKYCGYREDNIPQLEDVSRFLRERTGFTIRPVAGYLSPRDFLAGLAFRVFHCTQYVRHSSDPLYTPEPDTCHELLGHVPLLAEPSFAQFSQEIGLASLGASDEAVQKLATCYFFTVEFGLCKQEGKLKVYGAGLLSSISELKHSLSGNAKFKPFDPMVTCNQECIITSFQELYFVSESFEEAKEKMREFAKTIKRPFGLKYNPFTQSVDLLKDTKSIAMVVSELRHELDIVNDALNKMN 489          
BLAST of tph vs. Ensembl Xenopus
Match: taar2 (trace amine associated receptor 2 (gene/pseudogene) [Source:Xenbase;Acc:XB-GENE-961117])

HSP 1 Score: 551.592 bits (1420), Expect = 0.000e+0
Identity = 264/469 (56.29%), Postives = 341/469 (72.71%), Query Frame = 3
Query:  312 EENKTISTRRSTSFIFGVNDNVKGLVRVLEIFEKFRVSVIHIETRKSLKNKSKFEIFIDVDCRKDEIKSLIECLQQKID-------DDFHVQEVDMISSNINGIRIDTFDLAASEIGEQNIQLKNKKPGMTVDNLPWFPKYIKDLDKISNRVIMYGSELDADHPGFKDEVYRLRRNQFSEIAYSYKHGNPIPKIEYTNEEIKTWGNVYRELTKLYPTHACREFLQNLPLLQKYCGYREDNIPQLEDVSQFLKSRSGFTLRPVAGYLSSRDFLAGLAFRVFHCTQYIRHPSDPFYTPEPDCCHELMGHVPLLADSSFAQFSQEIGLASLGASEDEVQRLATCYFFTIEFGLCHQDGELRAYGAGLLSSIGELKHALSNESNIQKFDPKTVMEQECLVTTFQNAYFFTTSFEDAKDKMREFAKTIKKPFDVHYNPYTQMIETLDSTDSLTNVIDNIKGELATITNALRKFN 1697
            E N  +  R   S IF + + + GLV+ L++F++  V++IHIE+RKS +  S+FEIF+D D  ++++  +   L+  +        ++F V+E DM                                    +++PWFPK I DLDK +NRV+MYGS+LDADHPGFKD VYR RR  F+++A SY++G+PIP+IE+T EEI+TWG V+REL KLYPTHACRE+L+NLPLL KYCGYREDNIPQLEDVS+FL+ R+GFT+RPVAGYLS RDFLAGLAFRVFHCTQY+RH SDP YTPEPD CHEL+GHVPLLA+ SFAQFSQEIGLASLGAS++ VQ+LATCYFFT+EFGLC Q+G+L+ YGAGLLSSI ELKH+LS  +  + FDP     QEC++T+FQ  YF + SFE+AK+KMREFAKTIK+PF + YNP+TQ ++ L  T S+  V+  ++ EL  + +AL K N
Sbjct:   44 EYNDNVCERGKASVIFSLKNEIGGLVKALKLFQEKHVNLIHIESRKSKRRNSEFEIFVDCDSNREQLNEIFHLLKPHVSVISMSPPENFSVEEDDM------------------------------------ESVPWFPKRISDLDKCANRVLMYGSDLDADHPGFKDNVYRKRRKYFADVAMSYRYGDPIPRIEFTEEEIETWGTVFRELNKLYPTHACREYLKNLPLLSKYCGYREDNIPQLEDVSRFLRERTGFTIRPVAGYLSPRDFLAGLAFRVFHCTQYVRHSSDPLYTPEPDTCHELLGHVPLLAEPSFAQFSQEIGLASLGASDEAVQKLATCYFFTVEFGLCKQEGKLKVYGAGLLSSISELKHSLSGNAKFKPFDPMVTCNQECIITSFQELYFVSESFEEAKEKMREFAKTIKRPFGLKYNPFTQSVDLLKDTKSIAMVVSELRHELDIVNDALNKMN 476          
BLAST of tph vs. Ensembl Mouse
Match: Tph1 (tryptophan hydroxylase 1 [Source:MGI Symbol;Acc:MGI:98796])

HSP 1 Score: 582.793 bits (1501), Expect = 0.000e+0
Identity = 274/461 (59.44%), Postives = 351/461 (76.14%), Query Frame = 3
Query:  312 EENKTISTRRS-TSFIFGVNDNVKGLVRVLEIFEKFRVSVIHIETRKSLKNKSKFEIFIDVDCRKDEIKSLIECLQQKIDDDFHVQEVDMISSNINGIRIDTFDLAASEIGEQNIQLKNKKPGMTVDNLPWFPKYIKDLDKISNRVIMYGSELDADHPGFKDEVYRLRRNQFSEIAYSYKHGNPIPKIEYTNEEIKTWGNVYRELTKLYPTHACREFLQNLPLLQKYCGYREDNIPQLEDVSQFLKSRSGFTLRPVAGYLSSRDFLAGLAFRVFHCTQYIRHPSDPFYTPEPDCCHELMGHVPLLADSSFAQFSQEIGLASLGASEDEVQRLATCYFFTIEFGLCHQDGELRAYGAGLLSSIGELKHALSNESNIQKFDPKTVMEQECLVTTFQNAYFFTTSFEDAKDKMREFAKTIKKPFDVHYNPYTQMIETLDSTDSLTNVIDNIKGELATITNALRK 1691
            +ENK  S+ R   + IF + + V GL++VL+IF++  VS++HIE+RKS +  S+FEIF+D D  ++++  +   L+                S+   + +D+ D           QL  K+  M  + +PWFPK I DLD  +NRV++YGSELDADHPGFKD VYR RR  F+E+A +YKHG+PIPKIE+T EEIKTWG ++REL KLYPTHACRE+L+NLPLL KYCGYREDNIPQLEDVS FLK R+GF++RPVAGYLS RDFL+GLAFRVFHCTQY+RH SDP YTPEPD CHEL+GHVPLLA+ SFAQFSQEIGLASLGASE+ VQ+LATCYFFT+EFGLC QDG+LR +GAGLLSSI ELKHALS  + ++ FDPK   +QECL+T+FQ+ YF + SFEDAK+KMREFAKT+K+PF + YNPYTQ ++ L  T S+T+ ++ ++ +L  I++AL +
Sbjct:    9 KENKDHSSERGRVTLIFSLENEVGGLIKVLKIFQENHVSLLHIESRKSKQRNSEFEIFVDCDISREQLNDIFPLLK----------------SHATVLSVDSPD-----------QLTAKEDVM--ETVPWFPKKISDLDFCANRVLLYGSELDADHPGFKDNVYRRRRKYFAELAMNYKHGDPIPKIEFTEEEIKTWGTIFRELNKLYPTHACREYLRNLPLLSKYCGYREDNIPQLEDVSNFLKERTGFSIRPVAGYLSPRDFLSGLAFRVFHCTQYVRHSSDPLYTPEPDTCHELLGHVPLLAEPSFAQFSQEIGLASLGASEETVQKLATCYFFTVEFGLCKQDGQLRVFGAGLLSSISELKHALSGHAKVKPFDPKIACKQECLITSFQDVYFVSESFEDAKEKMREFAKTVKRPFGLKYNPYTQSVQVLRDTKSITSAMNELRYDLDVISDALAR 440          
BLAST of tph vs. Ensembl Mouse
Match: Tph1 (tryptophan hydroxylase 1 [Source:MGI Symbol;Acc:MGI:98796])

HSP 1 Score: 582.793 bits (1501), Expect = 0.000e+0
Identity = 274/461 (59.44%), Postives = 351/461 (76.14%), Query Frame = 3
Query:  312 EENKTISTRRS-TSFIFGVNDNVKGLVRVLEIFEKFRVSVIHIETRKSLKNKSKFEIFIDVDCRKDEIKSLIECLQQKIDDDFHVQEVDMISSNINGIRIDTFDLAASEIGEQNIQLKNKKPGMTVDNLPWFPKYIKDLDKISNRVIMYGSELDADHPGFKDEVYRLRRNQFSEIAYSYKHGNPIPKIEYTNEEIKTWGNVYRELTKLYPTHACREFLQNLPLLQKYCGYREDNIPQLEDVSQFLKSRSGFTLRPVAGYLSSRDFLAGLAFRVFHCTQYIRHPSDPFYTPEPDCCHELMGHVPLLADSSFAQFSQEIGLASLGASEDEVQRLATCYFFTIEFGLCHQDGELRAYGAGLLSSIGELKHALSNESNIQKFDPKTVMEQECLVTTFQNAYFFTTSFEDAKDKMREFAKTIKKPFDVHYNPYTQMIETLDSTDSLTNVIDNIKGELATITNALRK 1691
            +ENK  S+ R   + IF + + V GL++VL+IF++  VS++HIE+RKS +  S+FEIF+D D  ++++  +   L+                S+   + +D+ D           QL  K+  M  + +PWFPK I DLD  +NRV++YGSELDADHPGFKD VYR RR  F+E+A +YKHG+PIPKIE+T EEIKTWG ++REL KLYPTHACRE+L+NLPLL KYCGYREDNIPQLEDVS FLK R+GF++RPVAGYLS RDFL+GLAFRVFHCTQY+RH SDP YTPEPD CHEL+GHVPLLA+ SFAQFSQEIGLASLGASE+ VQ+LATCYFFT+EFGLC QDG+LR +GAGLLSSI ELKHALS  + ++ FDPK   +QECL+T+FQ+ YF + SFEDAK+KMREFAKT+K+PF + YNPYTQ ++ L  T S+T+ ++ ++ +L  I++AL +
Sbjct:    9 KENKDHSSERGRVTLIFSLENEVGGLIKVLKIFQENHVSLLHIESRKSKQRNSEFEIFVDCDISREQLNDIFPLLK----------------SHATVLSVDSPD-----------QLTAKEDVM--ETVPWFPKKISDLDFCANRVLLYGSELDADHPGFKDNVYRRRRKYFAELAMNYKHGDPIPKIEFTEEEIKTWGTIFRELNKLYPTHACREYLRNLPLLSKYCGYREDNIPQLEDVSNFLKERTGFSIRPVAGYLSPRDFLSGLAFRVFHCTQYVRHSSDPLYTPEPDTCHELLGHVPLLAEPSFAQFSQEIGLASLGASEETVQKLATCYFFTVEFGLCKQDGQLRVFGAGLLSSISELKHALSGHAKVKPFDPKIACKQECLITSFQDVYFVSESFEDAKEKMREFAKTVKRPFGLKYNPYTQSVQVLRDTKSITSAMNELRYDLDVISDALAR 440          
BLAST of tph vs. Ensembl Mouse
Match: Tph2 (tryptophan hydroxylase 2 [Source:MGI Symbol;Acc:MGI:2651811])

HSP 1 Score: 570.852 bits (1470), Expect = 0.000e+0
Identity = 273/465 (58.71%), Postives = 349/465 (75.05%), Query Frame = 3
Query:  312 EENKTISTRRS-TSFIFGVNDNVKGLVRVLEIFEKFRVSVIHIETRKSLKNKSKFEIFIDVDCRKDEIKSLIECLQQKIDDDFHVQEVDMISSNINGIRIDTFDLAASEIGEQNIQLKNKKPGMTVDNLPWFPKYIKDLDKISNRVIMYGSELDADHPGFKDEVYRLRRNQFSEIAYSYKHGNPIPKIEYTNEEIKTWGNVYRELTKLYPTHACREFLQNLPLLQKYCGYREDNIPQLEDVSQFLKSRSGFTLRPVAGYLSSRDFLAGLAFRVFHCTQYIRHPSDPFYTPEPDCCHELMGHVPLLADSSFAQFSQEIGLASLGASEDEVQRLATCYFFTIEFGLCHQDGELRAYGAGLLSSIGELKHALSNESNIQKFDPKTVMEQECLVTTFQNAYFFTTSFEDAKDKMREFAKTIKKPFDVHYNPYTQMIETLDSTDSLTNVIDNIKGELATITNALRKFNIF 1703
            E  K  +T  S T+ +F + + V GLV+ L +F++  V+++HIE+R+S +  S+ EIF+D +C K E   LI+ L+         Q   +  +    I  +  DL                     +++PWFP+ I +LD+ S+RV+MYG+ELDADHPGFKD VYR RR  F ++A  YK+G PIP++EYT EE KTWG V+REL+KLYPTHACRE+L+NLPLL KYCGYREDN+PQLEDVS FLK RSGFT+RPVAGYLS RDFLAGLA+RVFHCTQY+RH SDP YTPEPD CHEL+GHVPLLAD  FAQFSQEIGLASLGAS+++VQ+LATCYFFTIEFGLC Q+G+LRAYGAGLLSSIGELKHALS+++ ++ FDPKT   QECL+TTFQ+AYF + SFE+AK+KMR+FAK+I +PF V++NPYTQ IE L  T S+ NV+ +++ +L T+ +AL K N +
Sbjct:   50 EPGKGDTTESSKTAVVFSLKNEVGGLVKALRLFQEKHVNMLHIESRRSRRRSSEVEIFVDCECGKTEFNELIQLLK--------FQTTIVTLNPPESIWTEEEDL---------------------EDVPWFPRKISELDRCSHRVLMYGTELDADHPGFKDNVYRQRRKYFVDVAMGYKYGQPIPRVEYTEEETKTWGVVFRELSKLYPTHACREYLKNLPLLTKYCGYREDNVPQLEDVSMFLKERSGFTVRPVAGYLSPRDFLAGLAYRVFHCTQYVRHGSDPLYTPEPDTCHELLGHVPLLADPKFAQFSQEIGLASLGASDEDVQKLATCYFFTIEFGLCKQEGQLRAYGAGLLSSIGELKHALSDKACVKSFDPKTTCLQECLITTFQDAYFVSDSFEEAKEKMRDFAKSITRPFSVYFNPYTQSIEILKDTRSIENVVQDLRSDLNTVCDALNKMNQY 485          
BLAST of tph vs. Ensembl Mouse
Match: Pah (phenylalanine hydroxylase [Source:MGI Symbol;Acc:MGI:97473])

HSP 1 Score: 479.174 bits (1232), Expect = 5.043e-165
Identity = 234/450 (52.00%), Postives = 304/450 (67.56%), Query Frame = 3
Query:  342 STSFIFGVNDNVKGLVRVLEIFEKFRVSVIHIETRKSLKNKSKFEIFIDVDCRKDEIKSLIECLQQKIDDDFHVQEVDMISSNINGIRIDTFDLAASEIGEQNIQLKNKKPGMTVDNLPWFPKYIKDLDKISNRVIMYGSELDADHPGFKDEVYRLRRNQFSEIAYSYKHGNPIPKIEYTNEEIKTWGNVYRELTKLYPTHACREFLQNLPLLQKYCGYREDNIPQLEDVSQFLKSRSGFTLRPVAGYLSSRDFLAGLAFRVFHCTQYIRHPSDPFYTPEPDCCHELMGHVPLLADSSFAQFSQEIGLASLGASEDEVQRLATCYFFTIEFGLCHQDGELRAYGAGLLSSIGELKHALSNESNIQKFDPKTVMEQECLVTTFQNAYFFTTSFEDAKDKMREFAKTIKKPFDVHYNPYTQMIETLDSTDSLTNVIDNIKGELATITNALRK 1691
            + S IF + + V  L +VL +FE+  +++ HIE+R S  NK ++E F  +D R   +                      + S I  +R D        IG    +L   K   TV   PWFP+ I++LD+ +N+++ YG+ELDADHPGFKD VYR RR QF++IAY+Y+HG PIP++EYT EE KTWG V+R L  LY THAC E     PLL+KYCG+REDNIPQLEDVSQFL++ +GF LRPVAG LSSRDFL GLAFRVFHCTQYIRH S P YTPEPD CHEL+GHVPL +D SFAQFSQEIGLASLGA ++ +++LAT Y+FT+EFGLC +   ++AYGAGLLSS GEL++ LS++  +   + +    QE  VT FQ  Y+   SF DAK+K+R FA TI +PF V Y+PYTQ +E LD+T  L  + D+I  E+  + +AL+K
Sbjct:   34 AVSLIFSLKEEVGALAKVLRLFEENEINLTHIESRPSRLNKDEYEFFTYLDKRSKPV----------------------LGSIIKSLRND--------IGATVHELSRDKEKNTV---PWFPRTIQELDRFANQILSYGAELDADHPGFKDPVYRARRKQFADIAYNYRHGQPIPRVEYTEEERKTWGTVFRTLKALYKTHACYEHNHIFPLLEKYCGFREDNIPQLEDVSQFLQTCTGFRLRPVAGLLSSRDFLGGLAFRVFHCTQYIRHGSKPMYTPEPDICHELLGHVPLFSDRSFAQFSQEIGLASLGAPDEYIEKLATIYWFTVEFGLCKEGDSIKAYGAGLLSSFGELQYCLSDKPKLLPLELEKTACQEYTVTEFQPLYYVAESFNDAKEKVRTFAATIPRPFSVRYDPYTQRVEVLDNTQQLKILADSINSEVGILCHALQK 450          
BLAST of tph vs. Ensembl Mouse
Match: Th (tyrosine hydroxylase [Source:MGI Symbol;Acc:MGI:98735])

HSP 1 Score: 452.21 bits (1162), Expect = 6.358e-154
Identity = 215/437 (49.20%), Postives = 282/437 (64.53%), Query Frame = 3
Query:  384 LVRVLEIFEKFRVSVIHIETR---KSLKNKSKFEIFIDVDCRKDEIKSLIECLQQKIDDDFHVQEVDMISSNINGIRIDTFDLAASEIGEQNIQLKNKKPGMTVDNLPWFPKYIKDLDKISNRVIMYGSELDADHPGFKDEVYRLRRNQFSEIAYSYKHGNPIPKIEYTNEEIKTWGNVYRELTKLYPTHACREFLQNLPLLQKYCGYREDNIPQLEDVSQFLKSRSGFTLRPVAGYLSSRDFLAGLAFRVFHCTQYIRHPSDPFYTPEPDCCHELMGHVPLLADSSFAQFSQEIGLASLGASEDEVQRLATCYFFTIEFGLCHQDGELRAYGAGLLSSIGELKHALSNESNIQKFDPKTVMEQECLVTTFQNAYFFTTSFEDAKDKMREFAKTIKKPFDVHYNPYTQMIETLDSTDSLTNVIDNIKGELATITNAL 1685
            L R L++FE F   + H+ETR   + L      E F+  +    ++ +L+  +++  DD    +E                                       D +PWFP+ + +LDK  + V  +  +LD DHPGF D+ YR RR   +EIA+ YK G PIP +EYT EEI TW  VY  L  LY THACRE L+   LL++YCGYRED+IPQLEDVS FLK R+GF LRPVAG LS+RDFLA LAFRVF CTQYIRH S P ++PEPDCCHEL+GHVP+LAD +FAQFSQ+IGLASLGAS++E+++L+T Y+FT+EFGLC Q+GEL+AYGAGLLSS GEL H+LS E  ++ FDP T   Q     T+Q  YF + SF DAKDK+R +A  I++PF V ++PYT  I+ LDS  ++   ++ ++ EL T+T AL
Sbjct:   97 LSRALKVFETFEAKIHHLETRPAQRPLAGSPHLEYFVRFEVPSGDLAALLSSVRRVSDDVRSARE---------------------------------------DKVPWFPRKVSELDKCHHLVTKFDPDLDLDHPGFSDQAYRQRRKLIAEIAFQYKQGEPIPHVEYTKEEIATWKEVYATLKGLYATHACREHLEAFQLLERYCGYREDSIPQLEDVSHFLKERTGFQLRPVAGLLSARDFLASLAFRVFQCTQYIRHASSPMHSPEPDCCHELLGHVPMLADRTFAQFSQDIGLASLGASDEEIEKLSTVYWFTVEFGLCKQNGELKAYGAGLLSSYGELLHSLSEEPEVRAFDPDTAAVQPYQDQTYQPVYFVSESFSDAKDKLRNYASRIQRPFSVKFDPYTLAIDVLDSPHTIRRSLEGVQDELHTLTQAL 494          
BLAST of tph vs. UniProt/SwissProt
Match: sp|P70080|TPH1_CHICK (Tryptophan 5-hydroxylase 1 OS=Gallus gallus OX=9031 GN=TPH1 PE=1 SV=1)

HSP 1 Score: 587.8 bits (1514), Expect = 0.000e+0
Identity = 274/463 (59.18%), Postives = 350/463 (75.59%), Query Frame = 3
Query:  312 EENKTISTRRS-TSFIFGVNDNVKGLVRVLEIFEKFRVSVIHIETRKSLKNKSKFEIFIDVDCRKDEIKSLIECLQQKIDDDFHVQEVDMISSNINGIRIDTFDLAASEIGEQNIQLKNKKPGMTVDNLPWFPKYIKDLDKISNRVIMYGSELDADHPGFKDEVYRLRRNQFSEIAYSYKHGNPIPKIEYTNEEIKTWGNVYRELTKLYPTHACREFLQNLPLLQKYCGYREDNIPQLEDVSQFLKSRSGFTLRPVAGYLSSRDFLAGLAFRVFHCTQYIRHPSDPFYTPEPDCCHELMGHVPLLADSSFAQFSQEIGLASLGASEDEVQRLATCYFFTIEFGLCHQDGELRAYGAGLLSSIGELKHALSNESNIQKFDPKTVMEQECLVTTFQNAYFFTTSFEDAKDKMREFAKTIKKPFDVHYNPYTQMIETLDSTDSLTNVIDNIKGELATITNALRKFN 1697
            +ENK  +  R  T+ IF + + V GLV+ L++F++  V+++HIE+RKS +  S+FEIF+D D  ++++  + + L+       HV  V M  +    ++ D                        ++N+PW+PK I DLDK +NRV+MYGS+LDADHPGFKD VYR RR  F+++A +YKHG+PIP+IE+T EEIKTWG VYREL KLYPTHACRE+L+NLPLL KYCGYREDNIPQLEDVS+FLK R+GFT+RPVAGYLS RDFLAGLAFRVFHCTQY+RH SDP YTPEPD CHEL+GHVPLLA+ SFAQFSQEIGLASLGAS++ VQ+LATCYFFT+EFGLC Q+G+LR YGAGLLSSI ELKH+LS  + ++ FDPK   +QECL+TTFQ  YF + SFE+AK+KMREFAKTIK+PF V YNPYTQ ++ L  T S+ +V++ ++ EL  +++AL K  
Sbjct:    6 KENKDHAPERGRTAIIFSLKNEVGGLVKALKLFQEKHVNLVHIESRKSKRRNSEFEIFVDCDSNREQLNEIFQLLKS------HVSIVSMNPTEHFNVQEDG----------------------DMENIPWYPKKISDLDKCANRVLMYGSDLDADHPGFKDNVYRKRRKYFADLAMNYKHGDPIPEIEFTEEEIKTWGTVYRELNKLYPTHACREYLKNLPLLTKYCGYREDNIPQLEDVSRFLKERTGFTIRPVAGYLSPRDFLAGLAFRVFHCTQYVRHSSDPLYTPEPDTCHELLGHVPLLAEPSFAQFSQEIGLASLGASDEAVQKLATCYFFTVEFGLCKQEGQLRVYGAGLLSSISELKHSLSGSAKVKPFDPKVTCKQECLITTFQEVYFVSESFEEAKEKMREFAKTIKRPFGVKYNPYTQSVQILKDTKSIASVVNELRHELDIVSDALSKMG 440          
BLAST of tph vs. UniProt/SwissProt
Match: sp|P17752|TPH1_HUMAN (Tryptophan 5-hydroxylase 1 OS=Homo sapiens OX=9606 GN=TPH1 PE=1 SV=4)

HSP 1 Score: 584.334 bits (1505), Expect = 0.000e+0
Identity = 278/461 (60.30%), Postives = 352/461 (76.36%), Query Frame = 3
Query:  312 EENKTISTRRS-TSFIFGVNDNVKGLVRVLEIFEKFRVSVIHIETRKSLKNKSKFEIFIDVDCRKDEIKSLIECLQQKIDDDFHVQEVDMISSNINGIRIDTFDLAASEIGEQNIQLKNKKPGMTVDNLPWFPKYIKDLDKISNRVIMYGSELDADHPGFKDEVYRLRRNQFSEIAYSYKHGNPIPKIEYTNEEIKTWGNVYRELTKLYPTHACREFLQNLPLLQKYCGYREDNIPQLEDVSQFLKSRSGFTLRPVAGYLSSRDFLAGLAFRVFHCTQYIRHPSDPFYTPEPDCCHELMGHVPLLADSSFAQFSQEIGLASLGASEDEVQRLATCYFFTIEFGLCHQDGELRAYGAGLLSSIGELKHALSNESNIQKFDPKTVMEQECLVTTFQNAYFFTTSFEDAKDKMREFAKTIKKPFDVHYNPYTQMIETLDSTDSLTNVIDNIKGELATITNALRK 1691
            +ENK  S  R   S IF + + V GL++ L+IF++  V+++HIE+RKS +  S+FEIF+D D  ++++           +D FH     ++ S+ N + ++  D         N  LK    GM  + +PWFPK I DLD  +NRV+MYGSELDADHPGFKD VYR RR  F+++A +YKHG+PIPK+E+T EEIKTWG V++EL KLYPTHACRE+L+NLPLL KYCGYREDNIPQLEDVS FLK R+GF++RPVAGYLS RDFL+GLAFRVFHCTQY+RH SDPFYTPEPD CHEL+GHVPLLA+ SFAQFSQEIGLASLGASE+ VQ+LATCYFFT+EFGLC QDG+LR +GAGLLSSI ELKHALS  + ++ FDPK   +QECL+TTFQ+ YF + SFEDAK+KMREF KTIK+PF V YNPYT+ I+ L  T S+T+ ++ ++ +L  +++AL K
Sbjct:    6 KENKDHSLERGRASLIFSLKNEVGGLIKALKIFQEKHVNLLHIESRKSKRRNSEFEIFVDCDINREQL-----------NDIFH-----LLKSHTNVLSVNLPD---------NFTLKED--GM--ETVPWFPKKISDLDHCANRVLMYGSELDADHPGFKDNVYRKRRKYFADLAMNYKHGDPIPKVEFTEEEIKTWGTVFQELNKLYPTHACREYLKNLPLLSKYCGYREDNIPQLEDVSNFLKERTGFSIRPVAGYLSPRDFLSGLAFRVFHCTQYVRHSSDPFYTPEPDTCHELLGHVPLLAEPSFAQFSQEIGLASLGASEEAVQKLATCYFFTVEFGLCKQDGQLRVFGAGLLSSISELKHALSGHAKVKPFDPKITCKQECLITTFQDVYFVSESFEDAKEKMREFTKTIKRPFGVKYNPYTRSIQILKDTKSITSAMNELQHDLDVVSDALAK 437          
BLAST of tph vs. UniProt/SwissProt
Match: sp|P17532|TPH1_MOUSE (Tryptophan 5-hydroxylase 1 OS=Mus musculus OX=10090 GN=Tph1 PE=2 SV=1)

HSP 1 Score: 582.793 bits (1501), Expect = 0.000e+0
Identity = 274/461 (59.44%), Postives = 351/461 (76.14%), Query Frame = 3
Query:  312 EENKTISTRRS-TSFIFGVNDNVKGLVRVLEIFEKFRVSVIHIETRKSLKNKSKFEIFIDVDCRKDEIKSLIECLQQKIDDDFHVQEVDMISSNINGIRIDTFDLAASEIGEQNIQLKNKKPGMTVDNLPWFPKYIKDLDKISNRVIMYGSELDADHPGFKDEVYRLRRNQFSEIAYSYKHGNPIPKIEYTNEEIKTWGNVYRELTKLYPTHACREFLQNLPLLQKYCGYREDNIPQLEDVSQFLKSRSGFTLRPVAGYLSSRDFLAGLAFRVFHCTQYIRHPSDPFYTPEPDCCHELMGHVPLLADSSFAQFSQEIGLASLGASEDEVQRLATCYFFTIEFGLCHQDGELRAYGAGLLSSIGELKHALSNESNIQKFDPKTVMEQECLVTTFQNAYFFTTSFEDAKDKMREFAKTIKKPFDVHYNPYTQMIETLDSTDSLTNVIDNIKGELATITNALRK 1691
            +ENK  S+ R   + IF + + V GL++VL+IF++  VS++HIE+RKS +  S+FEIF+D D  ++++  +   L+                S+   + +D+ D           QL  K+  M  + +PWFPK I DLD  +NRV++YGSELDADHPGFKD VYR RR  F+E+A +YKHG+PIPKIE+T EEIKTWG ++REL KLYPTHACRE+L+NLPLL KYCGYREDNIPQLEDVS FLK R+GF++RPVAGYLS RDFL+GLAFRVFHCTQY+RH SDP YTPEPD CHEL+GHVPLLA+ SFAQFSQEIGLASLGASE+ VQ+LATCYFFT+EFGLC QDG+LR +GAGLLSSI ELKHALS  + ++ FDPK   +QECL+T+FQ+ YF + SFEDAK+KMREFAKT+K+PF + YNPYTQ ++ L  T S+T+ ++ ++ +L  I++AL +
Sbjct:    9 KENKDHSSERGRVTLIFSLENEVGGLIKVLKIFQENHVSLLHIESRKSKQRNSEFEIFVDCDISREQLNDIFPLLK----------------SHATVLSVDSPD-----------QLTAKEDVM--ETVPWFPKKISDLDFCANRVLLYGSELDADHPGFKDNVYRRRRKYFAELAMNYKHGDPIPKIEFTEEEIKTWGTIFRELNKLYPTHACREYLRNLPLLSKYCGYREDNIPQLEDVSNFLKERTGFSIRPVAGYLSPRDFLSGLAFRVFHCTQYVRHSSDPLYTPEPDTCHELLGHVPLLAEPSFAQFSQEIGLASLGASEETVQKLATCYFFTVEFGLCKQDGQLRVFGAGLLSSISELKHALSGHAKVKPFDPKIACKQECLITSFQDVYFVSESFEDAKEKMREFAKTVKRPFGLKYNPYTQSVQVLRDTKSITSAMNELRYDLDVISDALAR 440          
BLAST of tph vs. UniProt/SwissProt
Match: sp|P17290|TPH1_RABIT (Tryptophan 5-hydroxylase 1 OS=Oryctolagus cuniculus OX=9986 GN=TPH1 PE=1 SV=2)

HSP 1 Score: 581.637 bits (1498), Expect = 0.000e+0
Identity = 275/461 (59.65%), Postives = 351/461 (76.14%), Query Frame = 3
Query:  312 EENKTISTRRS-TSFIFGVNDNVKGLVRVLEIFEKFRVSVIHIETRKSLKNKSKFEIFIDVDCRKDEIKSLIECLQQKIDDDFHVQEVDMISSNINGIRIDTFDLAASEIGEQNIQLKNKKPGMTVDNLPWFPKYIKDLDKISNRVIMYGSELDADHPGFKDEVYRLRRNQFSEIAYSYKHGNPIPKIEYTNEEIKTWGNVYRELTKLYPTHACREFLQNLPLLQKYCGYREDNIPQLEDVSQFLKSRSGFTLRPVAGYLSSRDFLAGLAFRVFHCTQYIRHPSDPFYTPEPDCCHELMGHVPLLADSSFAQFSQEIGLASLGASEDEVQRLATCYFFTIEFGLCHQDGELRAYGAGLLSSIGELKHALSNESNIQKFDPKTVMEQECLVTTFQNAYFFTTSFEDAKDKMREFAKTIKKPFDVHYNPYTQMIETLDSTDSLTNVIDNIKGELATITNALRK 1691
            +ENK  S  R   + IF + + V GL++ L+IF++  V+++HIE+RKS +  S+FEIF+D D  ++++           +D FH     ++ S+ N + +   D         N  +K +  GM  +++PWFPK I DLD  +NRV+MYGSELDADHPGFKD VYR RR  F+++A SYK+G+PIPK+E+T EEIKTWG V+REL KLYPTHACRE+L+NLPLL KYCGYREDNIPQLED+S FLK R+GF++RPVAGYLS RDFL+GLAFRVFHCTQY+RH SDPFYTPEPD CHEL+GHVPLLA+ SFAQFSQEIGLASLGASE+ VQ+LATCYFFT+EFGLC QDG+LR +GAGLLSSI ELKH LS  + ++ FDPK   +QECL+TTFQ+ YF + SFEDAK+KMREF KTIK+PF V YNPYT+ I+ L    S+TN ++ ++ +L  +++AL K
Sbjct:    6 KENKDHSLERGRATLIFSLKNEVGGLIKALKIFQEKHVNLLHIESRKSKRRNSEFEIFVDCDTNREQL-----------NDIFH-----LLKSHTNVLSVTPPD---------NFTMKEE--GM--ESVPWFPKKISDLDHCANRVLMYGSELDADHPGFKDNVYRKRRKYFADLAMSYKYGDPIPKVEFTEEEIKTWGTVFRELNKLYPTHACREYLKNLPLLSKYCGYREDNIPQLEDISNFLKERTGFSIRPVAGYLSPRDFLSGLAFRVFHCTQYVRHSSDPFYTPEPDTCHELLGHVPLLAEPSFAQFSQEIGLASLGASEEAVQKLATCYFFTVEFGLCKQDGQLRVFGAGLLSSISELKHVLSGHAKVKPFDPKITYKQECLITTFQDVYFVSESFEDAKEKMREFTKTIKRPFGVKYNPYTRSIQILKDAKSITNAMNELRHDLDVVSDALGK 437          
BLAST of tph vs. UniProt/SwissProt
Match: sp|P09810|TPH1_RAT (Tryptophan 5-hydroxylase 1 OS=Rattus norvegicus OX=10116 GN=Tph1 PE=2 SV=2)

HSP 1 Score: 578.556 bits (1490), Expect = 0.000e+0
Identity = 270/461 (58.57%), Postives = 349/461 (75.70%), Query Frame = 3
Query:  312 EENKTISTRRS-TSFIFGVNDNVKGLVRVLEIFEKFRVSVIHIETRKSLKNKSKFEIFIDVDCRKDEIKSLIECLQQKIDDDFHVQEVDMISSNINGIRIDTFDLAASEIGEQNIQLKNKKPGMTVDNLPWFPKYIKDLDKISNRVIMYGSELDADHPGFKDEVYRLRRNQFSEIAYSYKHGNPIPKIEYTNEEIKTWGNVYRELTKLYPTHACREFLQNLPLLQKYCGYREDNIPQLEDVSQFLKSRSGFTLRPVAGYLSSRDFLAGLAFRVFHCTQYIRHPSDPFYTPEPDCCHELMGHVPLLADSSFAQFSQEIGLASLGASEDEVQRLATCYFFTIEFGLCHQDGELRAYGAGLLSSIGELKHALSNESNIQKFDPKTVMEQECLVTTFQNAYFFTTSFEDAKDKMREFAKTIKKPFDVHYNPYTQMIETLDSTDSLTNVIDNIKGELATITNALRK 1691
            +ENK  S+ R   + IF + + V GL++ L+IF++  V+++HIE+RKS +  S+FEIF+D D  ++++  +   L+                S+   + +D+ D           QL  K+  M  + +PWFPK I DLD  +NRV++YGSELDADHPGFKD VYR RR  F+E+A +YKHG+PIPKIE+T EEIKTWG ++REL KLYPTHACRE+L+NLPLL KYCGYREDN+PQLEDVS FLK R+GF++RPVAGYLS RDFL+GLAFRVFHCTQY+RH SDP YTPEPD CHEL+GHVPLLA+ SFAQFSQEIGLASLGASE+ VQ+LATCYFFT+EFGLC QDG+LR +GAGLLSSI EL+HALS  + ++ FDPK   +QECL+T+FQ+ YF + SFEDAK+KMREFAKT+K+PF V YNPYTQ I+ L  + S+T+ ++ ++ +L  + +AL +
Sbjct:    6 KENKDHSSERGRVTLIFSLKNEVGGLIKALKIFQENHVNLLHIESRKSKRRNSEFEIFVDCDINREQLNDIFPLLK----------------SHTTVLSVDSPD-----------QLPEKEDVM--ETVPWFPKKISDLDFCANRVLLYGSELDADHPGFKDNVYRRRRKYFAELAMNYKHGDPIPKIEFTEEEIKTWGTIFRELNKLYPTHACREYLRNLPLLSKYCGYREDNVPQLEDVSNFLKERTGFSIRPVAGYLSPRDFLSGLAFRVFHCTQYVRHSSDPLYTPEPDTCHELLGHVPLLAEPSFAQFSQEIGLASLGASEETVQKLATCYFFTVEFGLCKQDGQLRVFGAGLLSSISELRHALSGHAKVKPFDPKVACKQECLITSFQDVYFVSESFEDAKEKMREFAKTVKRPFGVKYNPYTQSIQVLRDSKSITSAMNELRHDLDVVNDALAR 437          
BLAST of tph vs. TrEMBL
Match: S5WES1 (Tph OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 1135.17 bits (2935), Expect = 0.000e+0
Identity = 545/545 (100.00%), Postives = 545/545 (100.00%), Query Frame = 3
Query:  108 MSDREKEKVSNKRNSIISLTKAKSVGESSIQINTAKTRRGRFSSVSSMIDEEDFEIIKGELFDLNIVMEENKTISTRRSTSFIFGVNDNVKGLVRVLEIFEKFRVSVIHIETRKSLKNKSKFEIFIDVDCRKDEIKSLIECLQQKIDDDFHVQEVDMISSNINGIRIDTFDLAASEIGEQNIQLKNKKPGMTVDNLPWFPKYIKDLDKISNRVIMYGSELDADHPGFKDEVYRLRRNQFSEIAYSYKHGNPIPKIEYTNEEIKTWGNVYRELTKLYPTHACREFLQNLPLLQKYCGYREDNIPQLEDVSQFLKSRSGFTLRPVAGYLSSRDFLAGLAFRVFHCTQYIRHPSDPFYTPEPDCCHELMGHVPLLADSSFAQFSQEIGLASLGASEDEVQRLATCYFFTIEFGLCHQDGELRAYGAGLLSSIGELKHALSNESNIQKFDPKTVMEQECLVTTFQNAYFFTTSFEDAKDKMREFAKTIKKPFDVHYNPYTQMIETLDSTDSLTNVIDNIKGELATITNALRKFNIFWHGTQMAQINNSN 1742
            MSDREKEKVSNKRNSIISLTKAKSVGESSIQINTAKTRRGRFSSVSSMIDEEDFEIIKGELFDLNIVMEENKTISTRRSTSFIFGVNDNVKGLVRVLEIFEKFRVSVIHIETRKSLKNKSKFEIFIDVDCRKDEIKSLIECLQQKIDDDFHVQEVDMISSNINGIRIDTFDLAASEIGEQNIQLKNKKPGMTVDNLPWFPKYIKDLDKISNRVIMYGSELDADHPGFKDEVYRLRRNQFSEIAYSYKHGNPIPKIEYTNEEIKTWGNVYRELTKLYPTHACREFLQNLPLLQKYCGYREDNIPQLEDVSQFLKSRSGFTLRPVAGYLSSRDFLAGLAFRVFHCTQYIRHPSDPFYTPEPDCCHELMGHVPLLADSSFAQFSQEIGLASLGASEDEVQRLATCYFFTIEFGLCHQDGELRAYGAGLLSSIGELKHALSNESNIQKFDPKTVMEQECLVTTFQNAYFFTTSFEDAKDKMREFAKTIKKPFDVHYNPYTQMIETLDSTDSLTNVIDNIKGELATITNALRKFNIFWHGTQMAQINNSN
Sbjct:    1 MSDREKEKVSNKRNSIISLTKAKSVGESSIQINTAKTRRGRFSSVSSMIDEEDFEIIKGELFDLNIVMEENKTISTRRSTSFIFGVNDNVKGLVRVLEIFEKFRVSVIHIETRKSLKNKSKFEIFIDVDCRKDEIKSLIECLQQKIDDDFHVQEVDMISSNINGIRIDTFDLAASEIGEQNIQLKNKKPGMTVDNLPWFPKYIKDLDKISNRVIMYGSELDADHPGFKDEVYRLRRNQFSEIAYSYKHGNPIPKIEYTNEEIKTWGNVYRELTKLYPTHACREFLQNLPLLQKYCGYREDNIPQLEDVSQFLKSRSGFTLRPVAGYLSSRDFLAGLAFRVFHCTQYIRHPSDPFYTPEPDCCHELMGHVPLLADSSFAQFSQEIGLASLGASEDEVQRLATCYFFTIEFGLCHQDGELRAYGAGLLSSIGELKHALSNESNIQKFDPKTVMEQECLVTTFQNAYFFTTSFEDAKDKMREFAKTIKKPFDVHYNPYTQMIETLDSTDSLTNVIDNIKGELATITNALRKFNIFWHGTQMAQINNSN 545          
BLAST of tph vs. TrEMBL
Match: A7VKD9 (Tryptophan hydroxylase OS=Dugesia japonica OX=6161 GN=DjTPH PE=2 SV=1)

HSP 1 Score: 994.186 bits (2569), Expect = 0.000e+0
Identity = 475/545 (87.16%), Postives = 510/545 (93.58%), Query Frame = 3
Query:  108 MSDREKEKVSNKRNSIISLTKAKSVGESSIQINTAKTRRGRFSSVSSMIDEEDFEIIKGELFDLNIVMEENKTISTRRSTSFIFGVNDNVKGLVRVLEIFEKFRVSVIHIETRKSLKNKSKFEIFIDVDCRKDEIKSLIECLQQKIDDDFHVQEVDMISSNINGIRIDTFDLAASEIGEQN-IQLKNKKPGMTVDNLPWFPKYIKDLDKISNRVIMYGSELDADHPGFKDEVYRLRRNQFSEIAYSYKHGNPIPKIEYTNEEIKTWGNVYRELTKLYPTHACREFLQNLPLLQKYCGYREDNIPQLEDVSQFLKSRSGFTLRPVAGYLSSRDFLAGLAFRVFHCTQYIRHPSDPFYTPEPDCCHELMGHVPLLADSSFAQFSQEIGLASLGASEDEVQRLATCYFFTIEFGLCHQDGELRAYGAGLLSSIGELKHALSNESNIQKFDPKTVMEQECLVTTFQNAYFFTTSFEDAKDKMREFAKTIKKPFDVHYNPYTQMIETLDSTDSLTNVIDNIKGELATITNALRKFNIFWHGTQMAQINNS 1739
            M +R+K    NK+NSIISLTKAKSV E+ IQIN+AK RRGRFSSVSSMIDEEDFEIIKGEL DLNIVMEENK+ISTRRSTSFIFGVNDNVKGLVRVLEIFEKF VSVIHIETRKSLKNKSKFEIFIDVDC+KDEIKSLI+CL+Q +D+DFHVQEVDMISSN NGI+ D+ D   +E  +QN IQ+K KK  MTVDNLPWFPKYIKDLDKISNRVIMYGSELDADHPGFKDE+YR RRNQFSEIAYSYKHGNPIPKIEYT +EI TWGNVYRELTKLYPTHACREFL+NLPLLQKYCGYREDNIPQLE+VSQFLK+RSGFTLRPVAGYLSSRDFLAGLAFRVFHCTQYIRHPSDPFYTPEPDCCHELMGHVPLLADSSFAQFSQEIGLASLGASE+EVQ+LATCYFFTIEFGLCHQDGELRAYGAGLLSSIGELKHALS ESNIQKFDPK VMEQECLVTTFQNAYF+T SFEDAKDKMR+FAKTIKKPFDVHYNPYTQMIE LDSTDS+T+VI+NIKGELATITNAL+K NI+W+G+  ++ + S
Sbjct:    1 MCERDKVFAENKKNSIISLTKAKSVSENLIQINSAKHRRGRFSSVSSMIDEEDFEIIKGELLDLNIVMEENKSISTRRSTSFIFGVNDNVKGLVRVLEIFEKFEVSVIHIETRKSLKNKSKFEIFIDVDCKKDEIKSLIKCLEQNVDNDFHVQEVDMISSNPNGIKCDSADRPNNESLDQNQIQIKAKKRAMTVDNLPWFPKYIKDLDKISNRVIMYGSELDADHPGFKDELYRKRRNQFSEIAYSYKHGNPIPKIEYTKDEITTWGNVYRELTKLYPTHACREFLENLPLLQKYCGYREDNIPQLEEVSQFLKNRSGFTLRPVAGYLSSRDFLAGLAFRVFHCTQYIRHPSDPFYTPEPDCCHELMGHVPLLADSSFAQFSQEIGLASLGASEEEVQKLATCYFFTIEFGLCHQDGELRAYGAGLLSSIGELKHALSTESNIQKFDPKLVMEQECLVTTFQNAYFYTPSFEDAKDKMRDFAKTIKKPFDVHYNPYTQMIEILDSTDSVTSVIENIKGELATITNALKKLNIYWYGSHRSEADQS 545          
BLAST of tph vs. TrEMBL
Match: F6KBQ2 (Tryptophan hydroxylase (Fragment) OS=Schmidtea mediterranea OX=79327 GN=tph PE=2 SV=1)

HSP 1 Score: 805.053 bits (2078), Expect = 0.000e+0
Identity = 380/380 (100.00%), Postives = 380/380 (100.00%), Query Frame = 3
Query:  489 VDCRKDEIKSLIECLQQKIDDDFHVQEVDMISSNINGIRIDTFDLAASEIGEQNIQLKNKKPGMTVDNLPWFPKYIKDLDKISNRVIMYGSELDADHPGFKDEVYRLRRNQFSEIAYSYKHGNPIPKIEYTNEEIKTWGNVYRELTKLYPTHACREFLQNLPLLQKYCGYREDNIPQLEDVSQFLKSRSGFTLRPVAGYLSSRDFLAGLAFRVFHCTQYIRHPSDPFYTPEPDCCHELMGHVPLLADSSFAQFSQEIGLASLGASEDEVQRLATCYFFTIEFGLCHQDGELRAYGAGLLSSIGELKHALSNESNIQKFDPKTVMEQECLVTTFQNAYFFTTSFEDAKDKMREFAKTIKKPFDVHYNPYTQMIETLDSTDS 1628
            VDCRKDEIKSLIECLQQKIDDDFHVQEVDMISSNINGIRIDTFDLAASEIGEQNIQLKNKKPGMTVDNLPWFPKYIKDLDKISNRVIMYGSELDADHPGFKDEVYRLRRNQFSEIAYSYKHGNPIPKIEYTNEEIKTWGNVYRELTKLYPTHACREFLQNLPLLQKYCGYREDNIPQLEDVSQFLKSRSGFTLRPVAGYLSSRDFLAGLAFRVFHCTQYIRHPSDPFYTPEPDCCHELMGHVPLLADSSFAQFSQEIGLASLGASEDEVQRLATCYFFTIEFGLCHQDGELRAYGAGLLSSIGELKHALSNESNIQKFDPKTVMEQECLVTTFQNAYFFTTSFEDAKDKMREFAKTIKKPFDVHYNPYTQMIETLDSTDS
Sbjct:    1 VDCRKDEIKSLIECLQQKIDDDFHVQEVDMISSNINGIRIDTFDLAASEIGEQNIQLKNKKPGMTVDNLPWFPKYIKDLDKISNRVIMYGSELDADHPGFKDEVYRLRRNQFSEIAYSYKHGNPIPKIEYTNEEIKTWGNVYRELTKLYPTHACREFLQNLPLLQKYCGYREDNIPQLEDVSQFLKSRSGFTLRPVAGYLSSRDFLAGLAFRVFHCTQYIRHPSDPFYTPEPDCCHELMGHVPLLADSSFAQFSQEIGLASLGASEDEVQRLATCYFFTIEFGLCHQDGELRAYGAGLLSSIGELKHALSNESNIQKFDPKTVMEQECLVTTFQNAYFFTTSFEDAKDKMREFAKTIKKPFDVHYNPYTQMIETLDSTDS 380          
BLAST of tph vs. TrEMBL
Match: A0A267EVM7 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig017249g1 PE=4 SV=1)

HSP 1 Score: 635.18 bits (1637), Expect = 0.000e+0
Identity = 307/533 (57.60%), Postives = 389/533 (72.98%), Query Frame = 3
Query:  207 TAKTRRGRFSSVSSMIDEEDFEIIKGELFDLNIVMEENKTISTRRSTSFIFGVNDNVKGLVRVLEIFEKFRVSVIHIETRKSLKNKSKFEIFIDVDCRKDEIKSLIECLQQKIDDDFHVQEVD-----------------MISSNINGIRIDTFD---------LAASEI-GEQN-IQLKNKKP--------GMTVDNLPWFPKYIKDLDKISNRVIMYGSELDADHPGFKDEVYRLRRNQFSEIAYSYKHGNPIPKIEYTNEEIKTWGNVYRELTKLYPTHACREFLQNLPLLQKYCGYREDNIPQLEDVSQFLKSRSGFTLRPVAGYLSSRDFLAGLAFRVFHCTQYIRHPSDPFYTPEPDCCHELMGHVPLLADSSFAQFSQEIGLASLGASEDEVQRLATCYFFTIEFGLCHQDGELRAYGAGLLSSIGELKHALSNESNIQKFDPKTVMEQECLVTTFQNAYFFTTSFEDAKDKMREFAKTIKKPFDVHYNPYTQMIETLDSTDSLTNVIDNIKGELATITNALRKFN 1697
             AK RRGRFSSVSSMIDE+D   I+ +L DL  V E  +  + +++ SFIFGV D + GL  VL+IFE   + V+H+E+R   +  + FEIF+DVD  + ++ SL++ L+ +++    VQEVD                  I    N   +D  D         +  +EI G+ N    K   P         MT++ LPWFP+ I+DLDK+S RVIMYGSELDADHPGFKD  YR RR  F+++AY+Y+ G PIP+IEYT EE +TW  VY+EL+ LY  HACREFL+NLP LQK+CGYREDNIPQLED+S++LK R+GF LRPVAGYLS+RDFL+GLAFRVFHCTQYIRH +DPFYTPEPDCCHE++GH+PLLAD SFAQFSQEIGLASLGAS++EVQ+LATCYFFTIEFGLC Q+GE++ YGAGLLS + E +  +S ++ I  FDP+TV ++ECLVTTFQN YF+T SFEDAK+KMREFAKTI++PFDV YNPYTQ +E LDS   + NV++ +KG+LA I++ALRK  
Sbjct:    5 AAKARRGRFSSVSSMIDEDDISGIENKLKDLGSVKETAE--AAKKTVSFIFGVGDRISGLAGVLKIFEANNIEVVHVESRGGRRASAPFEIFVDVDADRSKLPSLVDALKAEVES-VMVQEVDKSIDPDQTESGAAISGGGIGGGANDEAVDGGDAFENSGPAGVVDTEIPGKSNPASTKTSAPRQGRMLRRQMTMERLPWFPRRIQDLDKVSRRVIMYGSELDADHPGFKDVEYRKRRMWFADLAYNYRQGEPIPRIEYTAEETRTWAAVYKELSSLYQKHACREFLENLPQLQKFCGYREDNIPQLEDISRYLKDRTGFVLRPVAGYLSARDFLSGLAFRVFHCTQYIRHGADPFYTPEPDCCHEILGHMPLLADPSFAQFSQEIGLASLGASDEEVQKLATCYFFTIEFGLCKQEGEMKVYGAGLLSCVDEFRFVMSGKAEINSFDPRTVSKEECLVTTFQNRYFYTPSFEDAKEKMREFAKTIRRPFDVRYNPYTQSVEVLDSPRRIANVVNELKGDLAIISSALRKMT 534          
BLAST of tph vs. TrEMBL
Match: A0A1I8I7A2 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig010937g1 PE=4 SV=1)

HSP 1 Score: 633.639 bits (1633), Expect = 0.000e+0
Identity = 303/533 (56.85%), Postives = 386/533 (72.42%), Query Frame = 3
Query:  207 TAKTRRGRFSSVSSMIDEEDFEIIKGELFDLNIVMEENKTISTRRSTSFIFGVNDNVKGLVRVLEIFEKFRVSVIHIETRKSLKNKSKFEIFIDVDCRKDEIKSLIECLQQKIDDDFHVQEVD---------------------------------MISSNINGI---RIDTFDLAASEIGEQNIQLKNKKPGMTVDNLPWFPKYIKDLDKISNRVIMYGSELDADHPGFKDEVYRLRRNQFSEIAYSYKHGNPIPKIEYTNEEIKTWGNVYRELTKLYPTHACREFLQNLPLLQKYCGYREDNIPQLEDVSQFLKSRSGFTLRPVAGYLSSRDFLAGLAFRVFHCTQYIRHPSDPFYTPEPDCCHELMGHVPLLADSSFAQFSQEIGLASLGASEDEVQRLATCYFFTIEFGLCHQDGELRAYGAGLLSSIGELKHALSNESNIQKFDPKTVMEQECLVTTFQNAYFFTTSFEDAKDKMREFAKTIKKPFDVHYNPYTQMIETLDSTDSLTNVIDNIKGELATITNALRKFN 1697
             AK RRGRFSSVSSMIDE++   I+ +L DL  V E  +  + +++ SFIFGV D + GL  VL+IFE   + V+H+E+R   +  + FEIF+DVD  + ++ SL++ L+ +++    VQEVD                                   +S   G+    I     AAS       Q +  +  MT++ LPWFP+ I+DLDK+S RVIMYGSELDADHPGFKD  YR RR  F+++AY+Y+ G PIP+IEYT EE +TW  VY+EL+ LY  HACREFL+NLP LQK+CGYREDNIPQLED+S++LK R+GF LRPVAGYLS+RDFL+GLAFRVFHCTQYIRH +DPFYTPEPDCCHE++GH+PLLAD SFAQFSQEIGLASLGAS++EVQ+LATCYFFTIEFGLC Q+GE++ YGAGLLS + E +  +S ++ I  FDP+TV ++ECLVTTFQN YF+T SFEDAK+KMREFAKTI++PFDV YNPYTQ +E LDS   + NV++ +KG+LA I++ALRK  
Sbjct:    5 AAKARRGRFSSVSSMIDEDEISGIENKLKDLGSVKETAE--AAKKTVSFIFGVGDRISGLAGVLKIFEANNIEVVHVESRGGRRASAPFEIFVDVDADRSKLPSLVDALKAEVES-VMVQEVDKSIDPDQTESGAAISGGGVGGGANDGAVDGGNAFENSGPAGVVDTEIPGKSNAASAKTSAPRQGRMLRRQMTMERLPWFPRRIQDLDKVSRRVIMYGSELDADHPGFKDVEYRKRRMWFADLAYNYRQGEPIPRIEYTAEETRTWAAVYKELSSLYQKHACREFLENLPQLQKFCGYREDNIPQLEDISRYLKDRTGFVLRPVAGYLSARDFLSGLAFRVFHCTQYIRHGADPFYTPEPDCCHEILGHMPLLADPSFAQFSQEIGLASLGASDEEVQKLATCYFFTIEFGLCKQEGEMKVYGAGLLSCVDEFRFVMSGKAEINSFDPRTVSKEECLVTTFQNRYFYTPSFEDAKEKMREFAKTIRRPFDVRYNPYTQSVEVLDSPRRIANVVNELKGDLAIISSALRKMT 534          
BLAST of tph vs. Ensembl Cavefish
Match: tph1a (tryptophan hydroxylase 1 [Source:NCBI gene;Acc:103043966])

HSP 1 Score: 581.252 bits (1497), Expect = 0.000e+0
Identity = 271/463 (58.53%), Postives = 349/463 (75.38%), Query Frame = 3
Query:  312 EENKTISTRRS-TSFIFGVNDNVKGLVRVLEIFEKFRVSVIHIETRKSLKNKSKFEIFIDVDCRKDEIKSLIECLQQKIDDDFHVQEVDMISSNINGIRIDTFDLAASEIGEQNIQLKNKKPGMTVDNLPWFPKYIKDLDKISNRVIMYGSELDADHPGFKDEVYRLRRNQFSEIAYSYKHGNPIPKIEYTNEEIKTWGNVYRELTKLYPTHACREFLQNLPLLQKYCGYREDNIPQLEDVSQFLKSRSGFTLRPVAGYLSSRDFLAGLAFRVFHCTQYIRHPSDPFYTPEPDCCHELMGHVPLLADSSFAQFSQEIGLASLGASEDEVQRLATCYFFTIEFGLCHQDGELRAYGAGLLSSIGELKHALSNESNIQKFDPKTVMEQECLVTTFQNAYFFTTSFEDAKDKMREFAKTIKKPFDVHYNPYTQMIETLDSTDSLTNVIDNIKGELATITNALRKFN 1697
            ++NK+ S  +   + +F + + V GLV+ L++F++  V+++HIE+RKS +  S+FEI +D D   +++  +I+ L++      HV  +D  +S                       +K+      +DN+PWFPK I DLDK +NRV+MYGS+LDADHPGFKD VYR RR  F+++A SYKHG+PIP+IE+T EE+KTWG V+REL KLYPTHACRE L+NLPLL KYCGYREDNIPQLEDVS+FL+ R+GF +RPVAGYLS RDFLAGLAFRVFHCTQY+RH SDP YTPEPD CHEL+GHVPLLA+ SFAQFSQEIGLASLGAS++ VQ+LATCYFFT+EFGLC Q+G+LRAYGAGLLSSI EL+HALS  + I  FDPK   +QEC++TTFQ+ YF + SFE+AK KMREFAKTIK+PF V YNPYTQ ++ L  T S+ +V++ ++ EL  + +AL + N
Sbjct:   45 KDNKSESAEKGRAAIVFSLKNEVGGLVKALKLFQENHVNLVHIESRKSRRRNSEFEILVDCDSNHEQLNEIIQLLRK------HVNVLDTETS-----------------------IKSLPEEDEMDNVPWFPKKIADLDKCANRVLMYGSDLDADHPGFKDNVYRKRRKYFADLAMSYKHGDPIPRIEFTEEEVKTWGVVFRELNKLYPTHACREHLKNLPLLTKYCGYREDNIPQLEDVSRFLRERTGFNIRPVAGYLSPRDFLAGLAFRVFHCTQYVRHSSDPLYTPEPDTCHELLGHVPLLAEPSFAQFSQEIGLASLGASDEAVQKLATCYFFTVEFGLCKQEGKLRAYGAGLLSSISELRHALSGNARIMPFDPKVTCKQECIITTFQDVYFVSDSFEEAKVKMREFAKTIKRPFTVRYNPYTQSVDVLKDTTSINSVVEELRHELDIVGDALNRLN 478          
BLAST of tph vs. Ensembl Cavefish
Match: tph2 (tryptophan hydroxylase 2 (tryptophan 5-monooxygenase) [Source:ZFIN;Acc:ZDB-GENE-040624-4])

HSP 1 Score: 564.688 bits (1454), Expect = 0.000e+0
Identity = 264/453 (58.28%), Postives = 341/453 (75.28%), Query Frame = 3
Query:  345 TSFIFGVNDNVKGLVRVLEIFEKFRVSVIHIETRKSLKNKSKFEIFIDVDCRKDEIKSLIECLQQKIDDDFHVQEVDMISSNINGIRIDTFDLAASEIGEQNIQLKNKKPGMTVDNLPWFPKYIKDLDKISNRVIMYGSELDADHPGFKDEVYRLRRNQFSEIAYSYKHGNPIPKIEYTNEEIKTWGNVYRELTKLYPTHACREFLQNLPLLQKYCGYREDNIPQLEDVSQFLKSRSGFTLRPVAGYLSSRDFLAGLAFRVFHCTQYIRHPSDPFYTPEPDCCHELMGHVPLLADSSFAQFSQEIGLASLGASEDEVQRLATCYFFTIEFGLCHQDGELRAYGAGLLSSIGELKHALSNESNIQKFDPKTVMEQECLVTTFQNAYFFTTSFEDAKDKMREFAKTIKKPFDVHYNPYTQMIETLDSTDSLTNVIDNIKGELATITNALRKFNIF 1703
            T+ IF + + V  LV+ L +F++  V++ HIE+RKS +  ++ EI+ + +C K E   L++ L+  ++   +     + SS  +G                             + +PWFP+ I +LD+ S+RV+MYGSELDADHPGFKD VYR RR  F E+A +YK G PIP+I+YT EE+KTWG V+RELTKLYPTHACRE+L+NLPLL K+CGYREDNIPQLEDVS FL+ RSGF +RPVAGYLS RDFLAGLA+RVF+CTQY+RH +DP YTPEPD CHEL+GHVPLLAD  FAQFSQEIGLASLGAS+++VQ+LATCYFFTIEFGLC QDG+LRAYGAGLLSSIGEL+HALS+++ ++ FDP+T   QECL+TTFQ+ YF + SFE+AK+KMREFAK+IK+PF V+YNPYTQ I+ L  T S+ NV+ +++ +L T+ +AL K N +
Sbjct:   20 TAVIFSLKNEVGCLVKALRLFQEKHVNLAHIESRKSKRVTTEVEIYAECNCTKKEFNELVQHLKDHVNIISYNTPQHVWSSETDG-----------------------------EGVPWFPQKISELDQCSHRVLMYGSELDADHPGFKDNVYRQRRKYFVEVAMNYKFGQPIPRIDYTLEEVKTWGVVFRELTKLYPTHACREYLKNLPLLTKHCGYREDNIPQLEDVSLFLRERSGFIVRPVAGYLSPRDFLAGLAYRVFNCTQYVRHSTDPLYTPEPDTCHELLGHVPLLADPKFAQFSQEIGLASLGASDEDVQKLATCYFFTIEFGLCKQDGQLRAYGAGLLSSIGELRHALSDKAVVKPFDPRTTCYQECLITTFQDVYFVSDSFEEAKEKMREFAKSIKRPFSVYYNPYTQSIDLLKDTRSIENVVQDLRSDLTTVCDALGKMNKY 443          
BLAST of tph vs. Ensembl Cavefish
Match: tph1b (tryptophan 5-hydroxylase 1-like [Source:NCBI gene;Acc:103025693])

HSP 1 Score: 559.296 bits (1440), Expect = 0.000e+0
Identity = 269/503 (53.48%), Postives = 357/503 (70.97%), Query Frame = 3
Query:  207 TAKTRRGR-FSSVSSMIDEEDFEIIKGEL----FDLNIVMEENKTISTRRS-TSFIFGVNDNVKGLVRVLEIFEKFRVSVIHIETRKSLKNKSKFEIFIDVDCRKDEIKSLIECLQQKIDDDFHVQEVDMISSNINGIRIDTFDLAASEIGEQNIQLKNKKPGMTVDNLPWFPKYIKDLDKISNRVIMYGSELDADHPGFKDEVYRLRRNQFSEIAYSYKHGNPIPKIEYTNEEIKTWGNVYRELTKLYPTHACREFLQNLPLLQKYCGYREDNIPQLEDVSQFLKSRSGFTLRPVAGYLSSRDFLAGLAFRVFHCTQYIRHPSDPFYTPEPDCCHELMGHVPLLADSSFAQFSQEIGLASLGASEDEVQRLATCYFFTIEFGLCHQDGELRAYGAGLLSSIGELKHALSNESNIQKFDPKTVMEQECLVTTFQNAYFFTTSFEDAKDKMREFAKTIKKPFDVHYNPYTQMIETLDSTDSLTNVIDNIKGELATITNALRKFN 1697
            T   RRGR F S++   +E+    I  EL    F+ NI   + + +S++R   + IF + + V  LV+ L++F++ +V ++HIE+RKS +N S+ E+ +D D  +D +K +I+ L+++                 N + +D  +    +            P       PWFP+ I DLDK +NRV+MYGS LDADHPGFKD VYR RR  F+++A +YKHG  IP++E+T EE++TWG V+REL KLYP HACRE+L NLPLL ++CGYRE+NIPQLEDVS+FL+ R+GFT+RPVAGYLS RDFLAGLAFRVFHCTQY+RH S P YTPEPD CHEL+GHVPLLA+ SFAQFSQE+GLASLGAS+D VQ+LATCYFFT+EFGLC Q+G+LRAYGAGLLSSI EL+HALS  + I  F+PK   +QECL+TTFQ+ YF + SFE+AK +MREFAKTI++PF V YNPYTQ +  L    S+ +V++ ++ EL  + +AL + N
Sbjct:    6 TEGPRRGRSFDSINKYYEEKQ---INNELNKSTFN-NIEENQGRILSSKREHAAIIFSLKNEVGNLVKALKLFQENQVKLLHIESRKSRRNNSELEVLVDCDSERDTLKEIIQLLKKQT----------------NTVTMDPPERPLPD------------PDTDFPEEPWFPRKISDLDKCANRVLMYGSALDADHPGFKDNVYRKRRKYFADLAMNYKHGEAIPRVEFTEEEVRTWGVVFRELNKLYPCHACREYLLNLPLLSQHCGYRENNIPQLEDVSRFLRERTGFTIRPVAGYLSPRDFLAGLAFRVFHCTQYVRHSSAPLYTPEPDTCHELLGHVPLLAEPSFAQFSQELGLASLGASDDAVQKLATCYFFTVEFGLCKQEGKLRAYGAGLLSSISELQHALSGNAKILPFEPKVTCKQECLITTFQDVYFMSESFEEAKIRMREFAKTIRRPFTVRYNPYTQSVSVLKDMPSINSVVEELRHELDIVGDALHRLN 476          
BLAST of tph vs. Ensembl Cavefish
Match: tph1a (tryptophan hydroxylase 1 [Source:NCBI gene;Acc:103043966])

HSP 1 Score: 525.013 bits (1351), Expect = 0.000e+0
Identity = 246/411 (59.85%), Postives = 312/411 (75.91%), Query Frame = 3
Query:  312 EENKTISTRRS-TSFIFGVNDNVKGLVRVLEIFEKFRVSVIHIETRKSLKNKSKFEIFIDVDCRKDEIKSLIECLQQKIDDDFHVQEVDMISSNINGIRIDTFDLAASEIGEQNIQLKNKKPGMTVDNLPWFPKYIKDLDKISNRVIMYGSELDADHPGFKDEVYRLRRNQFSEIAYSYKHGNPIPKIEYTNEEIKTWGNVYRELTKLYPTHACREFLQNLPLLQKYCGYREDNIPQLEDVSQFLKSRSGFTLRPVAGYLSSRDFLAGLAFRVFHCTQYIRHPSDPFYTPEPDCCHELMGHVPLLADSSFAQFSQEIGLASLGASEDEVQRLATCYFFTIEFGLCHQDGELRAYGAGLLSSIGELKHALSNESNIQKFDPKTVMEQECLVTTFQNAYFFTTSFEDAKDKMR 1541
            ++NK+ S  +   + +F + + V GLV+ L++F++  V+++HIE+RKS +  S+FEI +D D   +++  +I+ L++      HV  +D  +S                       +K+      +DN+PWFPK I DLDK +NRV+MYGS+LDADHPGFKD VYR RR  F+++A SYKHG+PIP+IE+T EE+KTWG V+REL KLYPTHACRE L+NLPLL KYCGYREDNIPQLEDVS+FL+ R+GF +RPVAGYLS RDFLAGLAFRVFHCTQY+RH SDP YTPEPD CHEL+GHVPLLA+ SFAQFSQEIGLASLGAS++ VQ+LATCYFFT+EFGLC Q+G+LRAYGAGLLSSI EL+HALS  + I  FDPK   +QEC++TTFQ+ YF + SFE+AK KMR
Sbjct:   45 KDNKSESAEKGRAAIVFSLKNEVGGLVKALKLFQENHVNLVHIESRKSRRRNSEFEILVDCDSNHEQLNEIIQLLRK------HVNVLDTETS-----------------------IKSLPEEDEMDNVPWFPKKIADLDKCANRVLMYGSDLDADHPGFKDNVYRKRRKYFADLAMSYKHGDPIPRIEFTEEEVKTWGVVFRELNKLYPTHACREHLKNLPLLTKYCGYREDNIPQLEDVSRFLRERTGFNIRPVAGYLSPRDFLAGLAFRVFHCTQYVRHSSDPLYTPEPDTCHELLGHVPLLAEPSFAQFSQEIGLASLGASDEAVQKLATCYFFTVEFGLCKQEGKLRAYGAGLLSSISELRHALSGNARIMPFDPKVTCKQECIITTFQDVYFVSDSFEEAKVKMR 426          
BLAST of tph vs. Ensembl Cavefish
Match: pah (phenylalanine hydroxylase [Source:ZFIN;Acc:ZDB-GENE-031006-2])

HSP 1 Score: 461.07 bits (1185), Expect = 1.155e-158
Identity = 230/450 (51.11%), Postives = 302/450 (67.11%), Query Frame = 3
Query:  348 SFIFGVNDNVKGLVRVLEIFEKFRVSVIHIETRKSLKNKSKFEIFIDVDCRK--DEIKSLIECLQQKIDDDFHVQEVDMISSNINGIRIDTFDLAASEIGEQNIQLKNKKPGMTVDNLPWFPKYIKDLDKISNRVIMYGSELDADHPGFKDEVYRLRRNQFSEIAYSYKHGNPIPKIEYTNEEIKTWGNVYRELTKLYPTHACREFLQNLPLLQKYCGYREDNIPQLEDVSQFLKSRSGFTLRPVAGYLSSRDFLAGLAFRVFHCTQYIRHPSDPFYTPEPDCCHELMGHVPLLADSSFAQFSQEIGLASLGASEDEVQRLATCYFFTIEFGLCHQDGELRAYGAGLLSSIGELKHALSNESNIQKFDPKTVMEQECLVTTFQNAYFFTTSFEDAKDKMREFAKTIKKPFDVHYNPYTQMIETLDSTDSLTNVIDNIKGELATITNALRK 1691
            S IF +N+ V  L + L +FE+  +++ HIE+               V C K  DE+                          I+G+R        +EI  Q  ++   K     D +PWFP  I+DLD+ +N+++ YGSELDADHPGF D VYR RR +F++IAY+Y+HG  IP +EYT  E  TWG V+REL  LYPTHAC E  +  PLL++YCGYREDNIPQLED+S++L+S +GF LRPVAG LSSRDFLAGLAFRVFH TQYIRH S+P YTPEPD CHEL+GHVPL AD SFAQFSQEIGLASL A ++ +++LAT Y+FT+EFGLC Q  ++RAYGAGLLSS GEL++AL+++  +  F+P+  + Q+  +T FQ  YF   SFED+K+K+R++A TI +PF V YN YTQ IE LD+T  L N+ ++I  E+  + NAL+K
Sbjct:   14 SCIFSLNEEVGSLAKALRLFEEKGINLTHIESH--------------VSCSKALDEV--------------------------IDGLR--------AEITGQVHEMSRNK---IKDTVPWFPSNIQDLDRFANQILSYGSELDADHPGFTDPVYRARRKEFADIAYNYRHGQSIPYVEYTEAEKATWGTVFRELKTLYPTHACHEHNRVFPLLEEYCGYREDNIPQLEDISRYLQSCTGFRLRPVAGLLSSRDFLAGLAFRVFHSTQYIRHGSNPMYTPEPDICHELLGHVPLFADPSFAQFSQEIGLASLAAPDEYIEKLATVYWFTVEFGLCKQGNDIRAYGAGLLSSFGELQYALTDKPKLLPFEPEKTILQKYPITEFQPIYFVAESFEDSKEKVRKYAATIPRPFSVRYNAYTQSIEVLDNTQQLRNLANSI-SEVGILCNALQK 411          
BLAST of tph vs. Ensembl Sea Lamprey
Match: tph1a (tryptophan hydroxylase 1 (tryptophan 5-monooxygenase) a [Source:ZFIN;Acc:ZDB-GENE-030317-1])

HSP 1 Score: 580.867 bits (1496), Expect = 0.000e+0
Identity = 267/454 (58.81%), Postives = 345/454 (75.99%), Query Frame = 3
Query:  336 RRSTSFIFGVNDNVKGLVRVLEIFEKFRVSVIHIETRKSLKNKSKFEIFIDVDCRKDEIKSLIECLQQKIDDDFHVQEVDMISSNINGIRIDTFDLAASEIGEQNIQLKNKKPGMTVDNLPWFPKYIKDLDKISNRVIMYGSELDADHPGFKDEVYRLRRNQFSEIAYSYKHGNPIPKIEYTNEEIKTWGNVYRELTKLYPTHACREFLQNLPLLQKYCGYREDNIPQLEDVSQFLKSRSGFTLRPVAGYLSSRDFLAGLAFRVFHCTQYIRHPSDPFYTPEPDCCHELMGHVPLLADSSFAQFSQEIGLASLGASEDEVQRLATCYFFTIEFGLCHQDGELRAYGAGLLSSIGELKHALSNESNIQKFDPKTVMEQECLVTTFQNAYFFTTSFEDAKDKMREFAKTIKKPFDVHYNPYTQMIETLDSTDSLTNVIDNIKGELATITNALRKFN 1697
            R   + +F + +++ GLV+ L++F++  V+++HIE+RKS +  S+FEI++D D  ++++  L++ L+            +++S +      D        +G Q++           D +PWFPK I DLD  SN+V+MYG++LDADHPGFKD VYR RR  F++IA +YKHG PIP+IEYT EE++TW  V+RELTKLYPTHACRE+L+NLPLL K+CGYR+DNIPQLEDVS+FLK RSGFT+RPVAGYLS RDFLAGLAFRVFHCTQY+RH SDP YTPEPD CHEL+GHVPLLA+ SFAQFSQEIGLASLGAS++ VQ+LATCYFFT+EFGLC QDG+LRAYGAGLLSSI ELKHALS  + ++ FDPK   +QECL+TTFQ+ YF + SFE+AK+KMREFAKTIK+ F V YNPYTQ IE L  T  +  ++  ++ EL T+++AL + N
Sbjct:   54 RGRAAVVFSLKNDIGGLVKALKLFQEKHVNLMHIESRKSKRRNSEFEIYVDCDSNREQLGELMQLLRS--------HACNIVSMSGPASHCD--------VGPQDL-----------DGVPWFPKKISDLDHSSNKVLMYGADLDADHPGFKDNVYRKRRKHFADIALNYKHGEPIPRIEYTEEEVRTWATVFRELTKLYPTHACREYLKNLPLLTKHCGYRDDNIPQLEDVSRFLKERSGFTIRPVAGYLSPRDFLAGLAFRVFHCTQYVRHSSDPLYTPEPDTCHELLGHVPLLAEPSFAQFSQEIGLASLGASDEAVQKLATCYFFTVEFGLCKQDGQLRAYGAGLLSSISELKHALSENAKVKGFDPKVTCKQECLITTFQDIYFVSESFEEAKEKMREFAKTIKRNFTVRYNPYTQSIEVLKDTRMIAEMVKELRAELDTVSDALHRLN 480          
BLAST of tph vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000676.1 (pep scaffold:Pmarinus_7.0:GL477040:200355:204568:-1 gene:ENSPMAG00000000617.1 transcript:ENSPMAT00000000676.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 327.405 bits (838), Expect = 5.423e-109
Identity = 148/281 (52.67%), Postives = 197/281 (70.11%), Query Frame = 3
Query:  852 GNPIPKIEYTNEEIKTWGNVYRELTKLYPTHACREFLQNLPLLQKYCGYREDNIPQLEDVSQFLKSRSGFTLRPVAGYLSSRDFLAGLAFRVFHCTQYIRHPSDPFYTPEPDCCHELMGHVPLLADSSFAQFSQEIGLASLGASEDEVQRLATCYFFTIEFGLCHQDGELRAYGAGLLSSIGELKHALSNESNIQKFDPKTVMEQECLVTTFQNAYFFTTSFEDAKDKMREFAKTIKKPFDVHYNPYTQMIETLDSTDSLTNVIDNIKGELATITNALRKF 1694
            G  IP++ YT EEI TWG VYR+L  LYPTHAC+E +    LL+++CGY ED IPQLEDVS FL  R+GF LRP AG LS+RDFLA LAFRVF CTQYIRH S P ++PEPDCCHEL+GHVP+LADS+FAQFSQ  G++ +         L   Y+FT+EFGLC Q+G ++AYGAGLLSS GEL  ALS E   + F+ +    Q     T+Q  YF + S EDAKDK+R++A+ +++P  + ++P T+ +  LDST SL   +D ++ +++ ++ AL + 
Sbjct:    1 GELIPRVHYTQEEIATWGEVYRKLAGLYPTHACKEHVDAFRLLEQHCGYSEDAIPQLEDVSTFLLERTGFQLRPAAGLLSARDFLASLAFRVFQCTQYIRHASSPMHSPEPDCCHELLGHVPMLADSTFAQFSQVSGVSEVSVRTHPCAPLPQLYWFTVEFGLCKQEGHVKAYGAGLLSSFGELMFALSGEPEYRAFEAEAAALQPYQDQTYQPVYFVSDSLEDAKDKLRQYAQGLRRPVALRFDPITRSVHALDSTRSLRTAVDALQEQVSVLSCALSRM 281          
BLAST of tph vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001726.1 (pep scaffold:Pmarinus_7.0:GL477470:183489:194417:1 gene:ENSPMAG00000001558.1 transcript:ENSPMAT00000001726.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 95.5153 bits (236), Expect = 5.998e-23
Identity = 75/199 (37.69%), Postives = 98/199 (49.25%), Query Frame = 3
Query:  768 DADHP--GFKDEVYRLRRNQFSEIAYSYKHGNPIPKIEYTNEEIKTWGNVYRELTKLYPTHACREFLQNLPLLQKYCGYREDNIPQLEDVSQFLKSRSGFTLRPVAGYLSSRDFLAGLAFRVFHCTQY-----IRHPSDPFYT-PEPDCCHELMGHVPLLADSSFAQFSQEIGLASLGASEDEVQRLATCYFFTIEFGL 1340
            D DHP   F  E+   RR  FSE+A  YK   P P ++Y+  E   W +      +  P  A  EF   L  L     Y    IPQ   VSQ L   +GF+L PV G   +R  L+ LAFRV  C+ +     + HP+   Y  P  D C  L+G VPLL     A+  Q++GLASLG+S  +VQ LA  ++   EF L
Sbjct:    1 DEDHPYSDFCSELDESRRAYFSELALQYKFREPAPVLQYSARESAAWRSALEAAVRGAPG-AEPEFRAALEEL-TVTAYSASAIPQASHVSQLLHGHTGFSLWPVPGTPPARVLLSALAFRVLPCSLHACPGSVAHPAHRTYGGPLTDVCGLLLGLVPLLTMGPVARAVQDMGLASLGSSNTDVQLLAESFYSVCEFAL 197          
BLAST of tph vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006904.1 (pep scaffold:Pmarinus_7.0:GL491535:768:2811:-1 gene:ENSPMAG00000006244.1 transcript:ENSPMAT00000006904.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 54.6842 bits (130), Expect = 7.128e-10
Identity = 27/71 (38.03%), Postives = 46/71 (64.79%), Query Frame = 3
Query:  585 SNINGIRIDTFDLAASEIGEQN----IQL-KNKKPGMTVDNLPWFPKYIKDLDKISNRVIMYGSELDADHP 782
            ++++G R    D    E+  Q+    +QL +NK+     D +PWFP+ I+DLD+ +N+++ YG+ELD+DHP
Sbjct:   26 ASVSGERPGALDALLLELRSQSAGSVLQLSRNKRK----DAVPWFPRTIRDLDRFANQILSYGAELDSDHP 92          
BLAST of tph vs. Ensembl Nematostella
Match: EDO31745 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SX22])

HSP 1 Score: 410.609 bits (1054), Expect = 1.299e-139
Identity = 202/405 (49.88%), Postives = 272/405 (67.16%), Query Frame = 3
Query:  330 STRRSTSFIFGVNDNVKGLVRVLEIFEKFRVSVIHIETRKSLKNKSKFEIFIDVDCRKDEIKSLIECLQQKIDDDFHVQEVDMISSNINGIRIDTFDLAASEIGEQNIQLKNKKPGMTVDNLPWFPKYIKDLDKISNRVIMYGSELDADHPGFKDEVYRLRRNQFSEIAYSYKHGNPIPKIEYTNEEIKTWGNVYRELTKLYPTHACREFLQNLPLLQKYCGYREDNIPQLEDVSQFLKSRSGFTLRPVAGYLSSRDFLAGLAFRVFHCTQYIRHPSDPFYTPEPDCCHELMGHVPLLADSSFAQFSQEIGLASLGASEDEVQRLATCYFFTIEFGLCHQDGELRAYGAGLLSSIGELKHALSNESNIQKFDPKTVMEQECLVTTFQNAYFFTTSFEDAKDKMRE 1544
            S +++T+ +F +N+ V  L R L++FE   V++ HIE+R S   K++++ F D +                                ++G  ++ F + A +    NI + +   G    ++PWFP+ I DLDK ++RV+ YG+ELD+DHPGF D+VYR RR +F++IA+ +KHG  IP++ YT+ EI TW  V+ ELTKLYPTHACRE     PLL + CGYR  NIPQL+DVS FLK  +GFTLRPVAG LSSRDFLAGLAFRVFH TQYIRHP+ P YTPEPD  HEL+GHVPL AD  FAQFSQEIGLASLGA ++ V++LAT Y+FT+EFGLC Q+GE++AYGAGLLSS GEL++ L++E      +P+    Q+  +T +Q  YF   SF  A++K+R+
Sbjct:   26 SEKKATTVVFSLNEEVGALARALKLFEDHHVNMTHIESRPSKACKTRYDFFADCE-------------------------------GLHGASLNHF-VDALKKRAVNITVLSDDKG----SVPWFPRKISDLDKFADRVLSYGAELDSDHPGFTDQVYRARRKEFADIAFKHKHGEIIPQVTYTDIEIATWDKVFTELTKLYPTHACREHNFVWPLLVQNCGYRLGNIPQLQDVSMFLKECTGFTLRPVAGLLSSRDFLAGLAFRVFHSTQYIRHPTKPMYTPEPDVVHELIGHVPLFADPDFAQFSQEIGLASLGAPDEWVEKLATLYWFTVEFGLCRQEGEVKAYGAGLLSSFGELQYCLTDEPKKYPLEPEKTSVQKYPITQYQPVYFIADSFLSARNKVRK 394          
BLAST of tph vs. Ensembl Medaka
Match: tph1 (tryptophan hydroxylase 1 [Source:NCBI gene;Acc:101175562])

HSP 1 Score: 582.408 bits (1500), Expect = 0.000e+0
Identity = 286/496 (57.66%), Postives = 363/496 (73.19%), Query Frame = 3
Query:  219 RRGR-FSSVSSMIDEE--DFEIIKGELFDLNIVMEENKTISTRRSTSFIFGVNDNVKGLVRVLEIFEKFRVSVIHIETRKSLKNKSKFEIFIDVDCRKDEIKSLIECLQQKIDDDFHVQEVDMISSNINGIRIDTFDLAASEIGEQNIQLKNKKPGMTVDNLPWFPKYIKDLDKISNRVIMYGSELDADHPGFKDEVYRLRRNQFSEIAYSYKHGNPIPKIEYTNEEIKTWGNVYRELTKLYPTHACREFLQNLPLLQKYCGYREDNIPQLEDVSQFLKSRSGFTLRPVAGYLSSRDFLAGLAFRVFHCTQYIRHPSDPFYTPEPDCCHELMGHVPLLADSSFAQFSQEIGLASLGASEDEVQRLATCYFFTIEFGLCHQDGELRAYGAGLLSSIGELKHALSNESNIQKFDPKTVMEQECLVTTFQNAYFFTTSFEDAKDKMREFAKTIKKPFDVHYNPYTQMIETLDSTDSLTNVIDNIKGELATITNALRKFN 1697
            RRGR F S++   +E+  + EI K     +    E+  T    R+T  IF + + V GLV+ L++F++  V+++HIE+RKS +  S+FEIF+D D   +++  +I  L++      HV  VDM   +             S + E+++            ++PWFPK I DLDK +NRV+MYGSELDADHPGFKD VYR RR  F+++A +YKHG+PIP+IE+T EE+KTWG VYREL KLYPTHACRE+L+NLPLL KYC  REDNIPQLEDVS+FL+ R+GFT+RPVAGYLS RDFLAGLAFRVFHCTQY+RH SDP YTPEPD CHEL+GHVPLLA+ SFAQFSQEIGLASLGAS+D VQ+LATCYFFT+EFGLC Q+G LRAYGAGLLSSI ELKHALS  + I  FDPK   +QEC++TTFQ+ YF + SFE+AK KMREFAKTIK+PF V YNPYTQ ++ L  T S+ +V++ ++ EL  + +AL + N
Sbjct:   79 RRGRSFDSMNIGFEEKLLNNEINKSTFNKIEENTEKQNTSEKGRAT-IIFSLKNEVGGLVKALKLFQENHVNLVHIESRKSKRRNSEFEIFVDCDSNHEQLSEIIHLLRK------HVNIVDMNPPD------------NSCLHEEDMY-----------DVPWFPKRISDLDKCANRVLMYGSELDADHPGFKDNVYRKRRKYFADLAMAYKHGDPIPRIEFTEEEVKTWGVVYRELNKLYPTHACREYLKNLPLLSKYCECREDNIPQLEDVSRFLRERTGFTIRPVAGYLSPRDFLAGLAFRVFHCTQYVRHSSDPLYTPEPDTCHELLGHVPLLAEPSFAQFSQEIGLASLGASDDSVQKLATCYFFTVEFGLCKQEGHLRAYGAGLLSSISELKHALSGNARIMPFDPKVTSKQECIITTFQDVYFVSDSFEEAKVKMREFAKTIKRPFTVRYNPYTQSVDVLKDTLSINSVVEELRHELDIVGDALSRLN 544          
BLAST of tph vs. Ensembl Medaka
Match: tph1 (tryptophan hydroxylase 1 [Source:NCBI gene;Acc:101175562])

HSP 1 Score: 578.17 bits (1489), Expect = 0.000e+0
Identity = 273/459 (59.48%), Postives = 345/459 (75.16%), Query Frame = 3
Query:  321 KTISTRRSTSFIFGVNDNVKGLVRVLEIFEKFRVSVIHIETRKSLKNKSKFEIFIDVDCRKDEIKSLIECLQQKIDDDFHVQEVDMISSNINGIRIDTFDLAASEIGEQNIQLKNKKPGMTVDNLPWFPKYIKDLDKISNRVIMYGSELDADHPGFKDEVYRLRRNQFSEIAYSYKHGNPIPKIEYTNEEIKTWGNVYRELTKLYPTHACREFLQNLPLLQKYCGYREDNIPQLEDVSQFLKSRSGFTLRPVAGYLSSRDFLAGLAFRVFHCTQYIRHPSDPFYTPEPDCCHELMGHVPLLADSSFAQFSQEIGLASLGASEDEVQRLATCYFFTIEFGLCHQDGELRAYGAGLLSSIGELKHALSNESNIQKFDPKTVMEQECLVTTFQNAYFFTTSFEDAKDKMREFAKTIKKPFDVHYNPYTQMIETLDSTDSLTNVIDNIKGELATITNALRKFN 1697
            +  S +   + IF + + V GLV+ L++F++  V+++HIE+RKS +  S+FEIF+D D   +++  +I  L++      HV  VDM   +             S + E+++            ++PWFPK I DLDK +NRV+MYGSELDADHPGFKD VYR RR  F+++A +YKHG+PIP+IE+T EE+KTWG VYREL KLYPTHACRE+L+NLPLL KYC  REDNIPQLEDVS+FL+ R+GFT+RPVAGYLS RDFLAGLAFRVFHCTQY+RH SDP YTPEPD CHEL+GHVPLLA+ SFAQFSQEIGLASLGAS+D VQ+LATCYFFT+EFGLC Q+G LRAYGAGLLSSI ELKHALS  + I  FDPK   +QEC++TTFQ+ YF + SFE+AK KMREFAKTIK+PF V YNPYTQ ++ L  T S+ +V++ ++ EL  + +AL + N
Sbjct:    4 QNTSEKGRATIIFSLKNEVGGLVKALKLFQENHVNLVHIESRKSKRRNSEFEIFVDCDSNHEQLSEIIHLLRK------HVNIVDMNPPD------------NSCLHEEDMY-----------DVPWFPKRISDLDKCANRVLMYGSELDADHPGFKDNVYRKRRKYFADLAMAYKHGDPIPRIEFTEEEVKTWGVVYRELNKLYPTHACREYLKNLPLLSKYCECREDNIPQLEDVSRFLRERTGFTIRPVAGYLSPRDFLAGLAFRVFHCTQYVRHSSDPLYTPEPDTCHELLGHVPLLAEPSFAQFSQEIGLASLGASDDSVQKLATCYFFTVEFGLCKQEGHLRAYGAGLLSSISELKHALSGNARIMPFDPKVTSKQECIITTFQDVYFVSDSFEEAKVKMREFAKTIKRPFTVRYNPYTQSVDVLKDTLSINSVVEELRHELDIVGDALSRLN 433          
BLAST of tph vs. Ensembl Medaka
Match: tph2 (tryptophan hydroxylase 2 [Source:NCBI gene;Acc:101166957])

HSP 1 Score: 571.622 bits (1472), Expect = 0.000e+0
Identity = 270/453 (59.60%), Postives = 343/453 (75.72%), Query Frame = 3
Query:  345 TSFIFGVNDNVKGLVRVLEIFEKFRVSVIHIETRKSLKNKSKFEIFIDVDCRKDEIKSLIECLQQKIDDDFHVQEVDMISSNINGIRIDTFDLAASEIGEQNIQLKNKKPGMTVDNLPWFPKYIKDLDKISNRVIMYGSELDADHPGFKDEVYRLRRNQFSEIAYSYKHGNPIPKIEYTNEEIKTWGNVYRELTKLYPTHACREFLQNLPLLQKYCGYREDNIPQLEDVSQFLKSRSGFTLRPVAGYLSSRDFLAGLAFRVFHCTQYIRHPSDPFYTPEPDCCHELMGHVPLLADSSFAQFSQEIGLASLGASEDEVQRLATCYFFTIEFGLCHQDGELRAYGAGLLSSIGELKHALSNESNIQKFDPKTVMEQECLVTTFQNAYFFTTSFEDAKDKMREFAKTIKKPFDVHYNPYTQMIETLDSTDSLTNVIDNIKGELATITNALRKFNIF 1703
            T+ +F + + V  LV+ L++F++ RV++ HIE+R S +  ++ EIF D  C + E + L++ L+           V ++S+N          + A +  ++++              PWFP  I +LD+ S+RV+MYGSELDADHPGFKDEVYR RR  F E+A +YK G PIP+IEYT EE++TWG V+RELTKLYPTHAC+E L+NLPLL K+CGYREDNIPQLEDVS FLK RSGFT+RPVAGYLS RDFLAGLAFRVF+CTQYIRH +DP YTPEPD CHEL+GHVPLLAD  FAQFSQEIGLASLGAS+++VQ+LATCYFFTIEFGLC QDG LRAYGAGLLSSIGEL+HALS+++ ++ FDPKT   QECL+TTFQ  YF + SFE+AK+KMREFAKTIK+PF V+YNPYTQ ++ L  T S+ NV+ +++ +L T+ +AL K N +
Sbjct:   84 TAVVFSLKNEVGFLVKALQLFQEKRVNLNHIESRVSKRVPNEVEIFADCSCSQKEFEELLQLLRDS---------VSVVSTNTPA------HVWADDADDEDV--------------PWFPMKISELDQCSHRVLMYGSELDADHPGFKDEVYRRRRKYFVEVAMNYKFGQPIPRIEYTPEEVRTWGVVFRELTKLYPTHACKEHLKNLPLLTKHCGYREDNIPQLEDVSMFLKERSGFTVRPVAGYLSPRDFLAGLAFRVFNCTQYIRHGTDPLYTPEPDTCHELLGHVPLLADPKFAQFSQEIGLASLGASDEDVQKLATCYFFTIEFGLCKQDGHLRAYGAGLLSSIGELRHALSDKACVRMFDPKTTCNQECLITTFQEVYFVSESFEEAKEKMREFAKTIKRPFSVYYNPYTQSVDLLKDTRSIENVVQDLRSDLTTVCDALGKMNTY 507          
BLAST of tph vs. Ensembl Medaka
Match: tph1b (tryptophan 5-hydroxylase 1 [Source:NCBI gene;Acc:101170994])

HSP 1 Score: 563.148 bits (1450), Expect = 0.000e+0
Identity = 260/458 (56.77%), Postives = 339/458 (74.02%), Query Frame = 3
Query:  324 TISTRRSTSFIFGVNDNVKGLVRVLEIFEKFRVSVIHIETRKSLKNKSKFEIFIDVDCRKDEIKSLIECLQQKIDDDFHVQEVDMISSNINGIRIDTFDLAASEIGEQNIQLKNKKPGMTVDNLPWFPKYIKDLDKISNRVIMYGSELDADHPGFKDEVYRLRRNQFSEIAYSYKHGNPIPKIEYTNEEIKTWGNVYRELTKLYPTHACREFLQNLPLLQKYCGYREDNIPQLEDVSQFLKSRSGFTLRPVAGYLSSRDFLAGLAFRVFHCTQYIRHPSDPFYTPEPDCCHELMGHVPLLADSSFAQFSQEIGLASLGASEDEVQRLATCYFFTIEFGLCHQDGELRAYGAGLLSSIGELKHALSNESNIQKFDPKTVMEQECLVTTFQNAYFFTTSFEDAKDKMREFAKTIKKPFDVHYNPYTQMIETLDSTDSLTNVIDNIKGELATITNALRKFN 1697
              S +R+ + IF + + V GL++ L++F++  V ++HIE+RKS +  S FE+F+D D   +++K L +                ++S++   + I  F    S + E +     +      D +PWFPK I DLD+ +NRV+MYGS+LDADHPGFKD VYR RR  F+++A ++KHGNPIPKI YT EE+ TWG V+REL KLYP+HAC+E+L+NLPLL + C Y EDNIPQLEDVS+FLK +SGFT+RPVAGYLS RDFLAGLAFRVFHCTQY+RH S+P YTPEPD CHEL+GHVPLLA+ SFAQFSQEIGLASLGAS+D V++LATCYFFT+EFGLC QDG+LRAYGAGLLSS  ELKH+LS ++NI  FDP     QEC++TTFQ AYF   SFE+AK+KMREFAKT+ +PF VHYNPYTQ ++ L +T ++ +++ +I+ EL  +  AL +  
Sbjct:   42 ACSRKRTATIIFTLKNEVGGLIKALKLFQEKHVHLVHIESRKSRRRDSDFEVFVDCDSEHEQMKELTQ----------------LLSTHAQIVEITPFG-GCSPLAEDD-----RADAPEADGVPWFPKKISDLDQCANRVLMYGSDLDADHPGFKDSVYRKRRQYFADVAMTFKHGNPIPKIHYTAEEVCTWGVVFRELHKLYPSHACKEYLKNLPLLTRDCCYSEDNIPQLEDVSKFLKGQSGFTIRPVAGYLSPRDFLAGLAFRVFHCTQYVRHSSEPLYTPEPDTCHELLGHVPLLAEPSFAQFSQEIGLASLGASDDAVKKLATCYFFTVEFGLCKQDGKLRAYGAGLLSSASELKHSLSGKANILPFDPILTCNQECMITTFQEAYFVAESFEEAKNKMREFAKTLHRPFTVHYNPYTQSVDVLTNTHNINSMVKDIRHELDIVEEALNQLG 477          
BLAST of tph vs. Ensembl Medaka
Match: tph1b (tryptophan 5-hydroxylase 1 [Source:NCBI gene;Acc:101170994])

HSP 1 Score: 562.377 bits (1448), Expect = 0.000e+0
Identity = 260/455 (57.14%), Postives = 339/455 (74.51%), Query Frame = 3
Query:  330 STRRSTSFIFGVNDNVKGLVRVLEIFEKFRVSVIHIETRKSLKNKSKFEIFIDVDCRKDEIKSLIECLQQKIDDDFHVQEVDMISSNINGIRIDTFDLAASEIGEQNIQLKNKKPGMTVDNLPWFPKYIKDLDKISNRVIMYGSELDADHPGFKDEVYRLRRNQFSEIAYSYKHGNPIPKIEYTNEEIKTWGNVYRELTKLYPTHACREFLQNLPLLQKYCGYREDNIPQLEDVSQFLKSRSGFTLRPVAGYLSSRDFLAGLAFRVFHCTQYIRHPSDPFYTPEPDCCHELMGHVPLLADSSFAQFSQEIGLASLGASEDEVQRLATCYFFTIEFGLCHQDGELRAYGAGLLSSIGELKHALSNESNIQKFDPKTVMEQECLVTTFQNAYFFTTSFEDAKDKMREFAKTIKKPFDVHYNPYTQMIETLDSTDSLTNVIDNIKGELATITNALRKF 1694
            S +R+ + IF + + V GL++ L++F++  V ++HIE+RKS +  S FE+F+D D   +++K L +                ++S++   + I  F    S + E +     +      D +PWFPK I DLD+ +NRV+MYGS+LDADHPGFKD VYR RR  F+++A ++KHGNPIPKI YT EE+ TWG V+REL KLYP+HAC+E+L+NLPLL + C Y EDNIPQLEDVS+FLK +SGFT+RPVAGYLS RDFLAGLAFRVFHCTQY+RH S+P YTPEPD CHEL+GHVPLLA+ SFAQFSQEIGLASLGAS+D V++LATCYFFT+EFGLC QDG+LRAYGAGLLSS  ELKH+LS ++NI  FDP     QEC++TTFQ AYF   SFE+AK+KMREFAKT+ +PF VHYNPYTQ ++ L +T ++ +++ +I+ EL  +  AL + 
Sbjct:    8 SQKRTATIIFTLKNEVGGLIKALKLFQEKHVHLVHIESRKSRRRDSDFEVFVDCDSEHEQMKELTQ----------------LLSTHAQIVEITPFG-GCSPLAEDD-----RADAPEADGVPWFPKKISDLDQCANRVLMYGSDLDADHPGFKDSVYRKRRQYFADVAMTFKHGNPIPKIHYTAEEVCTWGVVFRELHKLYPSHACKEYLKNLPLLTRDCCYSEDNIPQLEDVSKFLKGQSGFTIRPVAGYLSPRDFLAGLAFRVFHCTQYVRHSSEPLYTPEPDTCHELLGHVPLLAEPSFAQFSQEIGLASLGASDDAVKKLATCYFFTVEFGLCKQDGKLRAYGAGLLSSASELKHSLSGKANILPFDPILTCNQECMITTFQEAYFVAESFEEAKNKMREFAKTLHRPFTVHYNPYTQSVDVLTNTHNINSMVKDIRHELDIVEEALNQL 440          
BLAST of tph vs. Planmine SMEST
Match: SMESG000000522.1 (SMESG000000522.1)

HSP 1 Score: 1133.63 bits (2931), Expect = 0.000e+0
Identity = 544/545 (99.82%), Postives = 545/545 (100.00%), Query Frame = 3
Query:  108 MSDREKEKVSNKRNSIISLTKAKSVGESSIQINTAKTRRGRFSSVSSMIDEEDFEIIKGELFDLNIVMEENKTISTRRSTSFIFGVNDNVKGLVRVLEIFEKFRVSVIHIETRKSLKNKSKFEIFIDVDCRKDEIKSLIECLQQKIDDDFHVQEVDMISSNINGIRIDTFDLAASEIGEQNIQLKNKKPGMTVDNLPWFPKYIKDLDKISNRVIMYGSELDADHPGFKDEVYRLRRNQFSEIAYSYKHGNPIPKIEYTNEEIKTWGNVYRELTKLYPTHACREFLQNLPLLQKYCGYREDNIPQLEDVSQFLKSRSGFTLRPVAGYLSSRDFLAGLAFRVFHCTQYIRHPSDPFYTPEPDCCHELMGHVPLLADSSFAQFSQEIGLASLGASEDEVQRLATCYFFTIEFGLCHQDGELRAYGAGLLSSIGELKHALSNESNIQKFDPKTVMEQECLVTTFQNAYFFTTSFEDAKDKMREFAKTIKKPFDVHYNPYTQMIETLDSTDSLTNVIDNIKGELATITNALRKFNIFWHGTQMAQINNSN 1742
            MSDREKEKVSNKRNSIISLTKAKSVGESSIQINTAKTRRGRFSSVSSMIDEEDFEIIKGELFDLNIVMEENKTISTRRSTSFIFGVNDNVKGLVRVLEIFEKFRVSVIHIETRKSLKNKSKFEIFIDVDCRKDEIKSLIECLQQKIDDDFHVQEVDMISSNINGIRIDTFDLAASEIGEQNIQLKNKKPGMTVDNLPWFPKYIKDLDKISNRVIMYGSELDADHPGFKDEVYRLRRNQFSEIAYSYKHGNPIPKIEYTNEEIKTWGNVYRELTKLYPTHACREFLQNLPLLQKYCGYREDNIPQLEDVSQFLKSRSGFTLRPVAGYLSSRDFLAGLAFRVFHCTQYIRHPSDPFYTPEPDCCHELMGHVPLLADSSFAQFSQEIGLASLGASEDEVQRLATCYFFTIEFGLCHQDGELRAYGAGLLSSIGELKHALSNESNIQKFDPKTVMEQECLVTTFQNAYFFTTSFEDAKDKMREFAKTIKKPFDVHYNPYTQMIETLDSTDSLTNVIDNIKGELATITNALRKFNIFWHGTQMA+INNSN
Sbjct:    1 MSDREKEKVSNKRNSIISLTKAKSVGESSIQINTAKTRRGRFSSVSSMIDEEDFEIIKGELFDLNIVMEENKTISTRRSTSFIFGVNDNVKGLVRVLEIFEKFRVSVIHIETRKSLKNKSKFEIFIDVDCRKDEIKSLIECLQQKIDDDFHVQEVDMISSNINGIRIDTFDLAASEIGEQNIQLKNKKPGMTVDNLPWFPKYIKDLDKISNRVIMYGSELDADHPGFKDEVYRLRRNQFSEIAYSYKHGNPIPKIEYTNEEIKTWGNVYRELTKLYPTHACREFLQNLPLLQKYCGYREDNIPQLEDVSQFLKSRSGFTLRPVAGYLSSRDFLAGLAFRVFHCTQYIRHPSDPFYTPEPDCCHELMGHVPLLADSSFAQFSQEIGLASLGASEDEVQRLATCYFFTIEFGLCHQDGELRAYGAGLLSSIGELKHALSNESNIQKFDPKTVMEQECLVTTFQNAYFFTTSFEDAKDKMREFAKTIKKPFDVHYNPYTQMIETLDSTDSLTNVIDNIKGELATITNALRKFNIFWHGTQMAEINNSN 545          
BLAST of tph vs. Planmine SMEST
Match: SMESG000000522.1 (SMESG000000522.1)

HSP 1 Score: 1001.89 bits (2589), Expect = 0.000e+0
Identity = 477/478 (99.79%), Postives = 478/478 (100.00%), Query Frame = 3
Query:  309 MEENKTISTRRSTSFIFGVNDNVKGLVRVLEIFEKFRVSVIHIETRKSLKNKSKFEIFIDVDCRKDEIKSLIECLQQKIDDDFHVQEVDMISSNINGIRIDTFDLAASEIGEQNIQLKNKKPGMTVDNLPWFPKYIKDLDKISNRVIMYGSELDADHPGFKDEVYRLRRNQFSEIAYSYKHGNPIPKIEYTNEEIKTWGNVYRELTKLYPTHACREFLQNLPLLQKYCGYREDNIPQLEDVSQFLKSRSGFTLRPVAGYLSSRDFLAGLAFRVFHCTQYIRHPSDPFYTPEPDCCHELMGHVPLLADSSFAQFSQEIGLASLGASEDEVQRLATCYFFTIEFGLCHQDGELRAYGAGLLSSIGELKHALSNESNIQKFDPKTVMEQECLVTTFQNAYFFTTSFEDAKDKMREFAKTIKKPFDVHYNPYTQMIETLDSTDSLTNVIDNIKGELATITNALRKFNIFWHGTQMAQINNSN 1742
            MEENKTISTRRSTSFIFGVNDNVKGLVRVLEIFEKFRVSVIHIETRKSLKNKSKFEIFIDVDCRKDEIKSLIECLQQKIDDDFHVQEVDMISSNINGIRIDTFDLAASEIGEQNIQLKNKKPGMTVDNLPWFPKYIKDLDKISNRVIMYGSELDADHPGFKDEVYRLRRNQFSEIAYSYKHGNPIPKIEYTNEEIKTWGNVYRELTKLYPTHACREFLQNLPLLQKYCGYREDNIPQLEDVSQFLKSRSGFTLRPVAGYLSSRDFLAGLAFRVFHCTQYIRHPSDPFYTPEPDCCHELMGHVPLLADSSFAQFSQEIGLASLGASEDEVQRLATCYFFTIEFGLCHQDGELRAYGAGLLSSIGELKHALSNESNIQKFDPKTVMEQECLVTTFQNAYFFTTSFEDAKDKMREFAKTIKKPFDVHYNPYTQMIETLDSTDSLTNVIDNIKGELATITNALRKFNIFWHGTQMA+INNSN
Sbjct:    1 MEENKTISTRRSTSFIFGVNDNVKGLVRVLEIFEKFRVSVIHIETRKSLKNKSKFEIFIDVDCRKDEIKSLIECLQQKIDDDFHVQEVDMISSNINGIRIDTFDLAASEIGEQNIQLKNKKPGMTVDNLPWFPKYIKDLDKISNRVIMYGSELDADHPGFKDEVYRLRRNQFSEIAYSYKHGNPIPKIEYTNEEIKTWGNVYRELTKLYPTHACREFLQNLPLLQKYCGYREDNIPQLEDVSQFLKSRSGFTLRPVAGYLSSRDFLAGLAFRVFHCTQYIRHPSDPFYTPEPDCCHELMGHVPLLADSSFAQFSQEIGLASLGASEDEVQRLATCYFFTIEFGLCHQDGELRAYGAGLLSSIGELKHALSNESNIQKFDPKTVMEQECLVTTFQNAYFFTTSFEDAKDKMREFAKTIKKPFDVHYNPYTQMIETLDSTDSLTNVIDNIKGELATITNALRKFNIFWHGTQMAEINNSN 478          
BLAST of tph vs. Planmine SMEST
Match: SMESG000077798.1 (SMESG000077798.1)

HSP 1 Score: 454.136 bits (1167), Expect = 1.163e-155
Identity = 220/451 (48.78%), Postives = 293/451 (64.97%), Query Frame = 3
Query:  342 STSFIFGVNDNVKGLVRVLEIFEKFRVSVIHIETRKSLKNKSKFEIFIDVDCRKDEIKSLIECLQQKIDDDFHVQEVDMISSNINGIRIDTFDLAASEIGEQNIQLKNKKPGMTVDNLPWFPKYIKDLDKISNRVIMYGSELDADHPGFKDEVYRLRRNQFSEIAYSYKHGNPIPKIEYTNEEIKTWGNVYRELTKLYPTHACREFLQNLPLLQKYCGYREDNIPQLEDVSQFLKSRSGFTLRPVAGYLSSRDFLAGLAFRVFHCTQYIRHPSDPFYTPEPDCCHELMGHVPLLADSSFAQFSQEIGLASLGASEDEVQRLATCYFFTIEFGLCHQDGELRAYGAGLLSSIGELKHALSNESNIQKFDPKTVMEQECLVTTFQNAYFFTTSFEDAKDKMREFAKTIKKPFDVHYNPYTQMIETLDSTDSLTNVIDNIKGELATITNALRKF 1694
            +T+ +   +  +  L  +LEIF+K  V+++HIE+R S   K +++  I+ D R   +   IE LQ                            L    +  Q+  LK         ++PWFP+ IKDLD+ +N+++ YGSELDADHPGF D VYR RR QF++IA+ YKHG PI ++EYT EEI TW  V+ +LT LYPTHAC+EF    PLLQ+ CGY  DNIPQL+DVS FLK  +GFTLRPVAG LSSRDFLAGL+FRVFH TQYIRH   P YTPEPD CHEL+GHVPL  +  FAQFSQEIGLASLGAS++ +++LATCY+FT+EFGLC +  +++AYGAGLLSS GEL++ L++E     FDP+    Q+  +  +Q  YF   SF DAK ++R F+K + +PF V Y+PYTQ +E LD    +  ++ ++K +   +  AL K 
Sbjct:   23 NTTILITASSKIGSLASILEIFKKNHVNLLHIESRPSKNLKEQYDFLINADNRTGGLMMAIENLQ-------------------------GLSLEVQVLSRQHDNLKG--------DVPWFPRKIKDLDRFANQILSYGSELDADHPGFTDPVYRERRKQFADIAFFYKHGQPIQRVEYTKEEINTWRTVFDKLTTLYPTHACKEFNYVFPLLQENCGYNRDNIPQLQDVSDFLKDCTGFTLRPVAGLLSSRDFLAGLSFRVFHSTQYIRHSKVPLYTPEPDVCHELLGHVPLFCNPEFAQFSQEIGLASLGASDEYIEKLATCYWFTVEFGLCKEHDKIKAYGAGLLSSFGELQYCLTDEPKKLSFDPQVTGLQKYPIVEYQPIYFVAESFADAKIRLRNFSKMVDRPFAVKYDPYTQTVEVLDKNSQIKQLMISLKDDFNVLEEALNKL 440          
BLAST of tph vs. Planmine SMEST
Match: SMESG000034472.1 (SMESG000034472.1)

HSP 1 Score: 364.77 bits (935), Expect = 4.992e-120
Identity = 172/340 (50.59%), Postives = 238/340 (70.00%), Query Frame = 3
Query:  684 VDNLPWFPKYIKDLDKISNRVIMYGSELDADHPGFKDEVYRLRRNQFSEIAYSYKHGNPIPKIEYTNEEIKTWGNVYRELTKLYPTHACREFLQNLPLLQKYCGYREDNIPQLEDVSQFLKSRSGFTLRPVAGYLSSRDFLAGLAFRVFHCTQYIRHPSDPFYTPEPDCCHELMGHVPLLADSSFAQFSQEIGLASLGASEDEVQRLATCYFFTIEFGLCHQDGELRAYGAGLLSSIGELKHALSNESNIQKFDPKTVMEQECLVTTFQNAYFFTTSFEDAKDKMREFAKTIKKPFDVHYNPYTQMIETLDSTDSLTNVIDNIKGELATITNALRKFNIF 1703
            VD++ W PK+I DLD  ++ V+ +  E+ +DHPGF D+ Y+ RR + +EIA+++KHG  IP++EY   E  TW   Y  LT LY  +AC+E L  +  L++ C Y  DNIPQLEDVS +LK +SGF LRPVAG LS+RDFLA L FRVF CTQY RH S P +TPEPDC HEL+GHVP+L+D  FA+FSQEIGL SLGAS+++++RLAT Y+FT+EFGLC++D +++A+GAGLLSS GEL+HA+S+    + F+P+T          +Q  Y+   S  D K+KMR+FAK+I +   + Y+PYT+ IE L++  S+ ++   IK EL  + N+L     F
Sbjct:  154 VDDI-WIPKHISDLDNCNHLVLKFQPEMASDHPGFHDKEYQKRRMEIAEIAFNFKHGEKIPRVEYLESEKNTWKEAYIALTSLYKDYACKEQLIGIKRLEEECEYGPDNIPQLEDVSNYLKKKSGFQLRPVAGLLSARDFLASLGFRVFQCTQYTRHHSKPLHTPEPDCIHELLGHVPVLSDMEFAEFSQEIGLCSLGASDEDIERLATLYWFTVEFGLCYEDKKMKAFGAGLLSSSGELQHAISDVPEHRIFEPQTASITPYRDEEYQPVYYVIDSVTDMKEKMRQFAKSIHRQNPIRYDPYTETIEVLNNKKSVCHLGRVIKRELDNMENSLSSMLTF 492          
The following BLAST results are available for this feature:
BLAST of tph vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TPH10.000e+060.30tryptophan hydroxylase 1 [Source:HGNC Symbol;Acc:H... [more]
TPH20.000e+060.26tryptophan hydroxylase 2 [Source:HGNC Symbol;Acc:H... [more]
PAH8.809e-16251.11phenylalanine hydroxylase [Source:HGNC Symbol;Acc:... [more]
PAH1.387e-16151.11phenylalanine hydroxylase [Source:HGNC Symbol;Acc:... [more]
TH3.740e-15248.17tyrosine hydroxylase [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of tph vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pah-11.669e-15448.79Phenylalanine-4-hydroxylase [Source:UniProtKB/Swi... [more]
pah-12.062e-15448.79Phenylalanine-4-hydroxylase [Source:UniProtKB/Swi... [more]
tph-13.156e-15053.83TryPtophan Hydroxylase [Source:UniProtKB/TrEMBL;A... [more]
tph-18.089e-15053.83TryPtophan Hydroxylase [Source:UniProtKB/TrEMBL;A... [more]
cat-24.756e-10136.93Tyrosine 3-monooxygenase [Source:UniProtKB/Swiss-... [more]
back to top
BLAST of tph vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Trh2.823e-17952.65gene:FBgn0035187 transcript:FBtr0072638[more]
Hn3.744e-16249.46gene:FBgn0001208 transcript:FBtr0100225[more]
Hn4.593e-16249.46gene:FBgn0001208 transcript:FBtr0334645[more]
Hn4.593e-16249.46gene:FBgn0001208 transcript:FBtr0076811[more]
ple6.952e-13439.83gene:FBgn0005626 transcript:FBtr0076956[more]
back to top
BLAST of tph vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tph1a0.000e+058.67tryptophan hydroxylase 1 (tryptophan 5-monooxygena... [more]
tph1a0.000e+058.67tryptophan hydroxylase 1 (tryptophan 5-monooxygena... [more]
tph20.000e+058.12tryptophan hydroxylase 2 (tryptophan 5-monooxygena... [more]
tph20.000e+058.12tryptophan hydroxylase 2 (tryptophan 5-monooxygena... [more]
tph20.000e+058.12tryptophan hydroxylase 2 (tryptophan 5-monooxygena... [more]
back to top
BLAST of tph vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TPH20.000e+057.89tryptophan hydroxylase 2 [Source:NCBI gene;Acc:100... [more]
taar20.000e+057.79trace amine associated receptor 2 (gene/pseudogene... [more]
taar20.000e+056.29trace amine associated receptor 2 (gene/pseudogene... [more]
taar20.000e+056.29trace amine associated receptor 2 (gene/pseudogene... [more]
taar20.000e+056.29trace amine associated receptor 2 (gene/pseudogene... [more]
back to top
BLAST of tph vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tph10.000e+059.44tryptophan hydroxylase 1 [Source:MGI Symbol;Acc:MG... [more]
Tph10.000e+059.44tryptophan hydroxylase 1 [Source:MGI Symbol;Acc:MG... [more]
Tph20.000e+058.71tryptophan hydroxylase 2 [Source:MGI Symbol;Acc:MG... [more]
Pah5.043e-16552.00phenylalanine hydroxylase [Source:MGI Symbol;Acc:M... [more]
Th6.358e-15449.20tyrosine hydroxylase [Source:MGI Symbol;Acc:MGI:98... [more]
back to top
BLAST of tph vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P70080|TPH1_CHICK0.000e+059.18Tryptophan 5-hydroxylase 1 OS=Gallus gallus OX=903... [more]
sp|P17752|TPH1_HUMAN0.000e+060.30Tryptophan 5-hydroxylase 1 OS=Homo sapiens OX=9606... [more]
sp|P17532|TPH1_MOUSE0.000e+059.44Tryptophan 5-hydroxylase 1 OS=Mus musculus OX=1009... [more]
sp|P17290|TPH1_RABIT0.000e+059.65Tryptophan 5-hydroxylase 1 OS=Oryctolagus cuniculu... [more]
sp|P09810|TPH1_RAT0.000e+058.57Tryptophan 5-hydroxylase 1 OS=Rattus norvegicus OX... [more]
back to top
BLAST of tph vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
S5WES10.000e+0100.00Tph OS=Schmidtea mediterranea OX=79327 PE=2 SV=1[more]
A7VKD90.000e+087.16Tryptophan hydroxylase OS=Dugesia japonica OX=6161... [more]
F6KBQ20.000e+0100.00Tryptophan hydroxylase (Fragment) OS=Schmidtea med... [more]
A0A267EVM70.000e+057.60Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8I7A20.000e+056.85Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of tph vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tph1a0.000e+058.53tryptophan hydroxylase 1 [Source:NCBI gene;Acc:103... [more]
tph20.000e+058.28tryptophan hydroxylase 2 (tryptophan 5-monooxygena... [more]
tph1b0.000e+053.48tryptophan 5-hydroxylase 1-like [Source:NCBI gene;... [more]
tph1a0.000e+059.85tryptophan hydroxylase 1 [Source:NCBI gene;Acc:103... [more]
pah1.155e-15851.11phenylalanine hydroxylase [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of tph vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
tph1a0.000e+058.81tryptophan hydroxylase 1 (tryptophan 5-monooxygena... [more]
ENSPMAT00000000676.15.423e-10952.67pep scaffold:Pmarinus_7.0:GL477040:200355:204568:-... [more]
ENSPMAT00000001726.15.998e-2337.69pep scaffold:Pmarinus_7.0:GL477470:183489:194417:1... [more]
ENSPMAT00000006904.17.128e-1038.03pep scaffold:Pmarinus_7.0:GL491535:768:2811:-1 gen... [more]
back to top
BLAST of tph vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of tph vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO317451.299e-13949.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of tph vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tph10.000e+057.66tryptophan hydroxylase 1 [Source:NCBI gene;Acc:101... [more]
tph10.000e+059.48tryptophan hydroxylase 1 [Source:NCBI gene;Acc:101... [more]
tph20.000e+059.60tryptophan hydroxylase 2 [Source:NCBI gene;Acc:101... [more]
tph1b0.000e+056.77tryptophan 5-hydroxylase 1 [Source:NCBI gene;Acc:1... [more]
tph1b0.000e+057.14tryptophan 5-hydroxylase 1 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of tph vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000000522.10.000e+099.82SMESG000000522.1[more]
SMESG000000522.10.000e+099.79SMESG000000522.1[more]
SMESG000077798.11.163e-15548.78SMESG000077798.1[more]
SMESG000034472.14.992e-12050.59SMESG000034472.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30012020
GenBankAGS83411.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012020 ID=SMED30012020|Name=tph|organism=Schmidtea mediterranea sexual|type=transcript|length=1774bp
TATAAAACGAGAAAAAAATTTTTAAAAGTCATTTCATTTTTTCCCCTCTT
TCAACAAACAGAAATTCGAGTTTTTATTTTCAGTTCCCCATATTTACTCA
GTGACAAATGTCCGATAGGGAGAAAGAAAAAGTGAGCAACAAAAGAAATT
CAATCATATCTTTGACGAAGGCAAAGTCGGTGGGCGAGAGTTCAATCCAA
ATAAATACGGCCAAAACCAGACGAGGAAGATTTTCAAGCGTCAGCAGCAT
GATTGACGAAGAAGATTTTGAAATAATAAAGGGCGAGTTATTCGACTTGA
ACATCGTCATGGAAGAAAATAAAACTATTTCAACTCGCCGGTCGACTTCA
TTCATTTTTGGAGTGAATGATAACGTCAAAGGACTCGTGAGGGTTTTGGA
GATATTTGAAAAATTCCGTGTTTCTGTCATTCATATCGAGACGAGAAAAT
CGCTGAAAAACAAATCGAAATTCGAAATTTTCATCGACGTCGACTGCAGA
AAAGACGAGATCAAAAGCTTGATAGAATGTTTGCAACAGAAAATAGATGA
CGATTTTCACGTTCAAGAGGTCGACATGATCTCGTCAAATATCAATGGTA
TTAGAATTGACACTTTTGATCTAGCAGCGAGCGAGATAGGCGAACAAAAC
ATTCAACTTAAAAACAAAAAACCTGGAATGACAGTGGATAACTTGCCTTG
GTTTCCTAAATATATCAAGGATCTAGACAAAATATCAAATCGCGTTATTA
TGTATGGATCTGAACTTGATGCTGATCATCCTGGATTTAAAGATGAAGTT
TATAGGTTACGTCGAAATCAGTTTTCCGAAATAGCTTACTCATACAAACA
TGGAAACCCAATTCCGAAAATTGAATATACAAACGAAGAAATTAAGACTT
GGGGAAATGTTTACCGAGAGTTGACTAAATTATATCCAACTCATGCTTGT
CGGGAGTTCTTGCAGAATTTGCCGCTTTTACAAAAGTACTGTGGATACAG
AGAAGATAATATTCCTCAACTCGAAGATGTTTCTCAATTTTTAAAGAGTC
GATCCGGATTTACTCTACGACCAGTGGCAGGCTATTTGAGTTCTAGAGAC
TTTTTAGCTGGTCTTGCATTCCGTGTATTTCACTGCACGCAATATATACG
CCATCCTTCGGATCCATTTTATACCCCAGAACCGGATTGCTGTCATGAAT
TAATGGGGCATGTACCTTTGTTGGCGGATTCAAGTTTTGCTCAGTTTTCT
CAAGAAATTGGGTTAGCATCCTTAGGAGCTTCCGAGGACGAAGTTCAAAG
ATTGGCTACGTGCTACTTCTTCACTATTGAATTTGGACTTTGTCATCAAG
ATGGAGAACTTCGAGCTTATGGAGCTGGTTTGTTGTCATCTATCGGTGAA
TTGAAACACGCCTTGAGTAATGAATCTAACATTCAAAAGTTTGACCCAAA
AACCGTGATGGAGCAAGAATGCCTAGTGACGACATTTCAGAATGCCTATT
TTTTCACTACTTCTTTTGAGGATGCTAAAGATAAAATGAGGGAATTCGCA
AAGACAATCAAGAAACCATTCGATGTCCATTACAACCCTTACACTCAAAT
GATCGAAACCCTCGACTCCACAGATTCCTTGACTAACGTCATAGACAATA
TCAAGGGAGAACTTGCAACAATTACAAATGCTTTAAGGAAATTCAACATT
TTTTGGCACGGAACTCAAATGGCGCAAATTAATAATTCAAATTAGCAAAA
AAATAGTTTCAAAACTACTTGAAC
back to top

protein sequence of SMED30012020-orf-1

>SMED30012020-orf-1 ID=SMED30012020-orf-1|Name=SMED30012020-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=546bp
MSDREKEKVSNKRNSIISLTKAKSVGESSIQINTAKTRRGRFSSVSSMID
EEDFEIIKGELFDLNIVMEENKTISTRRSTSFIFGVNDNVKGLVRVLEIF
EKFRVSVIHIETRKSLKNKSKFEIFIDVDCRKDEIKSLIECLQQKIDDDF
HVQEVDMISSNINGIRIDTFDLAASEIGEQNIQLKNKKPGMTVDNLPWFP
KYIKDLDKISNRVIMYGSELDADHPGFKDEVYRLRRNQFSEIAYSYKHGN
PIPKIEYTNEEIKTWGNVYRELTKLYPTHACREFLQNLPLLQKYCGYRED
NIPQLEDVSQFLKSRSGFTLRPVAGYLSSRDFLAGLAFRVFHCTQYIRHP
SDPFYTPEPDCCHELMGHVPLLADSSFAQFSQEIGLASLGASEDEVQRLA
TCYFFTIEFGLCHQDGELRAYGAGLLSSIGELKHALSNESNIQKFDPKTV
MEQECLVTTFQNAYFFTTSFEDAKDKMREFAKTIKKPFDVHYNPYTQMIE
TLDSTDSLTNVIDNIKGELATITNALRKFNIFWHGTQMAQINNSN*
back to top
Aliases
The feature 'tph' has the following synonyms
Synonym
tph
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004510tryptophan 5-monooxygenase activity
GO:0016491oxidoreductase activity
GO:0016714oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced pteridine as one donor, and incorporation of one atom of oxygen
GO:0004497monooxygenase activity
GO:0005506iron ion binding
GO:0016597amino acid binding
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0042427serotonin biosynthetic process
GO:0055114oxidation-reduction process
GO:0009072aromatic amino acid family metabolic process
GO:0008152metabolic process
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000031pigment cup cell
PLANA:0000036eye
PLANA:0000075optic cup
PLANA:0000080peripheral nervous system
PLANA:0000099neuron
PLANA:0000103central nervous system
PLANA:0000105secretory cell
PLANA:0000142posterior region of the whole animal
PLANA:0000143ventral region of the whole animal
PLANA:0000418head
PLANA:0000420parapharyngeal region
PLANA:0000481serotonergic neuron
Vocabulary: INTERPRO
TermDefinition
IPR036951ArAA_hydroxylase_sf
IPR041904TrpOH_cat
IPR036329Aro-AA_hydroxylase_C_sf
IPR019774Aromatic-AA_hydroxylase_C
IPR001273ArAA_hydroxylase
IPR019773Tyrosine_3-monooxygenase-like
IPR018301ArAA_hydroxylase_Fe/CU_BS
IPR002912ACT_dom
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR019774Aromatic amino acid hydroxylase, C-terminalPRINTSPR00372FYWHYDRXLASEcoord: 225..244
score: 60.65
coord: 380..399
score: 72.39
coord: 486..504
score: 54.69
coord: 420..438
score: 75.51
coord: 451..470
score: 40.43
coord: 316..338
score: 79.96
IPR019774Aromatic amino acid hydroxylase, C-terminalPFAMPF00351Biopterin_Hcoord: 197..526
e-value: 7.7E-172
score: 570.8
IPR019774Aromatic amino acid hydroxylase, C-terminalPROSITEPS51410BH4_AAA_HYDROXYL_2coord: 182..530
score: 142.82
IPR036951Aromatic amino acid hydroxylase superfamilyGENE3DG3DSA:1.10.800.10coord: 189..534
e-value: 1.9E-168
score: 561.6
IPR019773Tyrosine 3-monooxygenase-likePIRSFPIRSF000336THcoord: 2..532
e-value: 2.8E-203
score: 673.6
NoneNo IPR availableGENE3DG3DSA:3.30.70.260coord: 63..150
e-value: 4.0E-16
score: 60.5
NoneNo IPR availablePANTHERPTHR11473:SF16TRYPTOPHAN 5-HYDROXYLASE 2coord: 70..532
NoneNo IPR availableSUPERFAMILYSSF55021ACT-likecoord: 72..149
IPR001273Aromatic amino acid hydroxylasePANTHERPTHR11473AROMATIC AMINO ACID HYDROXYLASEcoord: 70..532
IPR018301Aromatic amino acid hydroxylase, iron/copper binding sitePROSITEPS00367BH4_AAA_HYDROXYL_1coord: 359..370
IPR002912ACT domainPROSITEPS51671ACTcoord: 81..160
score: 10.822
IPR041904Tryptophan 5-hydroxylase, catalytic domainCDDcd03346eu_TrpOHcoord: 197..483
e-value: 0.0
score: 580.608
IPR036329Aromatic amino acid monoxygenase, C-terminal domain superfamilySUPERFAMILYSSF56534Aromatic aminoacid monoxygenases, catalytic and oligomerization domainscoord: 196..529