Deoxyribonuclease II

Overview
NameDeoxyribonuclease II
Smed IDSMED30011994
Length (bp)1046
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Deoxyribonuclease II (SMED30011994) t-SNE clustered cells

Violin plots show distribution of expression levels for Deoxyribonuclease II (SMED30011994) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Deoxyribonuclease II (SMED30011994) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Deoxyribonuclease II (SMED30011994) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011994

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30011994SMESG000060779.1 Contig4893GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30011994SMESG000062993.1 Contig4893GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30011994SMESG000062993.1 dd_Smed_v4_1643_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30011994SMESG000062993.1 dd_Smed_v4_1643_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Deoxyribonuclease II vs. Ensembl Human
Match: DNASE2B (deoxyribonuclease 2 beta [Source:HGNC Symbol;Acc:HGNC:28875])

HSP 1 Score: 107.457 bits (267), Expect = 9.980e-26
Identity = 72/257 (28.02%), Postives = 126/257 (49.03%), Query Frame = 1
Query:  115 LSCKNDNNQDIEWFIGLKFPKS---------YKFVYISSQSETWTMSKFDLSSKNNMIGWTIEQTYSSHQSQS---FYAYYNDETPKFTYSSR--GHLKGVISFDINNGFWLIHSVPLFPTFGN--YTYGKAEEIYGQSFICVSLESENLQNIEN--FPVNDKL------KTLLTNFINNKNMKIQQTNMTIIMKTLKSL------PLVHFGKSYSFGQDLYSGLVAPGLQASIMVESWIRG-EKVDSTCGTNYHVY 792
            +SC+N+  + ++WF   K PK           +++Y+ S + +W  S+  ++   +++G T++Q Y ++ S+S    Y  YND  PK    SR  GH KG++ ++   GFWLIHS+P FP      Y Y       GQS IC++ +    + I++     N  +       T     I+   +  + ++  I  + L +L        +HF KS SF  D+++  +A  L+  ++ E+W R  +++ S C   YHVY
Sbjct:   30 ISCRNEEGKAVDWFTFYKLPKRQNKESGETGLEYLYLDSTTRSWRKSEQLMNDTKSVLGRTLQQLYEAYASKSNNTAYLIYNDGVPKPVNYSRKYGHTKGLLLWNRVQGFWLIHSIPQFPPIPEEGYDYPPTGRRNGQSGICITFKYNQYEAIDSQLLVCNPNVYSCSIPATFHQELIHMPQLCTRASSSEIPGRLLTTLQSAQGQKFLHFAKSDSFLDDIFAAWMAQRLKTHLLTETWQRKRQELPSNCSLPYHVY 286          
BLAST of Deoxyribonuclease II vs. Ensembl Human
Match: DNASE2 (deoxyribonuclease 2, lysosomal [Source:HGNC Symbol;Acc:HGNC:2960])

HSP 1 Score: 105.531 bits (262), Expect = 4.963e-25
Identity = 68/255 (26.67%), Postives = 117/255 (45.88%), Query Frame = 1
Query:   70 VALIFNILHQLAICELSCKNDNNQDIEWFIGLKFP----------KSYKFVYISSQSETWTMSKFDLSSKNNMIGWTIEQTYSSHQSQSFYAYYNDETPKFTY----SSRGHLKGVISFDINNGFWLIHSVPLFP---TFGNYTYGKAEEIYGQSFICVSLESENLQNIE-----NFP--VNDKLKTL-------LTNFINNKNMKIQQTNMTIIMKTLKSLPLVHFGKSYSFGQDLYSGLVAPGLQASIMVESW 741
            + L+   L  +    L+C  D+ Q ++WF+  K P          +  ++ Y+   S  W   +  ++S    +G +++  Y S+ SQ  +  YND+ P+ +     S RGH KGV+  D + GFWL+HSVP FP   +   Y++  +   YGQ+ +CVS        +       +P   N +L+ +       L N +   ++  +  N +I + +        F K   FG DLYSG +A  L  ++ V+ W
Sbjct:    2 IPLLLAALLCVPAGALTCYGDSGQPVDWFVVYKLPALRGSGEAAQRGLQYKYLDESSGGWRDGRALINSPEGAVGRSLQPLYRSNTSQLAFLLYNDQPPQPSKAQDSSMRGHTKGVLLLDHDGGFWLVHSVPNFPPPASSAAYSWPHSACTYGQTLLCVSFPFAQFSKMGKQLTYTYPWVYNYQLEGIFAQEFPDLENVVKGHHVSQEPWNSSITLTSQAGAVFQSFAKFSKFGDDLYSGWLAAALGTNLQVQFW 256          
BLAST of Deoxyribonuclease II vs. Ensembl Human
Match: DNASE2 (deoxyribonuclease 2, lysosomal [Source:HGNC Symbol;Acc:HGNC:2960])

HSP 1 Score: 62.3882 bits (150), Expect = 1.113e-10
Identity = 54/238 (22.69%), Postives = 96/238 (40.34%), Query Frame = 1
Query:   70 VALIFNILHQLAICELSCKNDNNQDIEWFIGLKFP----------KSYKFVYISSQSETWTMSKFDLSSKNNMIGWTIEQTYSSHQSQSFYAYYNDETPKFTY----SSRGHLKGVISFDINNGFWLIHSVPLFPTFGNYTYGKAEEIYGQSFICVSLESENLQNIENFPVNDKLKTLLTNFINNKNMKIQQTNMTIIMKTLKSLPLVHFGKSYSFGQDLYSGLVAPGLQASIMVESW 741
            + L+   L  +    L+C  D+ Q ++WF+  K P          +  ++ Y+   S  W   +  ++S    +G +++  Y S+ SQ  +  YND+ P+ +     S RGH KG           L ++ P       Y Y + E I+ Q F        +L+N+                +   ++  +  N +I + +        F K   FG DLYSG +A  L  ++ V+ W
Sbjct:    2 IPLLLAALLCVPAGALTCYGDSGQPVDWFVVYKLPALRGSGEAAQRGLQYKYLDESSGGWRDGRALINSPEGAVGRSLQPLYRSNTSQLAFLLYNDQPPQPSKAQDSSMRGHTKGKQ---------LTYTYPWV-----YNY-QLEGIFAQEF-------PDLENV----------------VKGHHVSQEPWNSSITLTSQAGAVFQSFAKFSKFGDDLYSGWLAAALGTNLQVQFW 201          
BLAST of Deoxyribonuclease II vs. Ensembl Celegans
Match: crn-7 (Cell-death-related nuclease 7 [Source:UniProtKB/Swiss-Prot;Acc:P34387])

HSP 1 Score: 135.191 bits (339), Expect = 2.092e-36
Identity = 82/258 (31.78%), Postives = 139/258 (53.88%), Query Frame = 1
Query:   76 LIFNILHQLAICELSCKNDNNQDIEWFIGLKFPK-------SYKFVYISSQSETWTMSKFDLSSKNNMIGWTIEQTYSSHQSQSFYAYYNDETP-KFTYSSRGHLKGVISFDINNGFWLIHSVPLFPTFGNYTYGKAEEIYGQSFICVSLE-------SENLQNIENFP-VNDKLKTLLTNFINNKNMKIQQTN--------MTIIMKTLKSLPLVHFGKSYSFGQDLYSGLVAPGLQASIMVESWIR--GEKVDSTC 771
            LIF+++      ++ CKN   + ++WF+  K PK         +FVY  ++S  WT    D++  N  +G T+ Q YS+ +S +F+  Y+D+ P K   S RGH KGV  FD   GFWLIHSVP FP   +++Y    E YGQSF C S+E       +E+ + I+  P + +  +   T F   KN++ +Q+         ++  +KT++ + L+ + K   F  D+++ L++   + ++ VESW+   G+ + +TC
Sbjct:    7 LIFSVIFTTGNGKIQCKNMRGKSVDWFVVYKLPKLSGAGTSGKEFVYFDAESSDWTRGN-DINDPNVAVGATVSQVYSADKSNNFWFMYSDDDPIKSADSYRGHAKGVSLFDSTTGFWLIHSVPNFPPIKSFSYPNTAEKYGQSFFCASMEVQHLTELAEHWKYIQATPYIINIPEKYATRFPTLKNVEAKQSLPRSATQFWISKPIKTVQGVTLMAYAKHKKFDGDIWNDLISRQNKVTLAVESWLNGSGDDIHTTC 263          
BLAST of Deoxyribonuclease II vs. Ensembl Celegans
Match: crn-6 (Cell death-related nuclease 6 [Source:UniProtKB/Swiss-Prot;Acc:P34508])

HSP 1 Score: 118.627 bits (296), Expect = 3.959e-30
Identity = 78/262 (29.77%), Postives = 125/262 (47.71%), Query Frame = 1
Query:   61 IIQVALIFNILHQLAICELSCKNDNNQDIEWFIGLKFPKSYK------------FVYISSQSETWTMSKFDLSSKNNMIGWTIEQTYSSHQSQSFYAYYNDETPKFTY--SSRGHLKGVISFDINNGFWLIHSVPLFPTFGNYTYGKAEEIYGQSFICVSLESENLQNIE---------------------NFPVNDKLKTLLTNFINNKNMKIQQTNMTIIMKTLKSLPLVHFGKSYSFGQDLYSGLVAPGLQASIMVESW 741
            I Q+ LI +++  ++     CK++N  +++WF+  K P  +             F+Y    ++ W +    +  +NN + +T++Q Y+S+ + +F   YNDE P  T   +S GH KGV  FD   GFW+IHS+P FP+   + +      YGQ  IC+S  + +L  I                       FPV  +LK       N +  K      T ++K+L      HF K+  +G+DLYS  V P L++SI VE+W
Sbjct:    2 IRQIILIVSLI-GISNAAYQCKDNNGSNVDWFVFYKLPHLWNHPDNVPISNGTGFLYFDVNNKNWKLMPQGMDVENNAVYYTLQQYYNSNMNTTFSYMYNDEWPDSTIWSNSSGHAKGVTVFDQYTGFWMIHSIPKFPSKDMFRFPSNAHYYGQMGICISYNTVSLATIAQQLFYYNTFTYQFNLPQSFANQFPVLSQLK-------NKEYNKSPPLTSTKVLKSLGGQHFRHFAKTGEWGKDLYSDFVGPTLKSSIKVETW 255          
BLAST of Deoxyribonuclease II vs. Ensembl Celegans
Match: crn-6 (Cell death-related nuclease 6 [Source:UniProtKB/Swiss-Prot;Acc:P34508])

HSP 1 Score: 118.627 bits (296), Expect = 3.959e-30
Identity = 78/262 (29.77%), Postives = 125/262 (47.71%), Query Frame = 1
Query:   61 IIQVALIFNILHQLAICELSCKNDNNQDIEWFIGLKFPKSYK------------FVYISSQSETWTMSKFDLSSKNNMIGWTIEQTYSSHQSQSFYAYYNDETPKFTY--SSRGHLKGVISFDINNGFWLIHSVPLFPTFGNYTYGKAEEIYGQSFICVSLESENLQNIE---------------------NFPVNDKLKTLLTNFINNKNMKIQQTNMTIIMKTLKSLPLVHFGKSYSFGQDLYSGLVAPGLQASIMVESW 741
            I Q+ LI +++  ++     CK++N  +++WF+  K P  +             F+Y    ++ W +    +  +NN + +T++Q Y+S+ + +F   YNDE P  T   +S GH KGV  FD   GFW+IHS+P FP+   + +      YGQ  IC+S  + +L  I                       FPV  +LK       N +  K      T ++K+L      HF K+  +G+DLYS  V P L++SI VE+W
Sbjct:    2 IRQIILIVSLI-GISNAAYQCKDNNGSNVDWFVFYKLPHLWNHPDNVPISNGTGFLYFDVNNKNWKLMPQGMDVENNAVYYTLQQYYNSNMNTTFSYMYNDEWPDSTIWSNSSGHAKGVTVFDQYTGFWMIHSIPKFPSKDMFRFPSNAHYYGQMGICISYNTVSLATIAQQLFYYNTFTYQFNLPQSFANQFPVLSQLK-------NKEYNKSPPLTSTKVLKSLGGQHFRHFAKTGEWGKDLYSDFVGPTLKSSIKVETW 255          
BLAST of Deoxyribonuclease II vs. Ensembl Celegans
Match: crn-6 (Cell death-related nuclease 6 [Source:UniProtKB/Swiss-Prot;Acc:P34508])

HSP 1 Score: 118.627 bits (296), Expect = 4.012e-30
Identity = 78/262 (29.77%), Postives = 125/262 (47.71%), Query Frame = 1
Query:   61 IIQVALIFNILHQLAICELSCKNDNNQDIEWFIGLKFPKSYK------------FVYISSQSETWTMSKFDLSSKNNMIGWTIEQTYSSHQSQSFYAYYNDETPKFTY--SSRGHLKGVISFDINNGFWLIHSVPLFPTFGNYTYGKAEEIYGQSFICVSLESENLQNIE---------------------NFPVNDKLKTLLTNFINNKNMKIQQTNMTIIMKTLKSLPLVHFGKSYSFGQDLYSGLVAPGLQASIMVESW 741
            I Q+ LI +++  ++     CK++N  +++WF+  K P  +             F+Y    ++ W +    +  +NN + +T++Q Y+S+ + +F   YNDE P  T   +S GH KGV  FD   GFW+IHS+P FP+   + +      YGQ  IC+S  + +L  I                       FPV  +LK       N +  K      T ++K+L      HF K+  +G+DLYS  V P L++SI VE+W
Sbjct:    2 IRQIILIVSLI-GISNAAYQCKDNNGSNVDWFVFYKLPHLWNHPDNVPISNGTGFLYFDVNNKNWKLMPQGMDVENNAVYYTLQQYYNSNMNTTFSYMYNDEWPDSTIWSNSSGHAKGVTVFDQYTGFWMIHSIPKFPSKDMFRFPSNAHYYGQMGICISYNTVSLATIAQQLFYYNTFTYQFNLPQSFANQFPVLSQLK-------NKEYNKSPPLTSTKVLKSLGGQHFRHFAKTGEWGKDLYSDFVGPTLKSSIKVETW 255          
BLAST of Deoxyribonuclease II vs. Ensembl Celegans
Match: crn-6 (Cell death-related nuclease 6 [Source:UniProtKB/Swiss-Prot;Acc:P34508])

HSP 1 Score: 118.627 bits (296), Expect = 4.012e-30
Identity = 78/262 (29.77%), Postives = 125/262 (47.71%), Query Frame = 1
Query:   61 IIQVALIFNILHQLAICELSCKNDNNQDIEWFIGLKFPKSYK------------FVYISSQSETWTMSKFDLSSKNNMIGWTIEQTYSSHQSQSFYAYYNDETPKFTY--SSRGHLKGVISFDINNGFWLIHSVPLFPTFGNYTYGKAEEIYGQSFICVSLESENLQNIE---------------------NFPVNDKLKTLLTNFINNKNMKIQQTNMTIIMKTLKSLPLVHFGKSYSFGQDLYSGLVAPGLQASIMVESW 741
            I Q+ LI +++  ++     CK++N  +++WF+  K P  +             F+Y    ++ W +    +  +NN + +T++Q Y+S+ + +F   YNDE P  T   +S GH KGV  FD   GFW+IHS+P FP+   + +      YGQ  IC+S  + +L  I                       FPV  +LK       N +  K      T ++K+L      HF K+  +G+DLYS  V P L++SI VE+W
Sbjct:    2 IRQIILIVSLI-GISNAAYQCKDNNGSNVDWFVFYKLPHLWNHPDNVPISNGTGFLYFDVNNKNWKLMPQGMDVENNAVYYTLQQYYNSNMNTTFSYMYNDEWPDSTIWSNSSGHAKGVTVFDQYTGFWMIHSIPKFPSKDMFRFPSNAHYYGQMGICISYNTVSLATIAQQLFYYNTFTYQFNLPQSFANQFPVLSQLK-------NKEYNKSPPLTSTKVLKSLGGQHFRHFAKTGEWGKDLYSDFVGPTLKSSIKVETW 255          
BLAST of Deoxyribonuclease II vs. Ensembl Fly
Match: DNaseII (gene:FBgn0000477 transcript:FBtr0083538)

HSP 1 Score: 114.775 bits (286), Expect = 9.702e-29
Identity = 74/246 (30.08%), Postives = 122/246 (49.59%), Query Frame = 1
Query:  103 AICELSCKNDNNQDIEWFIGLKFPKSY------------KFVYISSQS-ETWTMSKFDLSSKNNMIGWTIEQTYSSHQSQSFYAYYNDETPKFT-YSSRGHLKGVISFDINNGFWLIHSVPLFPTFGNYTYGKAEEIYGQSFICVSLESENLQNIENFPV----------------NDKLKTLLTNFINNKNMKIQQTNMTIIMKTLKSLPLVHFGKSYSFGQDLYSGLVAPGLQASIMVESWIRG 750
            A  ++SCK++   D++W+   K PK Y            K++Y++SQ+ +TW MS   +S   ++   T+    +   S +  A YND+ P  T +SS GH KGV++ D     W++HSVP FPT  +Y+Y  + E Y QS +CV+L+ E+L+ +    V                +D+L   L   ++ +          + +++L       FGKS     +LY+ +VAP L  S+ VE+W  G
Sbjct:   19 AKSKVSCKDEAGNDVDWWHLYKLPKHYQHNDLGKDTSGLKYLYVTSQNYDTWQMSGKFISDPLSLPAQTL-NPLNDDPSHTLLAAYNDQQPNGTVFSSGGHAKGVVASDGETAIWIVHSVPKFPTIPDYSYPTSGEQYAQSMLCVTLKGEDLEKVGQILVYNEPHFYYQRNPLATRSDELFPSLERALHGQWRTESPFQKDLEVRSLDGKKFRLFGKSGRANVELYADVVAPTLDVSLFVEAWRDG 263          
BLAST of Deoxyribonuclease II vs. Ensembl Zebrafish
Match: dnase2b (deoxyribonuclease II beta [Source:ZFIN;Acc:ZDB-GENE-090824-2])

HSP 1 Score: 128.257 bits (321), Expect = 7.574e-34
Identity = 78/261 (29.89%), Postives = 127/261 (48.66%), Query Frame = 1
Query:   88 ILHQLAICELSCKNDNNQDIEWFIGLKFP--------KSYKFVYISSQSETWTMSKFDLSSKNNMIGWTIEQTYSSHQS-QSFYAYYNDETPKFTYSSR-GHLKGVISFDINNGFWLIHSVPLFPTFG--NYTYGKAEEIYGQSFICVSLESENLQNIE-------------NFPVNDKLKT-LLTNFINNKNMKIQQTNMTIIMKTLKSLPLVHFGKSYSFGQDLYSGLVAPGLQASIMVESWI-RGEKVDSTCGTNYHV 789
            +L QL+ C +SC N++ Q ++WFI  K P            ++Y+      + +SK+ ++S    +G T+ Q YS + S  S Y  YND  P+  Y S+ GH KGV+ FD + GFWL HSVP FP F   NY+Y    + YGQ+ +C++        I              + PV  +     +    + K   I+       +++++      F KS ++  D+Y+G VA  L   ++VESW+ +  ++ S C   +HV
Sbjct:    3 VLFQLSACLISCLNEDGQPVDWFIMYKLPIYKMEVKGSGVDYMYLDPSIMDFQISKYTVNSSTGALGRTLTQLYSGYTSNSSVYMLYNDAPPELKYPSKYGHTKGVLMFDQDQGFWLTHSVPHFPPFPERNYSYPLTGKYYGQTLLCITFNYTQFPRISWQLAYLNPRVYNCSVPVAFRPDIGEMAQICDGKTPAIKNRRSLQKLQSVQGQTFFSFAKSQNYVDDIYTGWVAQALGTDLLVESWLHQAHQLPSNCSLPWHV 263          
BLAST of Deoxyribonuclease II vs. Ensembl Zebrafish
Match: dnase2b (deoxyribonuclease II beta [Source:ZFIN;Acc:ZDB-GENE-090824-2])

HSP 1 Score: 120.939 bits (302), Expect = 5.083e-31
Identity = 79/272 (29.04%), Postives = 127/272 (46.69%), Query Frame = 1
Query:   88 ILHQLAICEL-----------SCKNDNNQDIEWFIGLKFP--------KSYKFVYISSQSETWTMSKFDLSSKNNMIGWTIEQTYSSHQS-QSFYAYYNDETPKFTYSSR-GHLKGVISFDINNGFWLIHSVPLFPTFG--NYTYGKAEEIYGQSFICVSLESENLQNIE-------------NFPVNDKLKT-LLTNFINNKNMKIQQTNMTIIMKTLKSLPLVHFGKSYSFGQDLYSGLVAPGLQASIMVESWI-RGEKVDSTCGTNYHV 789
            +L QL+ C L           SC N++ Q ++WFI  K P            ++Y+      + +SK+ ++S    +G T+ Q YS + S  S Y  YND  P+  Y S+ GH KGV+ FD + GFWL HSVP FP F   NY+Y    + YGQ+ +C++        I              + PV  +     +    + K   I+       +++++      F KS ++  D+Y+G VA  L   ++VESW+ +  ++ S C   +HV
Sbjct:    3 VLFQLSACCLLFLMGFSEAVISCLNEDGQPVDWFIMYKLPIYKMEVKGSGVDYMYLDPSIMDFQISKYTVNSSTGALGRTLTQLYSGYTSNSSVYMLYNDAPPELKYPSKYGHTKGVLMFDQDQGFWLTHSVPHFPPFPERNYSYPLTGKYYGQTLLCITFNYTQFPRISWQLAYLNPRVYNCSVPVAFRPDIGEMAQICDGKTPAIKNRRSLQKLQSVQGQTFFSFAKSQNYVDDIYTGWVAQALGTDLLVESWLHQAHQLPSNCSLPWHV 274          
BLAST of Deoxyribonuclease II vs. Ensembl Zebrafish
Match: dnase2 (deoxyribonuclease II, lysosomal [Source:ZFIN;Acc:ZDB-GENE-010724-16])

HSP 1 Score: 104.375 bits (259), Expect = 7.102e-25
Identity = 79/275 (28.73%), Postives = 125/275 (45.45%), Query Frame = 1
Query:   79 IFNILH--QLAICELSCKNDNNQDIEWFIGLKFPKSY--------KFVYISSQSETWTMSKFDLSSKNNMIGWTIEQTYSSHQSQSFYAYYNDETPK---FTYSSR--GHLKGVISFDINNGFWLIHSVPLFP---TFGNYTYGKAEEIYGQSFICVSLESENLQNI-ENFPVND-----------------KLKTLLTNFINN-KNMKIQQTNMTIIMKTLKSLPLVHFGKSYSFGQDLYSGLVAPGLQASIMVESWIRGEKV-DSTCGTNYHV 789
            +  +LH  + A   +SC ND  + ++W+   K P  +        K++++  +SE WT     ++   + +G T+   Y        Y  YND+ PK      +SR  GH KGV+ FD   GFWL+HS P FP   + G ++Y  +    GQ+FICV+   E  Q I E   +N                   +  L  + ++   N     +N +I + +L     + F K  SF  DLY   VAP LQ++++V+ W R   +  S C  N+ V
Sbjct:    5 VLLLLHASRGAFSSISCYNDQGKPVDWYYLYKLPHEHHTPLEEGLKYLFMDVESEGWTDGTTLVNDTQSAVGRTVGPLYEG--GDVGYILYNDQPPKQKQVEGASRSCGHTKGVVVFDKEQGFWLVHSTPHFPPPKSEGQFSYPTSGISNGQNFICVTYPFERFQTIGEQLKINQPHIFDCSIPGSLATAVPAMAQLCKHTLDRWDNTSSSPSNRSISLLSLAKTEFISFAKGASFANDLYHSWVAPTLQSNLLVQFWRRSTGILPSDCSPNWEV 277          
BLAST of Deoxyribonuclease II vs. Ensembl Zebrafish
Match: dnase2 (deoxyribonuclease II, lysosomal [Source:ZFIN;Acc:ZDB-GENE-010724-16])

HSP 1 Score: 104.375 bits (259), Expect = 7.102e-25
Identity = 79/275 (28.73%), Postives = 125/275 (45.45%), Query Frame = 1
Query:   79 IFNILH--QLAICELSCKNDNNQDIEWFIGLKFPKSY--------KFVYISSQSETWTMSKFDLSSKNNMIGWTIEQTYSSHQSQSFYAYYNDETPK---FTYSSR--GHLKGVISFDINNGFWLIHSVPLFP---TFGNYTYGKAEEIYGQSFICVSLESENLQNI-ENFPVND-----------------KLKTLLTNFINN-KNMKIQQTNMTIIMKTLKSLPLVHFGKSYSFGQDLYSGLVAPGLQASIMVESWIRGEKV-DSTCGTNYHV 789
            +  +LH  + A   +SC ND  + ++W+   K P  +        K++++  +SE WT     ++   + +G T+   Y        Y  YND+ PK      +SR  GH KGV+ FD   GFWL+HS P FP   + G ++Y  +    GQ+FICV+   E  Q I E   +N                   +  L  + ++   N     +N +I + +L     + F K  SF  DLY   VAP LQ++++V+ W R   +  S C  N+ V
Sbjct:    5 VLLLLHASRGAFSSISCYNDQGKPVDWYYLYKLPHEHHTPLEEGLKYLFMDVESEGWTDGTTLVNDTQSAVGRTVGPLYEG--GDVGYILYNDQPPKQKQVEGASRSCGHTKGVVVFDKEQGFWLVHSTPHFPPPKSEGQFSYPTSGISNGQNFICVTYPFERFQTIGEQLKINQPHIFDCSIPGSLATAVPAMAQLCKHTLDRWDNTSSSPSNRSISLLSLAKTEFISFAKGASFANDLYHSWVAPTLQSNLLVQFWRRSTGILPSDCSPNWEV 277          
BLAST of Deoxyribonuclease II vs. Ensembl Xenopus
Match: dnase2b (deoxyribonuclease II beta [Source:NCBI gene;Acc:496759])

HSP 1 Score: 122.094 bits (305), Expect = 2.761e-31
Identity = 75/263 (28.52%), Postives = 127/263 (48.29%), Query Frame = 1
Query:  100 LAICELSCKNDNNQDIEWFIGLKFP---------KSYKFVYISSQSETWTMSKFDLSSKNNMIGWTIEQTYSSH-QSQSFYAYYNDETPKFTYSSR-GHLKGVISFDINNGFWLIHSVPLFPTF--GNYTYGKAEEIYGQSFICVSLESENLQNIENFPVNDKLKTLLTNFINNKNMKIQQTNMTIIMK-------------------TLKSLPLVHFGKSYSFGQDLYSGLVAPGLQASIMVESWIRGEKVDSTCGTNYHVY 792
            +   E+SC+N+    I+WF+  K P             ++Y+ S ++ W +SKF +++  + +G  ++Q Y  + ++ + Y  YND  P  T S+R GH KG++ FD + GFWLIHSVP FP +    Y Y    + +GQ+ ICV+ +    + I       +L     N  N     I Q  M ++ K                   + +    ++F KS  F  D+++  +A  L+ +++VESW   +++ S C   YHVY
Sbjct:    3 MVAAEISCRNEAGDPIDWFVVYKLPMLKMNGSTGSGLDYLYMDSTNQEWQISKFQINTTKSAVGQVLQQLYQDYDKNNTVYMIYNDAPPNVTNSTRKGHTKGILFFDNSQGFWLIHSVPHFPPYPEDGYGYPSTGKRFGQTAICVTYQYNEFKEIAT-----QLLYYNPNVYNCSVPDIYQKEMWMLHKICLGGHFPWIDSTRLTQLNSARGEVFLNFAKSKYFIDDIFAAWIAQKLRTNMLVESWQSRQQLSSNCSLQYHVY 260          
BLAST of Deoxyribonuclease II vs. Ensembl Xenopus
Match: dnase2 (deoxyribonuclease II, lysosomal [Source:NCBI gene;Acc:733868])

HSP 1 Score: 95.9005 bits (237), Expect = 1.138e-21
Identity = 73/258 (28.29%), Postives = 112/258 (43.41%), Query Frame = 1
Query:  118 SCKNDNNQDIEWFIGLKFPK--------SYKFVYISSQSETWTMSKFDLSSKNNMIGWTIEQTYSSHQSQSF-YAYYNDETPKFTYSS--RGHLKGVISFDINNGFWLIHSVPLFPTFGNYTYGKAEEIY--GQSFICVSLESENLQNI-----------------ENFPVN-DKLKTLLTNFINNKNMKIQQT-NMTIIMKTLKSLPLVHFGKSYSFGQDLYSGLVAPGLQASIMVESWIRGEKV-DSTCGTNYHVY 792
            SC  D+ + ++WFI  K P+           +VY  S S  W      ++S ++ +G T+ Q Y +   +   Y  YNDE    + S   RGH KG++  D   GFWL+HS P FP   + +Y      +  GQSF+CV+   +   +I                 E+F V+  +LKT        K    Q   N  +++ ++       F K   F  DLYSG V+  L++ + V+ W     V  S C   +H Y
Sbjct:   20 SCYGDHGKQVDWFIVYKLPQLRNKGEEAGMTYVYQDSSSGGWVPGATLMNSTDSAVGQTVSQLYKAFGMKDVAYILYNDEPANISSSGSDRGHTKGMLLLDKKQGFWLVHSTPRFPPPADQSYDWPLSAHRNGQSFLCVTYPYKQFGDIGQQLLYNTILPYDSSIPEDFSVDFPELKTAA-----EKGAVTQPPWNRQVVLTSVGGKQFTSFSKHAHFSDDLYSGWVSQVLKSHLFVQFWQNSRGVLPSNCSLPFHTY 272          
BLAST of Deoxyribonuclease II vs. Ensembl Mouse
Match: Dnase2b (deoxyribonuclease II beta [Source:MGI Symbol;Acc:MGI:1913283])

HSP 1 Score: 123.25 bits (308), Expect = 1.083e-31
Identity = 78/275 (28.36%), Postives = 136/275 (49.45%), Query Frame = 1
Query:   55 MKIIQVALIFNILHQLAICELSCKNDNNQDIEWFIGLKFPK---------SYKFVYISSQSETWTMSKFDLSSKNNMIGWTIEQTYSSHQSQSFYAY--YNDETPKFTYSSR--GHLKGVISFDINNGFWLIHSVPLFPTFGNYTYGKAEEIYGQSFICVSLESENLQNIENFPVNDKLKTLLTNFINN---------KNMKIQQTNMTIIMKTL------KSLPLVHFGKSYSFGQDLYSGLVAPGLQASIMVESW-IRGEKVDSTCGTNYHVY 792
            ++ +   L F +   L   E+SC+N+  + ++WFI  K PK           +++Y+ S  +TW  S + ++S  + +G T++  Y +H S +  AY  YND  P     SR  GH KG++ ++   GFWLIHSVP FP    Y Y  +   YGQ+ IC++      + I+ F +      + + FI +           M    +++ I ++ L      + L  VHF KS  +  D+++G +A  L+  ++ ++W  + +++ S C   YHVY
Sbjct:    6 LRTVLSLLFFALSGVLGTPEISCRNEYGEAVDWFIFYKLPKRTSKASEEAGLQYLYLDSTRQTWNKSLYLINSTRSALGRTLQHLYDTHNSTNDTAYLIYNDGVPGSVNYSRQYGHAKGLLVWNRTQGFWLIHSVPKFPPVHGYEYPTSGRRYGQTGICITFGYSQFEEID-FQLLVLQPNIYSCFIPSTFHWKLIYMPRMCANSSSLKIPVRYLAELHSAQGLNFVHFAKSSFYTDDIFTGWIAQKLKTHLLAQTWQKKKQELPSNCSLPYHVY 279          
BLAST of Deoxyribonuclease II vs. Ensembl Mouse
Match: Dnase2b (deoxyribonuclease II beta [Source:MGI Symbol;Acc:MGI:1913283])

HSP 1 Score: 123.25 bits (308), Expect = 1.083e-31
Identity = 78/275 (28.36%), Postives = 136/275 (49.45%), Query Frame = 1
Query:   55 MKIIQVALIFNILHQLAICELSCKNDNNQDIEWFIGLKFPK---------SYKFVYISSQSETWTMSKFDLSSKNNMIGWTIEQTYSSHQSQSFYAY--YNDETPKFTYSSR--GHLKGVISFDINNGFWLIHSVPLFPTFGNYTYGKAEEIYGQSFICVSLESENLQNIENFPVNDKLKTLLTNFINN---------KNMKIQQTNMTIIMKTL------KSLPLVHFGKSYSFGQDLYSGLVAPGLQASIMVESW-IRGEKVDSTCGTNYHVY 792
            ++ +   L F +   L   E+SC+N+  + ++WFI  K PK           +++Y+ S  +TW  S + ++S  + +G T++  Y +H S +  AY  YND  P     SR  GH KG++ ++   GFWLIHSVP FP    Y Y  +   YGQ+ IC++      + I+ F +      + + FI +           M    +++ I ++ L      + L  VHF KS  +  D+++G +A  L+  ++ ++W  + +++ S C   YHVY
Sbjct:    6 LRTVLSLLFFALSGVLGTPEISCRNEYGEAVDWFIFYKLPKRTSKASEEAGLQYLYLDSTRQTWNKSLYLINSTRSALGRTLQHLYDTHNSTNDTAYLIYNDGVPGSVNYSRQYGHAKGLLVWNRTQGFWLIHSVPKFPPVHGYEYPTSGRRYGQTGICITFGYSQFEEID-FQLLVLQPNIYSCFIPSTFHWKLIYMPRMCANSSSLKIPVRYLAELHSAQGLNFVHFAKSSFYTDDIFTGWIAQKLKTHLLAQTWQKKKQELPSNCSLPYHVY 279          
BLAST of Deoxyribonuclease II vs. Ensembl Mouse
Match: Dnase2a (deoxyribonuclease II alpha [Source:MGI Symbol;Acc:MGI:1329019])

HSP 1 Score: 111.309 bits (277), Expect = 2.280e-27
Identity = 74/256 (28.91%), Postives = 117/256 (45.70%), Query Frame = 1
Query:  115 LSCKNDNNQDIEWFIGLKFP---------KSYKFVYISSQSETWTMSKFDLSSKNNMIGWTIEQTYSSHQSQSFYAYYNDETPKFTYS----SRGHLKGVISFDINNGFWLIHSVPLFP---TFGNYTYGKAEEIYGQSFICVSLESENLQNIE-----NFPV--NDKLKTL-------LTNFINNKNMKIQQTNMTIIMKTLKSLPLVHFGKSYSFGQDLYSGLVAPGLQASIMVESWIRGEKV-DSTCGTNYHV 789
            LSC  D+ Q ++WF+  K P         K   + Y+   S+ W      ++S    +G +++  Y  + SQ  +  YND+ PK + +      GH KGV+  D   GFWL+HSVP FP   + G YT+    + +GQ+ +CVSL       I       +P+  + KL+         L   I N+++  +  N ++I+ +        F K   FG DLYSG +A  L  ++ V+ W     +  S C   Y V
Sbjct:   20 LSCYGDSGQPVDWFVVYKLPAHSGSRDTPKGLTYKYMDQNSDGWQDGVGYINSSEGAVGRSLQPLYRKNSSQLAFLLYNDQPPKSSSARDSTGHGHTKGVLLLDQEGGFWLVHSVPRFPPPASSGAYTWPPNAQTFGQTLLCVSLPFTQFARIGKQLTYTYPLVYDHKLEGFFAQKLPDLETVIKNQHVLHEPWNSSVILTSQAGATFQSFAKFGKFGDDLYSGWLAEALGTNLQVQFWQNSPGILPSNCSGAYQV 275          
BLAST of Deoxyribonuclease II vs. Ensembl Mouse
Match: Dnase2a (deoxyribonuclease II alpha [Source:MGI Symbol;Acc:MGI:1329019])

HSP 1 Score: 98.5969 bits (244), Expect = 5.506e-23
Identity = 66/228 (28.95%), Postives = 105/228 (46.05%), Query Frame = 1
Query:  172 PKSYKFVYISSQSETWTMSKFDLSSKNNMIGWTIEQTYSSHQSQSFYAYYNDETPKFTYS----SRGHLKGVISFDINNGFWLIHSVPLFP---TFGNYTYGKAEEIYGQSFICVSLESENLQNIE-----NFPV--NDKLKTL-------LTNFINNKNMKIQQTNMTIIMKTLKSLPLVHFGKSYSFGQDLYSGLVAPGLQASIMVESWIRGEKV-DSTCGTNYHV 789
            PK   + Y+   S+ W      ++S    +G +++  Y  + SQ  +  YND+ PK + +      GH KGV+  D   GFWL+HSVP FP   + G YT+    + +GQ+ +CVSL       I       +P+  + KL+         L   I N+++  +  N ++I+ +        F K   FG DLYSG +A  L  ++ V+ W     +  S C   Y V
Sbjct:   27 PKGLTYKYMDQNSDGWQDGVGYINSSEGAVGRSLQPLYRKNSSQLAFLLYNDQPPKSSSARDSTGHGHTKGVLLLDQEGGFWLVHSVPRFPPPASSGAYTWPPNAQTFGQTLLCVSLPFTQFARIGKQLTYTYPLVYDHKLEGFFAQKLPDLETVIKNQHVLHEPWNSSVILTSQAGATFQSFAKFGKFGDDLYSGWLAEALGTNLQVQFWQNSPGILPSNCSGAYQV 254          
BLAST of Deoxyribonuclease II vs. UniProt/SwissProt
Match: sp|P34387|TG198_CAEEL (Cell-death-related nuclease 7 OS=Caenorhabditis elegans OX=6239 GN=crn-7 PE=2 SV=2)

HSP 1 Score: 135.191 bits (339), Expect = 2.661e-35
Identity = 82/258 (31.78%), Postives = 139/258 (53.88%), Query Frame = 1
Query:   76 LIFNILHQLAICELSCKNDNNQDIEWFIGLKFPK-------SYKFVYISSQSETWTMSKFDLSSKNNMIGWTIEQTYSSHQSQSFYAYYNDETP-KFTYSSRGHLKGVISFDINNGFWLIHSVPLFPTFGNYTYGKAEEIYGQSFICVSLE-------SENLQNIENFP-VNDKLKTLLTNFINNKNMKIQQTN--------MTIIMKTLKSLPLVHFGKSYSFGQDLYSGLVAPGLQASIMVESWIR--GEKVDSTC 771
            LIF+++      ++ CKN   + ++WF+  K PK         +FVY  ++S  WT    D++  N  +G T+ Q YS+ +S +F+  Y+D+ P K   S RGH KGV  FD   GFWLIHSVP FP   +++Y    E YGQSF C S+E       +E+ + I+  P + +  +   T F   KN++ +Q+         ++  +KT++ + L+ + K   F  D+++ L++   + ++ VESW+   G+ + +TC
Sbjct:    7 LIFSVIFTTGNGKIQCKNMRGKSVDWFVVYKLPKLSGAGTSGKEFVYFDAESSDWTRGN-DINDPNVAVGATVSQVYSADKSNNFWFMYSDDDPIKSADSYRGHAKGVSLFDSTTGFWLIHSVPNFPPIKSFSYPNTAEKYGQSFFCASMEVQHLTELAEHWKYIQATPYIINIPEKYATRFPTLKNVEAKQSLPRSATQFWISKPIKTVQGVTLMAYAKHKKFDGDIWNDLISRQNKVTLAVESWLNGSGDDIHTTC 263          
BLAST of Deoxyribonuclease II vs. UniProt/SwissProt
Match: sp|Q9QY48|DNS2B_MOUSE (Deoxyribonuclease-2-beta OS=Mus musculus OX=10090 GN=Dnase2b PE=2 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 7.574e-31
Identity = 78/275 (28.36%), Postives = 136/275 (49.45%), Query Frame = 1
Query:   55 MKIIQVALIFNILHQLAICELSCKNDNNQDIEWFIGLKFPK---------SYKFVYISSQSETWTMSKFDLSSKNNMIGWTIEQTYSSHQSQSFYAY--YNDETPKFTYSSR--GHLKGVISFDINNGFWLIHSVPLFPTFGNYTYGKAEEIYGQSFICVSLESENLQNIENFPVNDKLKTLLTNFINN---------KNMKIQQTNMTIIMKTL------KSLPLVHFGKSYSFGQDLYSGLVAPGLQASIMVESW-IRGEKVDSTCGTNYHVY 792
            ++ +   L F +   L   E+SC+N+  + ++WFI  K PK           +++Y+ S  +TW  S + ++S  + +G T++  Y +H S +  AY  YND  P     SR  GH KG++ ++   GFWLIHSVP FP    Y Y  +   YGQ+ IC++      + I+ F +      + + FI +           M    +++ I ++ L      + L  VHF KS  +  D+++G +A  L+  ++ ++W  + +++ S C   YHVY
Sbjct:    6 LRTVLSLLFFALSGVLGTPEISCRNEYGEAVDWFIFYKLPKRTSKASEEAGLQYLYLDSTRQTWNKSLYLINSTRSALGRTLQHLYDTHNSTNDTAYLIYNDGVPGSVNYSRQYGHAKGLLVWNRTQGFWLIHSVPKFPPVHGYEYPTSGRRYGQTGICITFGYSQFEEID-FQLLVLQPNIYSCFIPSTFHWKLIYMPRMCANSSSLKIPVRYLAELHSAQGLNFVHFAKSSFYTDDIFTGWIAQKLKTHLLAQTWQKKKQELPSNCSLPYHVY 279          
BLAST of Deoxyribonuclease II vs. UniProt/SwissProt
Match: sp|P34508|CRN6_CAEEL (Cell death-related nuclease 6 OS=Caenorhabditis elegans OX=6239 GN=crn-6 PE=2 SV=3)

HSP 1 Score: 118.627 bits (296), Expect = 5.035e-29
Identity = 78/262 (29.77%), Postives = 125/262 (47.71%), Query Frame = 1
Query:   61 IIQVALIFNILHQLAICELSCKNDNNQDIEWFIGLKFPKSYK------------FVYISSQSETWTMSKFDLSSKNNMIGWTIEQTYSSHQSQSFYAYYNDETPKFTY--SSRGHLKGVISFDINNGFWLIHSVPLFPTFGNYTYGKAEEIYGQSFICVSLESENLQNIE---------------------NFPVNDKLKTLLTNFINNKNMKIQQTNMTIIMKTLKSLPLVHFGKSYSFGQDLYSGLVAPGLQASIMVESW 741
            I Q+ LI +++  ++     CK++N  +++WF+  K P  +             F+Y    ++ W +    +  +NN + +T++Q Y+S+ + +F   YNDE P  T   +S GH KGV  FD   GFW+IHS+P FP+   + +      YGQ  IC+S  + +L  I                       FPV  +LK       N +  K      T ++K+L      HF K+  +G+DLYS  V P L++SI VE+W
Sbjct:    2 IRQIILIVSLI-GISNAAYQCKDNNGSNVDWFVFYKLPHLWNHPDNVPISNGTGFLYFDVNNKNWKLMPQGMDVENNAVYYTLQQYYNSNMNTTFSYMYNDEWPDSTIWSNSSGHAKGVTVFDQYTGFWMIHSIPKFPSKDMFRFPSNAHYYGQMGICISYNTVSLATIAQQLFYYNTFTYQFNLPQSFANQFPVLSQLK-------NKEYNKSPPLTSTKVLKSLGGQHFRHFAKTGEWGKDLYSDFVGPTLKSSIKVETW 255          
BLAST of Deoxyribonuclease II vs. UniProt/SwissProt
Match: sp|Q9QZK8|DNS2A_RAT (Deoxyribonuclease-2-alpha OS=Rattus norvegicus OX=10116 GN=Dnase2 PE=2 SV=1)

HSP 1 Score: 111.694 bits (278), Expect = 9.278e-27
Identity = 71/240 (29.58%), Postives = 111/240 (46.25%), Query Frame = 1
Query:  115 LSCKNDNNQDIEWFIGLKFP----------KSYKFVYISSQSETWTMSKFDLSSKNNMIGWTIEQTYSSHQSQSFYAYYNDETPKFTYSS----RGHLKGVISFDINNGFWLIHSVPLFP---TFGNYTYGKAEEIYGQSFICVSLESENLQNIE-----NFPV--NDKLKTL-------LTNFINNKNMKIQQTNMTIIMKTLKSLPLVHFGKSYSFGQDLYSGLVAPGLQASIMVESW 741
            LSC  D+ + ++WF+  K P          K   + Y+   SE W      + SK+  +G T++  Y  + SQ  +  YND+ PK + +     RGH KGV+  D   GFWL+HSVP FP   + G Y++      YGQ+ +CVSL       I       +P+  + KL+ +       L       ++  +  N ++I+ +        F K   FG DLYSG +A  L  ++ V+ W
Sbjct:   20 LSCYGDSGRPVDWFVVYKLPANSGSGDKPWKGLMYKYMDQNSEGWQDGVGHIDSKDGAVGLTLQPLYQKNSSQLAFLLYNDQPPKSSSAQDSSSRGHTKGVLLLDQEGGFWLVHSVPRFPSPASSGAYSWPPNARTYGQTLLCVSLPFSQFPGIGKQLTYTYPLVYDHKLEGIFAQKLPDLEEVTKGHHVLREPWNSSVILTSRAGTTFQSFAKFGKFGDDLYSGWLAAALGTNLQVQFW 259          
BLAST of Deoxyribonuclease II vs. UniProt/SwissProt
Match: sp|Q9QZK9|DNS2B_RAT (Deoxyribonuclease-2-beta OS=Rattus norvegicus OX=10116 GN=Dnase2b PE=1 SV=1)

HSP 1 Score: 111.694 bits (278), Expect = 1.210e-26
Identity = 76/262 (29.01%), Postives = 128/262 (48.85%), Query Frame = 1
Query:  115 LSCKNDNNQDIEWFIGLKFPK---------SYKFVYISSQSETWTMSKFDLSSKNNMIGWTIEQTYSSHQSQSFYAY--YNDETPK-FTYSSR-GHLKGVISFDINNGFWLIHSVPLFPTFG--NYTYGKAEEIYGQSFICVSLESENLQNIEN----FPVNDKLKTLLTNFINN----------------KNMKIQQTNMTIIMKTLKSLPLVHFGKSYSFGQDLYSGLVAPGLQASIMVESWIR-GEKVDSTCGTNYHVY 792
            +SC N++ + ++WF   K P+            ++Y+ S   TW+ S   ++S  + +G T+EQ Y +H +++  AY  YND  P    YS   GH KG++ ++   GFWLIHS+P FP      Y Y  +   Y QS +C++L+    + I++    F  N     + + FI N                   KI    +T+ +++ + L  +HF KS  +  D+++  +A  L+  ++VESW R   ++ S C   YHVY
Sbjct:   26 ISCINEDGKAVDWFAFYKLPRRTSRGGTGMGLDYLYLDSTMRTWSKSHHLINSSRSSLGRTLEQLYEAHNAKNDTAYLIYNDAVPASVNYSGNYGHAKGLLVWNRVQGFWLIHSIPKFPPVPEKGYEYPSSGRQYAQSGLCITLKYSQYETIDSQLLVFQPN-----IYSCFIPNIFRWELIHMPQMCAKSSASKIPSRRLTV-LQSAQGLNFLHFAKSTFYTDDIFAAWIAQKLKVHLLVESWQRKNHELPSNCSLPYHVY 281          
BLAST of Deoxyribonuclease II vs. TrEMBL
Match: A0A368FC76 (Deoxyribonuclease II OS=Ancylostoma caninum OX=29170 GN=ANCCAN_24471 PE=4 SV=1)

HSP 1 Score: 152.525 bits (384), Expect = 1.500e-39
Identity = 92/267 (34.46%), Postives = 136/267 (50.94%), Query Frame = 1
Query:   67 QVALIFNILHQLAICELSCKNDNNQDIEWFIGLKFP------KSYKFVYISSQSETWTMSKFDLSSKNNMIGWTIEQTYSSHQSQSFYAYYNDETP-KFTYSSRGHLKGVISFDINNGFWLIHSVPLFPTFGNYTYGKAEEIYGQSFICVSLESENLQNIENF----PVNDKLKTL----------LTNFINNKNMKIQQTNMTIIMK--TLKSLPLVHFGKSYSFGQDLYSGLVAPGLQASIMVESWIRG--EKVDSTCGTNYHVY 792
            ++ L F +       +L CKN   +D++WF  +K P      K   FVY  S  + W MS   + SK + IG TI Q Y   + ++F   YND++P K   S RGH KGV +FD + GFW++HSVP FP    Y Y ++   + QSF+C+SL +  L+++  +     V   L +L          L + +N K++    T+ T I K  TL       F K   FG DL+   +AP L+ S+ VE+W  G  + V +TCG   +VY
Sbjct:    3 RLCLAFVVFINHGNAKLGCKNMQGEDVDWFAAIKLPPGVDKRKGTSFVYFDSTQDGWKMSPQSIDSKKSAIGATINQIYKVDKRKTFTIAYNDDSPVKAVDSGRGHSKGVAAFDSDVGFWMVHSVPNFPPIKKYKYPESGTRFAQSFLCLSLSTNALEDVGQYMRFAQVTPFLSSLPASFRVVAPSLVDVVNKKSLSKSSTDFTTIRKMVTLDGKKAKGFAKGKRFGADLWYKFIAPNLKTSMAVETWRNGNAKNVGTTCGEKENVY 269          
BLAST of Deoxyribonuclease II vs. TrEMBL
Match: A0A0B1S1S6 (Deoxyribonuclease II (Fragment) OS=Oesophagostomum dentatum OX=61180 GN=OESDEN_21477 PE=4 SV=1)

HSP 1 Score: 148.288 bits (373), Expect = 8.623e-39
Identity = 85/257 (33.07%), Postives = 134/257 (52.14%), Query Frame = 1
Query:   61 IIQVALIFNILHQLAICELSCKNDNNQDIEWFIGLKFP------KSYKFVYISSQSETWTMSKFDLSSKNNMIGWTIEQTYSSHQSQSFYAYYNDETP-KFTYSSRGHLKGVISFDINNGFWLIHSVPLFPTFGNYTYGKAEEIYGQSFICVSLESENLQN-------------IENFP-VNDKLKTLLTNFINNKNMKIQQTNMTII--MKTLKSLPLVHFGKSYSFGQDLYSGLVAPGLQASIMVESWIRGEKVD 762
            +++V L+  +L ++   +++CKN    D++WF  LK P      K Y FVY  S+ + W  S   ++SK + IG TI+Q Y   + + F   YND++P +   S RGH KGV  FD N GFWL+HSVP +P    Y Y ++   Y QSF+C+SL+++ L               I+N P  + KL  +L + +  +++   +T  T I  +KTL    +  F K      DL+   +A  ++A + VE+W  G   D
Sbjct:    1 MLEVGLVVLMLARMCNAKIACKNMEGDDVDWFAALKLPSSADNSKGYSFVYFDSKQKGWKKSNELINSKKSAIGATIDQIYGKGKGKMFKIAYNDDSPARKVDSGRGHSKGVALFDENTGFWLLHSVPNYPPLDKYDYPESGTKYAQSFLCLSLDADVLPEIGQYMRFAQVTPFIQNLPGYHRKLAPVLEDVVKRRSLGRSETIYTTIANIKTLNGKKITTFSKHKKSKFDLWHDFIAQNIEAPMAVETWRNGAAQD 257          
BLAST of Deoxyribonuclease II vs. TrEMBL
Match: A0A016W8Z0 (Uncharacterized protein OS=Ancylostoma ceylanicum OX=53326 GN=Acey_s0986.g3296 PE=4 SV=1)

HSP 1 Score: 147.902 bits (372), Expect = 3.149e-37
Identity = 87/255 (34.12%), Postives = 128/255 (50.20%), Query Frame = 1
Query:  109 CELSCKNDNNQDIEWFIGLKFP------KSYKFVYISSQSETWTMSKFDLSSKNNMIGWTIEQTYSSHQSQSFYAYYNDETP-KFTYSSRGHLKGVISFDINNGFWLIHSVPLFPTFGNYTYGKAEEIYGQSFICVSLESENLQNI-------------ENFPVNDKLKTL---LTNFINNKNMKIQQTNMTII--MKTLKSLPLVHFGKSYSFGQDLYSGLVAPGLQASIMVESWI--RGEKVDSTCGTNYHVY 792
              L CKN N +D++WF  +K P      K   FVY  S  + W MS   + S  + IG TI Q Y   + ++F   YND++P K   S+RGH KGV +FD + GFW++HS+P FP    Y Y K+   + QS +C+SL +  L+++              N P  D  K +   L + +N K++    T  T I  ++TL       F K   FG DL+   +AP L+  + VE+W    G+ V + CG   +VY
Sbjct:   68 ARLGCKNMNGEDVDWFAAIKLPPGVDERKGKSFVYFDSTQDGWEMSPEAIDSNKSAIGATINQIYGIDKMRTFTIAYNDDSPVKAVDSNRGHSKGVAAFDNDVGFWMVHSIPNFPPLKKYDYPKSGTRFAQSLLCLSLSTNALEDVGQYMRFAQVTPFLSNLP--DSFKVVAPSLVDVVNKKSLSNSDTIFTTIRGLETLDGKRARGFSKHKKFGADLWYDFIAPNLKTPMAVETWRSGSGKDVGTKCGKKENVY 320          
BLAST of Deoxyribonuclease II vs. TrEMBL
Match: A0A016W843 (Uncharacterized protein OS=Ancylostoma ceylanicum OX=53326 GN=Acey_s0986.g3296 PE=4 SV=1)

HSP 1 Score: 147.902 bits (372), Expect = 4.482e-37
Identity = 87/255 (34.12%), Postives = 128/255 (50.20%), Query Frame = 1
Query:  109 CELSCKNDNNQDIEWFIGLKFP------KSYKFVYISSQSETWTMSKFDLSSKNNMIGWTIEQTYSSHQSQSFYAYYNDETP-KFTYSSRGHLKGVISFDINNGFWLIHSVPLFPTFGNYTYGKAEEIYGQSFICVSLESENLQNI-------------ENFPVNDKLKTL---LTNFINNKNMKIQQTNMTII--MKTLKSLPLVHFGKSYSFGQDLYSGLVAPGLQASIMVESWI--RGEKVDSTCGTNYHVY 792
              L CKN N +D++WF  +K P      K   FVY  S  + W MS   + S  + IG TI Q Y   + ++F   YND++P K   S+RGH KGV +FD + GFW++HS+P FP    Y Y K+   + QS +C+SL +  L+++              N P  D  K +   L + +N K++    T  T I  ++TL       F K   FG DL+   +AP L+  + VE+W    G+ V + CG   +VY
Sbjct:   98 ARLGCKNMNGEDVDWFAAIKLPPGVDERKGKSFVYFDSTQDGWEMSPEAIDSNKSAIGATINQIYGIDKMRTFTIAYNDDSPVKAVDSNRGHSKGVAAFDNDVGFWMVHSIPNFPPLKKYDYPKSGTRFAQSLLCLSLSTNALEDVGQYMRFAQVTPFLSNLP--DSFKVVAPSLVDVVNKKSLSNSDTIFTTIRGLETLDGKRARGFSKHKKFGADLWYDFIAPNLKTPMAVETWRSGSGKDVGTKCGKKENVY 350          
BLAST of Deoxyribonuclease II vs. TrEMBL
Match: A0A016WTQ5 (Uncharacterized protein OS=Ancylostoma ceylanicum OX=53326 GN=Acey_s0523.g2910 PE=4 SV=1)

HSP 1 Score: 146.747 bits (369), Expect = 7.063e-37
Identity = 95/284 (33.45%), Postives = 139/284 (48.94%), Query Frame = 1
Query:   34 DQYSK------FRMKIIQVALIFNILHQLAICELSCKNDNNQDIEWFIGLKFP------KSYKFVYISSQSETWTMSKFDLSSKNNMIGWTIEQTYSSHQSQSFYAYYNDETP-KFTYSSRGHLKGVISFDINNGFWLIHSVPLFPTFGNYTYGKAEEIYGQSFICVSLESENLQNI-------------ENFPVNDK-LKTLLTNFINNKNMKIQQTNMTII--MKTLKSLPLVHFGKSYSFGQDLYSGLVAPGLQASIMVESWIRG--EKVDSTCGTNYHVY 792
            D+Y K         K+ ++ + F          L CKN   +D++WF  +K P      K   FVY  S  + W MS   + SK + IG TI Q Y   + ++F   YND++P K   S RGH KGV +F+ + GFW++HSVP FP    Y Y K+   + QSF+C+SL +  L+++              N P + K L   L + +N K+     ++ T I  + TL       F K   FG DL+   +AP L+ S+ VE+W  G  E V +TCG   +VY
Sbjct:   33 DRYQKNTVRPTLERKMWRICVAFAAFVTCGNARLGCKNMEGEDVDWFAAIKLPPGVDVRKGKSFVYFDSTQDGWKMSSQPVDSKKSAIGATINQIYKVDKKKTFTIAYNDDSPVKAVESGRGHSKGVAAFNSDVGFWMVHSVPNFPPIKKYDYPKSGTRFAQSFLCLSLSTNALEDVGQYMRFAQVTPFLSNLPASFKVLAPSLVDVVNKKSPSKSASDFTTIRTIVTLNGKKAKGFAKGKKFGADLWYKFIAPNLKTSMAVETWRGGNAEDVGTTCGNKQNVY 316          
BLAST of Deoxyribonuclease II vs. Ensembl Cavefish
Match: dnase2b (deoxyribonuclease 2 beta [Source:NCBI gene;Acc:103030372])

HSP 1 Score: 119.013 bits (297), Expect = 3.358e-30
Identity = 74/258 (28.68%), Postives = 119/258 (46.12%), Query Frame = 1
Query:  100 LAICELSCKNDNNQDIEWFIGLKFPKSYK--------FVYISSQSETWTMSKFDLSSKNNMIGWTIEQTYSSHQS-QSFYAYYNDETPKFTYSSR-GHLKGVISFDINNGFWLIHSVPLFPTF--GNYTYGKAEEIYGQSFICVSLESENLQNIEN---------------FPVNDKLKTLLTNFINNKNMKIQQTNMTIIMKTLKSLPLVHFGKSYSFGQDLYSGLVAPGLQASIMVESWIR-GEKVDSTCGTNYHV 789
            L+   LSC N+  Q ++WFI  K PK  K        ++Y+ +   TW MS + +++ +  +G T+ + Y +++S  S Y  YND  P   Y S  GH KG + FD + GFW+ HS+P FP F    + Y    ++YGQ+  C +   E  + I                  P +  +   +      K   +        +K+      + F KS+ +  D+Y+G VA  L+  ++VESW R   ++ S C   YHV
Sbjct:   35 LSEANLSCLNEEGQPVDWFIMYKLPKYKKGEVGSGVEYMYLDASMLTWRMSPYAVNTSDGAVGRTLGRLYKTYKSNSSVYMLYNDAPPLLKYQSNYGHSKGTLLFDRSQGFWITHSIPHFPPFLEMGFGYPSTGKLYGQTVHCTTYSYEQFKKISQQLAYINPRVYNCSVPVPYHTDMAA-MAQLCGGKRPTVAPRRKLEKLKSALGETFLSFSKSHQYVDDIYAGWVAQTLRTDLLVESWQRDNHQLPSNCSLPYHV 291          
BLAST of Deoxyribonuclease II vs. Ensembl Cavefish
Match: dnase2 (deoxyribonuclease-2-alpha-like [Source:NCBI gene;Acc:103028211])

HSP 1 Score: 107.071 bits (266), Expect = 6.818e-26
Identity = 73/266 (27.44%), Postives = 121/266 (45.49%), Query Frame = 1
Query:  115 LSCKNDNNQDIEWFIGLKFPKSY--------KFVYISSQSETWTMSKFDLSSKNNMIGWTIEQTYSSHQSQSFYAYYNDETPKF-----TYSSRGHLKGVISFDINNGFWLIHSVPLFP---TFGNYTYGKAEEIYGQSFICVSLESENLQNI-ENFPVN----------DKLKTLLTNFIN----NKNMK---------IQQTNMTIIMKTLKSLPLVHFGKSYSFGQDLYSGLVAPGLQASIMVESWIRGEKV-DSTCGTNYHV 789
            LSC +D    ++WF   K P+ +        K++    +SE W      +   +  +G T+   Y   + +  Y  YND+ P+       + S GH KGV+ FD   GFWL+HS P FP   T G ++Y ++    GQ+FICV+   +  + I E   +N          + L + + + +N    N++ +             N ++ + +L     + F K  +F  DLY   VAP LQA ++V+ W R   + +S C  +Y V
Sbjct:   20 LSCYDDQGNTVDWFYLYKLPRPHEAPREEGLKYLLQEEKSEGWVDGSVLVEDTSGALGRTVGPLY--EEGELGYILYNDQPPEKDRLENAHRSAGHTKGVVLFDDKQGFWLVHSTPHFPPLKTEGKFSYPESGTQNGQNFICVTYPLDRFETIGEQLKINQPHVYDCHIPESLASSVPSMVNLCKENQHRRNSSNAPPPSYSSANRSVSLLSLGGKEFISFAKGAAFDNDLYHSWVAPALQADLLVQFWRRSTGILESDCDPSYKV 283          
BLAST of Deoxyribonuclease II vs. Ensembl Sea Lamprey
Match: dnase2 (deoxyribonuclease II, lysosomal [Source:ZFIN;Acc:ZDB-GENE-010724-16])

HSP 1 Score: 117.472 bits (293), Expect = 1.641e-30
Identity = 75/251 (29.88%), Postives = 121/251 (48.21%), Query Frame = 1
Query:  115 LSCKNDNNQDIEWFIGLKFPKSYKFVYISSQSETWTMSKFDLSSKNNMIGWTIEQTYSSHQSQS---FYAYYNDETPKFTY--SSRGHLKGVISFDINNGFWLIHSVPLFP--TFGNYTYGKAEEIYGQSFICVSLESENLQNIE-----NFP----------VNDKLKTLLTNFINNKNMKIQQTNMTIIMKTLKSLPLVHFGKSYSF---GQDLYSGLVAPGLQASIMVESWIRGEKV-DSTCGTNYHV 789
            +SC N   + ++WFI  K PK   ++Y+   +++W  ++ D+ S ++ +  T+ Q Y  + +++    +  YNDE P   +  S  GH KGV+  D   GFWL+HS P FP    G + +      YGQSF+CVS   +   +I      N P          + DKL  L       K ++++     + + +        F K++ F     DLY  LVAP L++S+ +ESW+ G  V DS C   + V
Sbjct:    1 VSCLNGEGKSVDWFIVYKLPKGKDYLYLDKSTQSWQNAQVDVDSNSSPVYQTVNQLYDGNATEAGDVAFVLYNDEPPNSPHYDSICGHTKGVVMLDGTGGFWLVHSTPHFPPSVPGPFAWPHTALRYGQSFLCVSYGFDQFGDIALQLRYNEPDHYSCQVGAQLKDKLPDLQALCAKTK-LQVESATRVVELTSSAGKTFRSFAKTHRFDDGASDLYVHLVAPNLKSSLYLESWVHGVGVFDSNCSGEFCV 250          
BLAST of Deoxyribonuclease II vs. Ensembl Medaka
Match: dnase2 (deoxyribonuclease 2, lysosomal [Source:NCBI gene;Acc:101162954])

HSP 1 Score: 115.546 bits (288), Expect = 5.628e-29
Identity = 76/268 (28.36%), Postives = 122/268 (45.52%), Query Frame = 1
Query:  112 ELSCKNDNNQDIEWFIGLKFPKSYK---------FVYISSQSETWTMSKFDLSSKNNMIGWTIEQTYSSHQSQSF-YAYYNDETPKFTYS-----SRGHLKGVISFDINNGFWLIHSVPLFPT---FGNYTYGKAEEIYGQSFICVSLESENLQNI-ENFPVNDK----------------------LKTLLTNFINNKNMKIQQTNMTIIMKTLKSLPLVHFGKSYSFGQDLYSGLVAPGLQASIMVESWIRGEKV-DSTCGTNYHV 789
            ++SC ND    ++WF   K PK ++         ++ +    E W   K  ++  +  +G T+ Q YS  +S    Y  YND++P   +      S GH KGV+  D N GFWL+HS P FP     G Y Y  +    GQ+F+CV+   ++ Q I E   +N                         K  L++ ++++ M    +N ++ + ++     + F K  SF  DLY G VAP LQ+ ++V+ WIR   +  S C   + V
Sbjct:   19 QISCYNDQGDAVDWFYIYKLPKEHQKTAPRRGEQYLLLEKGGEGWMEGKVTVNDSSGALGRTVGQLYSERKSSEVAYVLYNDQSPVDGFGDGSGNSGGHTKGVVLLDQNQGFWLVHSTPHFPPERQAGEYYYPSSGVNNGQNFLCVTYPLKSFQTIGEQLQINQPHVYDCDIPESMVSLVPALAALCKKARLSDEVSSRPM----SNRSMTLTSMDGTNFISFAKGASFDDDLYHGWVAPALQSDLLVQFWIRSTGILPSDCSLGWKV 282          
BLAST of Deoxyribonuclease II vs. Ensembl Medaka
Match: dnase2b (deoxyribonuclease-2-beta [Source:NCBI gene;Acc:101174093])

HSP 1 Score: 106.686 bits (265), Expect = 8.450e-26
Identity = 80/276 (28.99%), Postives = 126/276 (45.65%), Query Frame = 1
Query:   67 QVALI-FNILHQLAICELSCKNDNNQDIEWFIGLKFPK--------SYKFVYISSQSETWTMSKFDLSSKNNMIGWTIEQTY---SSHQSQSFYAYYNDETPKFTY-SSRGHLKGVISFDINNGFWLIHSVPLFPTF--GNYTYGKAEEIYGQSFICVSLESENLQNIENFPVNDKLKTLLTNFINNKNMKIQQTNMTIIMKTL----------KSL-PL--------VHFGKSYSFGQDLYSGLVAPGLQASIMVESW-IRGEKVDSTCGTNYHV 789
            Q+AL+ F  L  +   ++SC+N+    ++WFI  K PK          +++Y+      W MSK+ +++    I  T++Q Y   +   + S Y  YND  P   Y  + GH KGV+ FD   GFWL HS+P FP+F    Y Y  + ++ GQ+ +C++ +      I       +L+ L   F N         ++  + K            KS+ PL        + F KS  F  D+Y+G VA  L   ++VESW  +G  + S C    H 
Sbjct:   10 QIALLLFTCL--VCAADISCRNEEGNPVDWFIIYKLPKYKVGEVGSGVEYMYLDESVARWQMSKYMINTSQGAIANTLKQLYMGKAYMSNSSVYVLYNDGPPDLKYIQAYGHTKGVLLFDHAKGFWLSHSIPHFPSFPERGYLYPSSGKLNGQTLLCMTYQYAQFLKIAQ-----QLEYLYPRFYNCSVPAALSADLPQLAKLCAGSKPALASDKSMQPLFSNRGEKFISFVKSDHFVDDIYTGWVAQVLDTDLLVESWQTQGRVLPSNCSLPRHA 278          
BLAST of Deoxyribonuclease II vs. Ensembl Medaka
Match: ENSORLT00000036979.1 (deoxyribonuclease-2-alpha [Source:NCBI gene;Acc:101173852])

HSP 1 Score: 90.5077 bits (223), Expect = 5.096e-20
Identity = 66/274 (24.09%), Postives = 127/274 (46.35%), Query Frame = 1
Query:   61 IIQVALIFNILHQLAICELSCKNDNNQDIEWFIGLKFPKSYK----FVYISSQSETWTMSKFDLSSKNNMIGWTIEQ--TYSSHQSQSF-YAYYNDETPK--FTYSSRGHLKGVISFDINNGFWLIHSVPLFPTFGNYTY-GKAEEIYGQSFICVSLESENLQNIENFPVNDKLKTLLTNFINNKNMKIQQTNMTII-----------------MKTLKSLPLVHFGKSYSFGQDLYSGLVAPGLQASIMVESWIR-GEKVDSTCGTN--YHVY 792
            +I+V +   I       ++ C+ND+  +++W+I  K   + K    ++Y+   +  WT+S   + S++  +GWT++    +   Q++ F Y  YND+ P       S GH KGV+  D   G WL HS P FPT+ +  +  ++     Q+F+C++      + I       +LK +     ++   ++    +  +                 +K++     + F K   F  DLYSGL+   L +++ V+SW +  + + S C ++  +HVY
Sbjct:    6 LIKVLVSVGIFFHGCQSDVRCRNDHGVEVDWYILYKLRNTQKDGSSYLYMDENTNGWTVSNQKIDSRSGCLGWTLKPLLDFYVKQTEGFGYLLYNDQPPNPYVAPKSFGHSKGVVMLDRQTGVWLSHSTPRFPTYRSQNFWPESGNANAQAFMCITFPYAQFEAI-----GLQLKYIHAYSFDSHVPQVFHMELQCVAQRSCYPKKEPWFKVANLKSMGGHSFLSFAKYTRFKDDLYSGLITNTLPSNLYVKSWGKMHDSLASNCSSSIPHHVY 274          
BLAST of Deoxyribonuclease II vs. Planmine SMEST
Match: SMESG000062993.1 (SMESG000062993.1)

HSP 1 Score: 491.5 bits (1264), Expect = 1.229e-175
Identity = 243/263 (92.40%), Postives = 245/263 (93.16%), Query Frame = 1
Query:   55 MKIIQVALIFNILHQLAICELSCKNDNNQDIEWFIGLKFPKSYKFVYISSQSETWTMSKFDLSSKNNMIGWTIEQTYSSHQSQSFYAYYNDETPKFTYSSRGHLKGVISFDINNGFWLIHSVPLFPTFGNYTYGKAEEIYGQSFICVSLESENLQNI-----------------ENFPVNDKLKTLLTNFINNKNMKIQQTNMTIIMKTLKSLPLVHFGKSYSFGQDLYSGLVAPGLQASIMVESWIRGEKVDSTCGTNYHVY 792
            MKIIQVALIFNILHQLAICELSCKN+NNQDIEWFIGLKFPKSYKFVYISSQSETWT SKFDLSSKNNMIGWTIEQTYSSHQSQSFYAYYNDETPKFTYSSRGHLKGVISFDINNGFWLIHSVPLFPTFGNYTYGKAEEIYGQSFICVSLESENLQNI                 ENFPVNDKLKTLLTNFINNKNMKIQQTNMTIIMKTLKSLPLVHFGKSYSFGQDLYSGLVAPGLQASIMVESWIRGEKVDSTCGT+YHVY
Sbjct:    1 MKIIQVALIFNILHQLAICELSCKNENNQDIEWFIGLKFPKSYKFVYISSQSETWTTSKFDLSSKNNMIGWTIEQTYSSHQSQSFYAYYNDETPKFTYSSRGHLKGVISFDINNGFWLIHSVPLFPTFGNYTYGKAEEIYGQSFICVSLESENLQNIVIQLLLMQSTVYSYNLPENFPVNDKLKTLLTNFINNKNMKIQQTNMTIIMKTLKSLPLVHFGKSYSFGQDLYSGLVAPGLQASIMVESWIRGEKVDSTCGTDYHVY 263          
BLAST of Deoxyribonuclease II vs. Planmine SMEST
Match: SMESG000062594.1 (SMESG000062594.1)

HSP 1 Score: 190.274 bits (482), Expect = 1.462e-57
Identity = 103/251 (41.04%), Postives = 152/251 (60.56%), Query Frame = 1
Query:  103 AICELSCKNDNNQDIEWFIGLKFPKSYKFVYISSQSET--WTMSKFDLSSKNNMIGWTIEQTYSSHQSQSFYAYYNDETPKFTYSSRG-HLKGVISFDINNGFWLIHSVPLFPTFGNYTYGKAEEIYGQSFICVSLESENLQNI-----------------ENFPVNDKLKTLLTNFINNKNMKIQQTNMTIIMKTLKSLPLVHFGKSYSFGQDLYSGLVAPGLQASIMVESWI--RGEKVDSTCGTNYHV 789
             +CE++C+N+NN+ ++WF+ +K PKSY FVY+SS +    W  S +DL S+ N+I  T++Q+Y    ++ FY YYND+ P    S++G HLKG+++ D + G+WL HSVP FP    Y + KA+ IYGQSF+CVS+++  L+ I                  +F  + +L +LL   I N   K   +N+ +  KTL S+ L+HF KS  + QDLYS L+AP L  S+ VE+W   RG K+DS C   Y V
Sbjct:   20 TLCEITCRNENNEYLDWFVAIKHPKSYNFVYLSSANADSHWKESNYDLKSEKNLIAITLQQSYLHCNTKCFYIYYNDDRPLSNSSTKGGHLKGILNMDDSTGYWLTHSVPNFPMENEYFFNKAQSIYGQSFMCVSIKNTYLKPIVQQLLMMQATVYSSFYPTSFTNDMELISLLPRLIKNIRSKNLVSNI-LHFKTLNSMNLLHFAKSPKYDQDLYSKLIAPTLNGSLFVETWRNGRGSKLDSACELKYKV 269          
BLAST of Deoxyribonuclease II vs. Planmine SMEST
Match: SMESG000081036.1 (SMESG000081036.1)

HSP 1 Score: 186.037 bits (471), Expect = 8.322e-56
Identity = 101/270 (37.41%), Postives = 158/270 (58.52%), Query Frame = 1
Query:   55 MKIIQVALIFNILHQLAICELSCKNDNNQDIEWFIGLKFPKSYKFVYISSQSE--TWTMSKFDLSSKNNMIGWTIEQTYSS--HQSQSFYAYYNDETPK-FTYSSRGHLKGVISFDINNGFWLIHSVPLFPTFGNYTYGKAEEIYGQSFICVSLESENLQNI-----------------ENFPVNDKLKTLLTNFINNKNMKIQQTNMTIIMKTLKSLPLVHFGKSYSFGQDLYSGLVAPGLQASIMVESWIRGE--KVDSTCGTNYHVY 792
            +K+I   L+  I  Q  + ++ CK++ N D++W+I +K+P  Y F Y+SS++   TW +  + L+S  N++  T+ Q YS+  ++ ++FYA+YND+  K  + S+ GHLKGVI+FD   G+WLIHSVP FP    Y+Y   + I GQSFICVS+++ +L ++                  +F  N  L   L   ++N +    ++N+ I + T+  +PL+HFGKS  F  DLYS L+AP L+ S+ VESW+ G   +  S C   Y VY
Sbjct:    2 LKLILGILVIAISFQQHLAKIMCKSEKNSDLDWYIAIKYPGVYNFFYLSSETNGNTWKLPNYALNSDKNLVALTLSQAYSAENNKDKTFYAFYNDDKSKNVSGSNDGHLKGVINFDEETGYWLIHSVPHFPPVRGYSYPDPQHINGQSFICVSIKTSDLNDVVKQLLLMYARVYSYYFPRSFTANTTLDYNLGRLVHNMHSPSIKSNV-IHLNTISKVPLIHFGKSKLFANDLYSVLIAPQLKESLFVESWLNGNGGREPSNCQLTYKVY 270          
BLAST of Deoxyribonuclease II vs. Planmine SMEST
Match: SMESG000081036.1 (SMESG000081036.1)

HSP 1 Score: 178.718 bits (452), Expect = 2.957e-53
Identity = 96/248 (38.71%), Postives = 147/248 (59.27%), Query Frame = 1
Query:  121 CKNDNNQDIEWFIGLKFPKSYKFVYISSQSE--TWTMSKFDLSSKNNMIGWTIEQTYSS--HQSQSFYAYYNDETPK-FTYSSRGHLKGVISFDINNGFWLIHSVPLFPTFGNYTYGKAEEIYGQSFICVSLESENLQNI-----------------ENFPVNDKLKTLLTNFINNKNMKIQQTNMTIIMKTLKSLPLVHFGKSYSFGQDLYSGLVAPGLQASIMVESWIRGE--KVDSTCGTNYHVY 792
            CK++ N D++W+I +K+P  Y F Y+SS++   TW +  + L+S  N++  T+ Q YS+  ++ ++FYA+YND+  K  + S+ GHLKGVI+FD   G+WLIHSVP FP    Y+Y   + I GQSFICVS+++ +L ++                  +F  N  L   L   ++N +    ++N+ I + T+  +PL+HFGKS  F  DLYS L+AP L+ S+ VESW+ G   +  S C   Y VY
Sbjct:    2 CKSEKNSDLDWYIAIKYPGVYNFFYLSSETNGNTWKLPNYALNSDKNLVALTLSQAYSAENNKDKTFYAFYNDDKSKNVSGSNDGHLKGVINFDEETGYWLIHSVPHFPPVRGYSYPDPQHINGQSFICVSIKTSDLNDVVKQLLLMYARVYSYYFPRSFTANTTLDYNLGRLVHNMHSPSIKSNV-IHLNTISKVPLIHFGKSKLFANDLYSVLIAPQLKESLFVESWLNGNGGREPSNCQLTYKVY 248          
BLAST of Deoxyribonuclease II vs. Planmine SMEST
Match: SMESG000081051.1 (SMESG000081051.1)

HSP 1 Score: 142.124 bits (357), Expect = 2.467e-40
Identity = 88/231 (38.10%), Postives = 129/231 (55.84%), Query Frame = 1
Query:   49 FRMKIIQVALIFNILHQLAICELSCKNDNNQDIEWFIGLKFP--KSYKFVYISSQSETWTMSKFDLSSKNNMIGWTIEQTYSSHQSQSFYAYYNDE-TPKFTYSSRGHLKGVISFDINNGFWLIHSVPLFPTFGNYTYGKAEEIYGQSFICVSLESENLQNI-----------------ENFPVNDKLKTLLTNFINNKNMKIQQTNMTIIMKTLKSLPLVHFGKSYSFGQ 681
            F +K I + L+  I  +++   LSCKN+NN+D++WFI +K P   S+  +   S +  W +S + L++ NN I  TI+QTY S   Q FY YYNDE T      + GH KGV++FD + G+WL+HSVP FP    Y YG  +  +GQSFICVSL+ +NL ++                 E F  N  L   + + +NN   K + +N+     T+K+  L+HFGKS  F +
Sbjct:    4 FTLKFIILFLLVEI--KISKSSLSCKNENNEDVDWFIAIKPPHVDSFSSLSSQSNNTDWLLSSYKLTNGNNSIALTIKQTYESKLKQRFYVYYNDEDTAGNEKYNMGHSKGVVTFDKSEGYWLVHSVPKFPFPNEYKYGSGQLKFGQSFICVSLKFQNLNSLVDQLLIMTTNVYSYFVPEGFSQNSSLMDKINSLVNNSIKKSKDSNV-FNFNTVKNFNLIHFGKSRLFNR 231          
The following BLAST results are available for this feature:
BLAST of Deoxyribonuclease II vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
DNASE2B9.980e-2628.02deoxyribonuclease 2 beta [Source:HGNC Symbol;Acc:H... [more]
DNASE24.963e-2526.67deoxyribonuclease 2, lysosomal [Source:HGNC Symbol... [more]
DNASE21.113e-1022.69deoxyribonuclease 2, lysosomal [Source:HGNC Symbol... [more]
back to top
BLAST of Deoxyribonuclease II vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
crn-72.092e-3631.78Cell-death-related nuclease 7 [Source:UniProtKB/S... [more]
crn-63.959e-3029.77Cell death-related nuclease 6 [Source:UniProtKB/S... [more]
crn-63.959e-3029.77Cell death-related nuclease 6 [Source:UniProtKB/S... [more]
crn-64.012e-3029.77Cell death-related nuclease 6 [Source:UniProtKB/S... [more]
crn-64.012e-3029.77Cell death-related nuclease 6 [Source:UniProtKB/S... [more]
back to top
BLAST of Deoxyribonuclease II vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
DNaseII9.702e-2930.08gene:FBgn0000477 transcript:FBtr0083538[more]
back to top
BLAST of Deoxyribonuclease II vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
dnase2b7.574e-3429.89deoxyribonuclease II beta [Source:ZFIN;Acc:ZDB-GEN... [more]
dnase2b5.083e-3129.04deoxyribonuclease II beta [Source:ZFIN;Acc:ZDB-GEN... [more]
dnase27.102e-2528.73deoxyribonuclease II, lysosomal [Source:ZFIN;Acc:Z... [more]
dnase27.102e-2528.73deoxyribonuclease II, lysosomal [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of Deoxyribonuclease II vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
dnase2b2.761e-3128.52deoxyribonuclease II beta [Source:NCBI gene;Acc:49... [more]
dnase21.138e-2128.29deoxyribonuclease II, lysosomal [Source:NCBI gene;... [more]
back to top
BLAST of Deoxyribonuclease II vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Dnase2b1.083e-3128.36deoxyribonuclease II beta [Source:MGI Symbol;Acc:M... [more]
Dnase2b1.083e-3128.36deoxyribonuclease II beta [Source:MGI Symbol;Acc:M... [more]
Dnase2a2.280e-2728.91deoxyribonuclease II alpha [Source:MGI Symbol;Acc:... [more]
Dnase2a5.506e-2328.95deoxyribonuclease II alpha [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of Deoxyribonuclease II vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P34387|TG198_CAEEL2.661e-3531.78Cell-death-related nuclease 7 OS=Caenorhabditis el... [more]
sp|Q9QY48|DNS2B_MOUSE7.574e-3128.36Deoxyribonuclease-2-beta OS=Mus musculus OX=10090 ... [more]
sp|P34508|CRN6_CAEEL5.035e-2929.77Cell death-related nuclease 6 OS=Caenorhabditis el... [more]
sp|Q9QZK8|DNS2A_RAT9.278e-2729.58Deoxyribonuclease-2-alpha OS=Rattus norvegicus OX=... [more]
sp|Q9QZK9|DNS2B_RAT1.210e-2629.01Deoxyribonuclease-2-beta OS=Rattus norvegicus OX=1... [more]
back to top
BLAST of Deoxyribonuclease II vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A368FC761.500e-3934.46Deoxyribonuclease II OS=Ancylostoma caninum OX=291... [more]
A0A0B1S1S68.623e-3933.07Deoxyribonuclease II (Fragment) OS=Oesophagostomum... [more]
A0A016W8Z03.149e-3734.12Uncharacterized protein OS=Ancylostoma ceylanicum ... [more]
A0A016W8434.482e-3734.12Uncharacterized protein OS=Ancylostoma ceylanicum ... [more]
A0A016WTQ57.063e-3733.45Uncharacterized protein OS=Ancylostoma ceylanicum ... [more]
back to top
BLAST of Deoxyribonuclease II vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
dnase2b3.358e-3028.68deoxyribonuclease 2 beta [Source:NCBI gene;Acc:103... [more]
dnase26.818e-2627.44deoxyribonuclease-2-alpha-like [Source:NCBI gene;A... [more]
back to top
BLAST of Deoxyribonuclease II vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
dnase21.641e-3029.88deoxyribonuclease II, lysosomal [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of Deoxyribonuclease II vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Deoxyribonuclease II vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Deoxyribonuclease II vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
dnase25.628e-2928.36deoxyribonuclease 2, lysosomal [Source:NCBI gene;A... [more]
dnase2b8.450e-2628.99deoxyribonuclease-2-beta [Source:NCBI gene;Acc:101... [more]
ENSORLT00000036979.15.096e-2024.09deoxyribonuclease-2-alpha [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Deoxyribonuclease II vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000062993.11.229e-17592.40SMESG000062993.1[more]
SMESG000062594.11.462e-5741.04SMESG000062594.1[more]
SMESG000081036.18.322e-5637.41SMESG000081036.1[more]
SMESG000081036.12.957e-5338.71SMESG000081036.1[more]
SMESG000081051.12.467e-4038.10SMESG000081051.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011994 ID=SMED30011994|Name=Deoxyribonuclease II|organism=Schmidtea mediterranea sexual|type=transcript|length=1046bp
ATTTGTTTAAATGAATGAAAAATGATATGAAAGGATCAGTATTCTAAATT
TAGAATGAAAATAATTCAAGTTGCATTAATATTTAACATTTTACATCAAC
TGGCTATATGTGAATTATCGTGTAAAAATGACAACAATCAAGATATTGAA
TGGTTTATTGGACTAAAATTTCCAAAATCGTACAAATTTGTTTATATAAG
TTCTCAATCAGAAACCTGGACAATGTCCAAATTTGATTTATCTAGCAAAA
ATAATATGATTGGTTGGACAATTGAACAAACATACTCATCACATCAATCT
CAATCATTTTATGCATATTATAATGATGAAACGCCAAAATTTACCTACTC
CAGTAGGGGTCATTTAAAAGGTGTAATTAGTTTTGATATTAATAATGGGT
TTTGGCTTATACATTCTGTTCCTCTATTTCCAACATTTGGTAATTATACA
TATGGGAAAGCGGAAGAAATATATGGTCAGTCATTTATATGTGTTTCACT
TGAATCTGAAAATCTTCAGAATATTGAAAACTTTCCGGTAAATGATAAAT
TGAAGACTTTACTGACCAATTTCATTAATAATAAAAACATGAAAATCCAA
CAGACTAATATGACGATTATTATGAAAACTCTGAAAAGTTTACCCTTGGT
TCATTTTGGGAAATCTTATAGTTTTGGTCAAGATTTGTATTCTGGGCTTG
TTGCTCCTGGCTTACAAGCGTCTATTATGGTGGAAAGCTGGATTAGAGGA
GAAAAAGTGGATTCAACTTGTGGCACCAATTACCATGTATATACGTAAAT
TTGTGAATTTTAAAAATAGAATAACTGCTTTTTACTAAATCATTTTCCTA
CTAGAAGAATTATTCATAAACAACTATAACTATAAGTTTACCAGTTGAAG
TACTATGGACCTTTGTAAACACTAGGTTAAAAGTGAAAATGAGAGCAATT
GTGTTTGTTTTATTTCCTCCATAAAGGCCATGGTGGCGCATTAGATTATA
TTAGATTAGAATCCTGAGAATTTAAATTTTAAAAAATTCCAGATCG
back to top

protein sequence of SMED30011994-orf-1

>SMED30011994-orf-1 ID=SMED30011994-orf-1|Name=SMED30011994-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=248bp
MKIIQVALIFNILHQLAICELSCKNDNNQDIEWFIGLKFPKSYKFVYISS
QSETWTMSKFDLSSKNNMIGWTIEQTYSSHQSQSFYAYYNDETPKFTYSS
RGHLKGVISFDINNGFWLIHSVPLFPTFGNYTYGKAEEIYGQSFICVSLE
SENLQNIENFPVNDKLKTLLTNFINNKNMKIQQTNMTIIMKTLKSLPLVH
FGKSYSFGQDLYSGLVAPGLQASIMVESWIRGEKVDSTCGTNYHVYT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR004947DNase_II
Vocabulary: biological process
TermDefinition
GO:0006259DNA metabolic process
Vocabulary: molecular function
TermDefinition
GO:0004531deoxyribonuclease II activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR004947Deoxyribonuclease IIPFAMPF03265DNase_IIcoord: 22..246
e-value: 4.4E-54
score: 183.9
IPR004947Deoxyribonuclease IIPANTHERPTHR10858DEOXYRIBONUCLEASE IIcoord: 5..245
NoneNo IPR availablePANTHERPTHR10858:SF23DEOXYRIBONUCLEASE IIcoord: 5..245
NoneNo IPR availableCDDcd09120PLDc_DNaseII_1coord: 19..149
e-value: 1.46239E-45
score: 147.441
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..19
score: 0.697