partitioning defective 3 homolog isoform X2

Overview
Namepartitioning defective 3 homolog isoform X2
Smed IDSMED30011984
Length (bp)3390
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of partitioning defective 3 homolog isoform X2 (SMED30011984) t-SNE clustered cells

Violin plots show distribution of expression levels for partitioning defective 3 homolog isoform X2 (SMED30011984) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of partitioning defective 3 homolog isoform X2 (SMED30011984) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for partitioning defective 3 homolog isoform X2 (SMED30011984) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011984

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30011984SMESG000071209.1 dd_Smed_v4_5548_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30011984SMESG000071209.1 dd_Smed_v4_5548_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30011984SMESG000071209.1 dd_Smed_v4_5548_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30011984SMESG000071209.1 dd_Smed_v4_5548_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30011984SMESG000071209.1 dd_Smed_v4_5548_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30011984SMESG000071209.1 dd_Smed_v4_5548_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of partitioning defective 3 homolog isoform X2 vs. Ensembl Human
Match: PARD3B (par-3 family cell polarity regulator beta [Source:HGNC Symbol;Acc:HGNC:14446])

HSP 1 Score: 93.5893 bits (231), Expect = 1.531e-18
Identity = 74/222 (33.33%), Postives = 111/222 (50.00%), Query Frame = 2
Query:  911 GLGFTIVTRDNQVLYGSGADLSSSVVILVNKILSNGGAADDGRLRPGDRIIEVDNVPVI--SARDTTEKLKTIPVNTTVELLISRIDND------ESELNPPSSKLPKTSQLTFEISLNSKNKESQQLGLNIHYRNEKDDPLLGT--GIYIHSILSNSLASQQGNLHKNDKLVGVNGQSLANLSVEQTINLLK--TAMQNN--SFLAITVMR--ESMNEDPS 1528
            GLGFT+VTRD+ + +G G        I V  IL  G A  DGRL+ GDRI+EV+   V   +  +    L++     T  L+I+R +        + E +  +  L  + QLTFEI LN    +S   GL +  +  K     GT  GI+I SI+    A + G L  ND+L+ VNG+SL   S  + +  L+   +M+ N    + + ++R  E   EDP+
Sbjct:  392 GLGFTVVTRDSSI-HGPGP-------IFVKNILPKGAAIKDGRLQSGDRILEVNGRDVTGRTQEELVAMLRSTKQGETASLVIARQEGHFLPRELKGEPDCCALSLETSEQLTFEIPLN----DSGSAGLGVSLKGNKSRET-GTDLGIFIKSIIHGGAAFKDGRLRMNDQLIAVNGESLLGKSNHEAMETLRRSMSMEGNIRGMIQLVILRRPERPMEDPA 600          
BLAST of partitioning defective 3 homolog isoform X2 vs. Ensembl Human
Match: PARD3B (par-3 family cell polarity regulator beta [Source:HGNC Symbol;Acc:HGNC:14446])

HSP 1 Score: 93.5893 bits (231), Expect = 1.569e-18
Identity = 74/222 (33.33%), Postives = 111/222 (50.00%), Query Frame = 2
Query:  911 GLGFTIVTRDNQVLYGSGADLSSSVVILVNKILSNGGAADDGRLRPGDRIIEVDNVPVI--SARDTTEKLKTIPVNTTVELLISRIDND------ESELNPPSSKLPKTSQLTFEISLNSKNKESQQLGLNIHYRNEKDDPLLGT--GIYIHSILSNSLASQQGNLHKNDKLVGVNGQSLANLSVEQTINLLK--TAMQNN--SFLAITVMR--ESMNEDPS 1528
            GLGFT+VTRD+ + +G G        I V  IL  G A  DGRL+ GDRI+EV+   V   +  +    L++     T  L+I+R +        + E +  +  L  + QLTFEI LN    +S   GL +  +  K     GT  GI+I SI+    A + G L  ND+L+ VNG+SL   S  + +  L+   +M+ N    + + ++R  E   EDP+
Sbjct:  318 GLGFTVVTRDSSI-HGPGP-------IFVKNILPKGAAIKDGRLQSGDRILEVNGRDVTGRTQEELVAMLRSTKQGETASLVIARQEGHFLPRELKGEPDCCALSLETSEQLTFEIPLN----DSGSAGLGVSLKGNKSRET-GTDLGIFIKSIIHGGAAFKDGRLRMNDQLIAVNGESLLGKSNHEAMETLRRSMSMEGNIRGMIQLVILRRPERPMEDPA 526          
BLAST of partitioning defective 3 homolog isoform X2 vs. Ensembl Human
Match: PARD3B (par-3 family cell polarity regulator beta [Source:HGNC Symbol;Acc:HGNC:14446])

HSP 1 Score: 93.2041 bits (230), Expect = 1.620e-18
Identity = 74/222 (33.33%), Postives = 111/222 (50.00%), Query Frame = 2
Query:  911 GLGFTIVTRDNQVLYGSGADLSSSVVILVNKILSNGGAADDGRLRPGDRIIEVDNVPVI--SARDTTEKLKTIPVNTTVELLISRIDND------ESELNPPSSKLPKTSQLTFEISLNSKNKESQQLGLNIHYRNEKDDPLLGT--GIYIHSILSNSLASQQGNLHKNDKLVGVNGQSLANLSVEQTINLLK--TAMQNN--SFLAITVMR--ESMNEDPS 1528
            GLGFT+VTRD+ + +G G        I V  IL  G A  DGRL+ GDRI+EV+   V   +  +    L++     T  L+I+R +        + E +  +  L  + QLTFEI LN    +S   GL +  +  K     GT  GI+I SI+    A + G L  ND+L+ VNG+SL   S  + +  L+   +M+ N    + + ++R  E   EDP+
Sbjct:  318 GLGFTVVTRDSSI-HGPGP-------IFVKNILPKGAAIKDGRLQSGDRILEVNGRDVTGRTQEELVAMLRSTKQGETASLVIARQEGHFLPRELKGEPDCCALSLETSEQLTFEIPLN----DSGSAGLGVSLKGNKSRET-GTDLGIFIKSIIHGGAAFKDGRLRMNDQLIAVNGESLLGKSNHEAMETLRRSMSMEGNIRGMIQLVILRRPERPMEDPA 526          
BLAST of partitioning defective 3 homolog isoform X2 vs. Ensembl Human
Match: PARD3B (par-3 family cell polarity regulator beta [Source:HGNC Symbol;Acc:HGNC:14446])

HSP 1 Score: 93.2041 bits (230), Expect = 1.777e-18
Identity = 74/222 (33.33%), Postives = 111/222 (50.00%), Query Frame = 2
Query:  911 GLGFTIVTRDNQVLYGSGADLSSSVVILVNKILSNGGAADDGRLRPGDRIIEVDNVPVI--SARDTTEKLKTIPVNTTVELLISRIDND------ESELNPPSSKLPKTSQLTFEISLNSKNKESQQLGLNIHYRNEKDDPLLGT--GIYIHSILSNSLASQQGNLHKNDKLVGVNGQSLANLSVEQTINLLK--TAMQNN--SFLAITVMR--ESMNEDPS 1528
            GLGFT+VTRD+ + +G G        I V  IL  G A  DGRL+ GDRI+EV+   V   +  +    L++     T  L+I+R +        + E +  +  L  + QLTFEI LN    +S   GL +  +  K     GT  GI+I SI+    A + G L  ND+L+ VNG+SL   S  + +  L+   +M+ N    + + ++R  E   EDP+
Sbjct:  392 GLGFTVVTRDSSI-HGPGP-------IFVKNILPKGAAIKDGRLQSGDRILEVNGRDVTGRTQEELVAMLRSTKQGETASLVIARQEGHFLPRELKGEPDCCALSLETSEQLTFEIPLN----DSGSAGLGVSLKGNKSRET-GTDLGIFIKSIIHGGAAFKDGRLRMNDQLIAVNGESLLGKSNHEAMETLRRSMSMEGNIRGMIQLVILRRPERPMEDPA 600          
BLAST of partitioning defective 3 homolog isoform X2 vs. Ensembl Human
Match: PARD3B (par-3 family cell polarity regulator beta [Source:HGNC Symbol;Acc:HGNC:14446])

HSP 1 Score: 93.2041 bits (230), Expect = 1.933e-18
Identity = 74/222 (33.33%), Postives = 111/222 (50.00%), Query Frame = 2
Query:  911 GLGFTIVTRDNQVLYGSGADLSSSVVILVNKILSNGGAADDGRLRPGDRIIEVDNVPVI--SARDTTEKLKTIPVNTTVELLISRIDND------ESELNPPSSKLPKTSQLTFEISLNSKNKESQQLGLNIHYRNEKDDPLLGT--GIYIHSILSNSLASQQGNLHKNDKLVGVNGQSLANLSVEQTINLLK--TAMQNN--SFLAITVMR--ESMNEDPS 1528
            GLGFT+VTRD+ + +G G        I V  IL  G A  DGRL+ GDRI+EV+   V   +  +    L++     T  L+I+R +        + E +  +  L  + QLTFEI LN    +S   GL +  +  K     GT  GI+I SI+    A + G L  ND+L+ VNG+SL   S  + +  L+   +M+ N    + + ++R  E   EDP+
Sbjct:  392 GLGFTVVTRDSSI-HGPGP-------IFVKNILPKGAAIKDGRLQSGDRILEVNGRDVTGRTQEELVAMLRSTKQGETASLVIARQEGHFLPRELKGEPDCCALSLETSEQLTFEIPLN----DSGSAGLGVSLKGNKSRET-GTDLGIFIKSIIHGGAAFKDGRLRMNDQLIAVNGESLLGKSNHEAMETLRRSMSMEGNIRGMIQLVILRRPERPMEDPA 600          
BLAST of partitioning defective 3 homolog isoform X2 vs. Ensembl Celegans
Match: mpz-1 (Multiple PDZ domain protein [Source:UniProtKB/TrEMBL;Acc:G1K0W2])

HSP 1 Score: 71.633 bits (174), Expect = 3.171e-12
Identity = 58/188 (30.85%), Postives = 89/188 (47.34%), Query Frame = 2
Query:  911 GLGFTIVTRDNQVLYGSGADLSSSVVILVNKILSNGGAADDGRLRPGDRIIEVDNVPV--ISARDTTEKLKTIPVNTTVELLISRIDNDESELNPPSSKLPKTSQL--TFEISLNSKNKESQQLGLNIHYRNEKDDPLLGTGIYIHSILSNSLASQQGNLHKNDKLVGVNGQSLANLSVEQTINLLKT 1462
            GLG +IV          GAD     V+ ++++ S+G AA DGRL+PGD+++EV+   +  ++   +   L+  P    V LLI R  N +  L  P       +Q+   FEI L  K       GL I     K++P    G+Y+  I+   LA   G L   D+++ VNG+ +     E    +LKT
Sbjct: 2069 GLGLSIV---------GGADTVLGTVV-IHEVYSDGAAAHDGRLKPGDQVLEVNGTSLRGVTHDQSIAYLRRTP--PKVRLLIYRDVNLQLSLLDP-------TQIYNIFEIDLVKKTGR----GLGISIVGRKNEP----GVYVSEIVKGGLAESDGRLMTGDQILEVNGKDVRGCMQEDVAAMLKT 2229          
BLAST of partitioning defective 3 homolog isoform X2 vs. Ensembl Celegans
Match: mpz-1 (Multiple PDZ domain protein [Source:UniProtKB/TrEMBL;Acc:G1K0W2])

HSP 1 Score: 71.633 bits (174), Expect = 3.274e-12
Identity = 58/188 (30.85%), Postives = 89/188 (47.34%), Query Frame = 2
Query:  911 GLGFTIVTRDNQVLYGSGADLSSSVVILVNKILSNGGAADDGRLRPGDRIIEVDNVPV--ISARDTTEKLKTIPVNTTVELLISRIDNDESELNPPSSKLPKTSQL--TFEISLNSKNKESQQLGLNIHYRNEKDDPLLGTGIYIHSILSNSLASQQGNLHKNDKLVGVNGQSLANLSVEQTINLLKT 1462
            GLG +IV          GAD     V+ ++++ S+G AA DGRL+PGD+++EV+   +  ++   +   L+  P    V LLI R  N +  L  P       +Q+   FEI L  K       GL I     K++P    G+Y+  I+   LA   G L   D+++ VNG+ +     E    +LKT
Sbjct: 1762 GLGLSIV---------GGADTVLGTVV-IHEVYSDGAAAHDGRLKPGDQVLEVNGTSLRGVTHDQSIAYLRRTP--PKVRLLIYRDVNLQLSLLDP-------TQIYNIFEIDLVKKTGR----GLGISIVGRKNEP----GVYVSEIVKGGLAESDGRLMTGDQILEVNGKDVRGCMQEDVAAMLKT 1922          
BLAST of partitioning defective 3 homolog isoform X2 vs. Ensembl Celegans
Match: mpz-1 (Multiple PDZ domain protein [Source:UniProtKB/TrEMBL;Acc:G1K0W2])

HSP 1 Score: 71.633 bits (174), Expect = 3.333e-12
Identity = 58/188 (30.85%), Postives = 89/188 (47.34%), Query Frame = 2
Query:  911 GLGFTIVTRDNQVLYGSGADLSSSVVILVNKILSNGGAADDGRLRPGDRIIEVDNVPV--ISARDTTEKLKTIPVNTTVELLISRIDNDESELNPPSSKLPKTSQL--TFEISLNSKNKESQQLGLNIHYRNEKDDPLLGTGIYIHSILSNSLASQQGNLHKNDKLVGVNGQSLANLSVEQTINLLKT 1462
            GLG +IV          GAD     V+ ++++ S+G AA DGRL+PGD+++EV+   +  ++   +   L+  P    V LLI R  N +  L  P       +Q+   FEI L  K       GL I     K++P    G+Y+  I+   LA   G L   D+++ VNG+ +     E    +LKT
Sbjct: 1780 GLGLSIV---------GGADTVLGTVV-IHEVYSDGAAAHDGRLKPGDQVLEVNGTSLRGVTHDQSIAYLRRTP--PKVRLLIYRDVNLQLSLLDP-------TQIYNIFEIDLVKKTGR----GLGISIVGRKNEP----GVYVSEIVKGGLAESDGRLMTGDQILEVNGKDVRGCMQEDVAAMLKT 1940          
BLAST of partitioning defective 3 homolog isoform X2 vs. Ensembl Celegans
Match: mpz-1 (Multiple PDZ domain protein [Source:UniProtKB/TrEMBL;Acc:G1K0W2])

HSP 1 Score: 71.633 bits (174), Expect = 3.357e-12
Identity = 58/188 (30.85%), Postives = 89/188 (47.34%), Query Frame = 2
Query:  911 GLGFTIVTRDNQVLYGSGADLSSSVVILVNKILSNGGAADDGRLRPGDRIIEVDNVPV--ISARDTTEKLKTIPVNTTVELLISRIDNDESELNPPSSKLPKTSQL--TFEISLNSKNKESQQLGLNIHYRNEKDDPLLGTGIYIHSILSNSLASQQGNLHKNDKLVGVNGQSLANLSVEQTINLLKT 1462
            GLG +IV          GAD     V+ ++++ S+G AA DGRL+PGD+++EV+   +  ++   +   L+  P    V LLI R  N +  L  P       +Q+   FEI L  K       GL I     K++P    G+Y+  I+   LA   G L   D+++ VNG+ +     E    +LKT
Sbjct: 1762 GLGLSIV---------GGADTVLGTVV-IHEVYSDGAAAHDGRLKPGDQVLEVNGTSLRGVTHDQSIAYLRRTP--PKVRLLIYRDVNLQLSLLDP-------TQIYNIFEIDLVKKTGR----GLGISIVGRKNEP----GVYVSEIVKGGLAESDGRLMTGDQILEVNGKDVRGCMQEDVAAMLKT 1922          
BLAST of partitioning defective 3 homolog isoform X2 vs. Ensembl Celegans
Match: mpz-1 (Multiple PDZ domain protein [Source:UniProtKB/TrEMBL;Acc:G1K0W2])

HSP 1 Score: 71.633 bits (174), Expect = 3.485e-12
Identity = 58/188 (30.85%), Postives = 89/188 (47.34%), Query Frame = 2
Query:  911 GLGFTIVTRDNQVLYGSGADLSSSVVILVNKILSNGGAADDGRLRPGDRIIEVDNVPV--ISARDTTEKLKTIPVNTTVELLISRIDNDESELNPPSSKLPKTSQL--TFEISLNSKNKESQQLGLNIHYRNEKDDPLLGTGIYIHSILSNSLASQQGNLHKNDKLVGVNGQSLANLSVEQTINLLKT 1462
            GLG +IV          GAD     V+ ++++ S+G AA DGRL+PGD+++EV+   +  ++   +   L+  P    V LLI R  N +  L  P       +Q+   FEI L  K       GL I     K++P    G+Y+  I+   LA   G L   D+++ VNG+ +     E    +LKT
Sbjct: 1949 GLGLSIV---------GGADTVLGTVV-IHEVYSDGAAAHDGRLKPGDQVLEVNGTSLRGVTHDQSIAYLRRTP--PKVRLLIYRDVNLQLSLLDP-------TQIYNIFEIDLVKKTGR----GLGISIVGRKNEP----GVYVSEIVKGGLAESDGRLMTGDQILEVNGKDVRGCMQEDVAAMLKT 2109          
BLAST of partitioning defective 3 homolog isoform X2 vs. Ensembl Fly
Match: baz (gene:FBgn0000163 transcript:FBtr0343763)

HSP 1 Score: 72.0182 bits (175), Expect = 3.255e-12
Identity = 54/160 (33.75%), Postives = 79/160 (49.38%), Query Frame = 2
Query:  734 MKGINNEEKFPMSKSAPASPTKPVPPLRSPQTH--LTMINVHNVRTXXXXXXXXXXXXPNGGLGFTIVTRDNQVLYGSGADLSSSVVILVNKILSNGGAADDGRLRPGDRIIEVDNVPVI--SARDTTEKLKTIPVNTTVELLISRIDNDESELNPPSSK 1201
            ++G  N  +   SK A       V P R P      T + V N R +G+KI+I + K PNG LGF++ TRDN               I +  IL  G A +DGRL+PGDR++EVD  P+   +  D    L+ +P   TV +++SR      + + P+ K
Sbjct:  393 LRGDRNRRQQRDSKVAEMVEVATVSPTRKPHAAPVGTSLQVANTRKLGRKIEIMLKKGPNG-LGFSVTTRDNPA--------GGHCPIYIKNILPRGAAIEDGRLKPGDRLLEVDGTPMTGKTQTDVVAILRGMPAGATVRIVVSRQQELAEQADQPAEK 543          
BLAST of partitioning defective 3 homolog isoform X2 vs. Ensembl Fly
Match: baz (gene:FBgn0000163 transcript:FBtr0111000)

HSP 1 Score: 72.0182 bits (175), Expect = 3.294e-12
Identity = 54/160 (33.75%), Postives = 79/160 (49.38%), Query Frame = 2
Query:  734 MKGINNEEKFPMSKSAPASPTKPVPPLRSPQTH--LTMINVHNVRTXXXXXXXXXXXXPNGGLGFTIVTRDNQVLYGSGADLSSSVVILVNKILSNGGAADDGRLRPGDRIIEVDNVPVI--SARDTTEKLKTIPVNTTVELLISRIDNDESELNPPSSK 1201
            ++G  N  +   SK A       V P R P      T + V N R +G+KI+I + K PNG LGF++ TRDN               I +  IL  G A +DGRL+PGDR++EVD  P+   +  D    L+ +P   TV +++SR      + + P+ K
Sbjct:  414 LRGDRNRRQQRDSKVAEMVEVATVSPTRKPHAAPVGTSLQVANTRKLGRKIEIMLKKGPNG-LGFSVTTRDNPA--------GGHCPIYIKNILPRGAAIEDGRLKPGDRLLEVDGTPMTGKTQTDVVAILRGMPAGATVRIVVSRQQELAEQADQPAEK 564          
BLAST of partitioning defective 3 homolog isoform X2 vs. Ensembl Fly
Match: baz (gene:FBgn0000163 transcript:FBtr0074388)

HSP 1 Score: 72.0182 bits (175), Expect = 3.404e-12
Identity = 54/160 (33.75%), Postives = 79/160 (49.38%), Query Frame = 2
Query:  734 MKGINNEEKFPMSKSAPASPTKPVPPLRSPQTH--LTMINVHNVRTXXXXXXXXXXXXPNGGLGFTIVTRDNQVLYGSGADLSSSVVILVNKILSNGGAADDGRLRPGDRIIEVDNVPVI--SARDTTEKLKTIPVNTTVELLISRIDNDESELNPPSSK 1201
            ++G  N  +   SK A       V P R P      T + V N R +G+KI+I + K PNG LGF++ TRDN               I +  IL  G A +DGRL+PGDR++EVD  P+   +  D    L+ +P   TV +++SR      + + P+ K
Sbjct:  393 LRGDRNRRQQRDSKVAEMVEVATVSPTRKPHAAPVGTSLQVANTRKLGRKIEIMLKKGPNG-LGFSVTTRDNPA--------GGHCPIYIKNILPRGAAIEDGRLKPGDRLLEVDGTPMTGKTQTDVVAILRGMPAGATVRIVVSRQQELAEQADQPAEK 543          
BLAST of partitioning defective 3 homolog isoform X2 vs. Ensembl Fly
Match: baz (gene:FBgn0000163 transcript:FBtr0343764)

HSP 1 Score: 72.0182 bits (175), Expect = 3.475e-12
Identity = 54/160 (33.75%), Postives = 79/160 (49.38%), Query Frame = 2
Query:  734 MKGINNEEKFPMSKSAPASPTKPVPPLRSPQTH--LTMINVHNVRTXXXXXXXXXXXXPNGGLGFTIVTRDNQVLYGSGADLSSSVVILVNKILSNGGAADDGRLRPGDRIIEVDNVPVI--SARDTTEKLKTIPVNTTVELLISRIDNDESELNPPSSK 1201
            ++G  N  +   SK A       V P R P      T + V N R +G+KI+I + K PNG LGF++ TRDN               I +  IL  G A +DGRL+PGDR++EVD  P+   +  D    L+ +P   TV +++SR      + + P+ K
Sbjct:  414 LRGDRNRRQQRDSKVAEMVEVATVSPTRKPHAAPVGTSLQVANTRKLGRKIEIMLKKGPNG-LGFSVTTRDNPA--------GGHCPIYIKNILPRGAAIEDGRLKPGDRLLEVDGTPMTGKTQTDVVAILRGMPAGATVRIVVSRQQELAEQADQPAEK 564          
BLAST of partitioning defective 3 homolog isoform X2 vs. Ensembl Fly
Match: scrib (gene:FBgn0263289 transcript:FBtr0335521)

HSP 1 Score: 54.6842 bits (130), Expect = 6.585e-7
Identity = 54/193 (27.98%), Postives = 90/193 (46.63%), Query Frame = 2
Query:  908 GGLGFTIV--TRDNQVLYGSGADLSSSVVILVNKILSNGGAADDGRLRPGDRIIEVDNVPVISARDTTEKLKTIPVNTTVELLISRIDNDESELNPPSSKLPKTSQLTFEISLNSKNKESQQLGLNIH-----YRNEKDDPLLGTGIYIHSILSNSLASQQGNLHKNDKLVGVNGQSLANLSVEQTINLLKTA 1465
            G LGF+I+  T  + V +G+         I ++ I+  G A+  G+LR GDRI++V+   V  A      L+ +     ++L I      + +  PP  +  +   +  E  L SK  E ++LG++I       R    DP    G+++  I S   A + G L    +L+ VNG SL   S +  +N+L+ A
Sbjct: 1152 GSLGFSIIGGTDHSCVPFGT-----REPGIFISHIVPGGIASKCGKLRMGDRILKVNEADVSKATHQDAVLELLKPGDEIKLTI------QHDPLPPGFQSIEVVYVKTEEVLLSK-AEGERLGMHIKGGLNGQRGNPADPS-DEGVFVSKINSVGAARRDGRLKVGMRLLEVNGHSLLGASHQDAVNVLRNA 1331          
BLAST of partitioning defective 3 homolog isoform X2 vs. Ensembl Zebrafish
Match: pard3ba (par-3 family cell polarity regulator beta a [Source:ZFIN;Acc:ZDB-GENE-080225-12])

HSP 1 Score: 95.5153 bits (236), Expect = 2.313e-19
Identity = 65/203 (32.02%), Postives = 99/203 (48.77%), Query Frame = 2
Query:  911 GLGFTIVTRDNQVLYGSGADLSSSVVILVNKILSNGGAADDGRLRPGDRIIEVDNVPVI--SARDTTEKLKTIPVNTTVELLISRIDND-----ESELNPPSSKLPKTSQLTFEISLNSKNKESQQLGLNIHYRNEKDDPLLGTGIYIHSILSNSLASQQGNLHKNDKLVGVNGQSLANLSVEQTINLLKTAMQNNSFLAITV 1498
            GLGFT+VTRD+  L+G G        I+V  IL  G A  DGRL+ GDRI+EV+ V +   +  +    L++  +  TV L++ R +       + E++ P        QL FE+ LN        + L  +   E  + L   GI+I SI+    A++ G L  ND+L+ VN +SL   S    +  L+ +M     L  T+
Sbjct:  236 GLGFTVVTRDSS-LHGPGP-------IMVKSILPRGAAVKDGRLKSGDRILEVNGVDITGRTQEELVAMLRSTKLGETVSLIVGRQEEFLPRELKGEVSGPLVSEDGREQLMFEVPLNDSGSAGLGVSLKGNKSRETGEDL---GIFIKSIIHGGAANKDGRLRVNDQLIAVNSESLVGRSNHDAMETLRHSMSTEGNLRGTI 427          
BLAST of partitioning defective 3 homolog isoform X2 vs. Ensembl Zebrafish
Match: pard3bb (par-3 family cell polarity regulator beta b [Source:ZFIN;Acc:ZDB-GENE-070912-290])

HSP 1 Score: 87.0409 bits (214), Expect = 5.227e-17
Identity = 65/194 (33.51%), Postives = 97/194 (50.00%), Query Frame = 2
Query:  911 GLGFTIVTRDNQVLYGSGADLSSSVVILVNKILSNGGAADDGRLRPGDRIIEVDNVPVI--SARDTTEKLKTIPVNTTVELLISRIDND--ESELNPPSSKL----PKTSQLTFEISLNSKNKESQQLGLNIHYRNEKDDPLLGTGIYIHSILSNSLASQQGNLHKNDKLVGVNGQSLANLSVEQTINLLKTAM 1468
            GLGFT+VTRD+ V +G G        ILV  IL  G A  DGRL+ GDRI+EV+ V +   S  +    L++     +V L+++R ++     EL    ++L        QL FE+ LN        + L  +   E  + L   GI+I SI+    A + G L  ND+L+ VNG+ L   S  + +  L+ +M
Sbjct:  215 GLGFTVVTRDSSV-HGPGP-------ILVKNILPRGAAVKDGRLQSGDRILEVNGVDIGGRSQEELVAMLRSTKQGDSVCLVVARQEDMFLPRELKEEQARLLLSEEGKEQLMFEVPLNDSGSAGLGVSLKGNKSRETGEDL---GIFIKSIIHGGAAFKDGRLRINDQLIAVNGEPLLGKSNHEAMETLRRSM 397          
BLAST of partitioning defective 3 homolog isoform X2 vs. Ensembl Zebrafish
Match: PARD3 (par-3 family cell polarity regulator [Source:HGNC Symbol;Acc:HGNC:16051])

HSP 1 Score: 86.2705 bits (212), Expect = 6.801e-17
Identity = 62/199 (31.16%), Postives = 100/199 (50.25%), Query Frame = 2
Query:  911 GLGFTIVTRDNQVLYGSGADLSSSVVILVNKILSNGGAADDGRLRPGDRIIEVDNVPV--ISARDTTEKLKTIPVNTTVELLISRIDN----------DESELNPPSSKLPKTSQLTFEISLNSKNKESQQLGLNIHYR-NEKDDPLLGTGIYIHSILSNSLASQQGNLHKNDKLVGVNGQSLANLSVEQTINLLKTAM 1468
            GLGF+I +RD          + +S  I V  IL  G A  DGRL+ GDR++EV+ V +   +  +    L++  +  TV LLISR ++          D+  L P  ++      +TFEI LN    +S   GL +  + N   +     GI++ SI++   A + G L  ND+L+ VNG+SL   + ++ +  L+ +M
Sbjct:  161 GLGFSITSRD--------VPIGTSAPIYVKNILPRGAAIQDGRLKAGDRLLEVNGVDLNGKTQEEVVALLRSTAMGGTVGLLISRQEDAFLPREAKEQDDLILTPDGTR----EFMTFEIPLN----DSGSAGLGVSVKGNRAKESHADLGIFVKSIITGGAACKDGRLRINDQLIAVNGESLLEKTNQEAMETLRKSM 343          
BLAST of partitioning defective 3 homolog isoform X2 vs. Ensembl Zebrafish
Match: pard3ab (par-3 family cell polarity regulator alpha, b [Source:ZFIN;Acc:ZDB-GENE-030925-47])

HSP 1 Score: 80.4925 bits (197), Expect = 9.102e-15
Identity = 60/212 (28.30%), Postives = 95/212 (44.81%), Query Frame = 2
Query:  911 GLGFTIVTRDNQVLYGSGADLSSSVVILVNKILSNGGAADDGRLRPGDRIIEVDNVPV--ISARDTTEKLKTIPVNTTVELLISR-----------------------IDNDESELNPPSSKLPKTSQLTFEISLNSKNKESQQLGLNIHYR-NEKDDPLLGTGIYIHSILSNSLASQQGNLHKNDKLVGVNGQSLANLSVEQTINLLKTAM 1468
            GLGF+I +RD          L  S  I V  IL  G A  DGRL+ GDR++EV+ V +      +    L+  P+  TV L++ R                       ++ +E  L P  ++      LT E+ LN    +S   GL +  + N   +     GI++ SI++   A + G L  ND+L+ VNG+SL   + +  +  L+ +M
Sbjct:  470 GLGFSITSRD--------VPLGGSAPIYVKNILPRGAAIQDGRLKAGDRLLEVNGVDLNGRGQEEVVSLLRATPMGGTVTLVVLRQEETFIPREMNAEPAIQNTREWKVEEEELVLTPDGTR----EFLTLEVPLN----DSGSAGLGVSVKGNRSKESHADLGIFVKSIINGGAACKDGRLRVNDQLIAVNGESLLGKTNQDAMETLRKSM 665          
BLAST of partitioning defective 3 homolog isoform X2 vs. Ensembl Zebrafish
Match: pard3ab (par-3 family cell polarity regulator alpha, b [Source:ZFIN;Acc:ZDB-GENE-030925-47])

HSP 1 Score: 80.4925 bits (197), Expect = 9.223e-15
Identity = 60/212 (28.30%), Postives = 95/212 (44.81%), Query Frame = 2
Query:  911 GLGFTIVTRDNQVLYGSGADLSSSVVILVNKILSNGGAADDGRLRPGDRIIEVDNVPV--ISARDTTEKLKTIPVNTTVELLISR-----------------------IDNDESELNPPSSKLPKTSQLTFEISLNSKNKESQQLGLNIHYR-NEKDDPLLGTGIYIHSILSNSLASQQGNLHKNDKLVGVNGQSLANLSVEQTINLLKTAM 1468
            GLGF+I +RD          L  S  I V  IL  G A  DGRL+ GDR++EV+ V +      +    L+  P+  TV L++ R                       ++ +E  L P  ++      LT E+ LN    +S   GL +  + N   +     GI++ SI++   A + G L  ND+L+ VNG+SL   + +  +  L+ +M
Sbjct:  470 GLGFSITSRD--------VPLGGSAPIYVKNILPRGAAIQDGRLKAGDRLLEVNGVDLNGRGQEEVVSLLRATPMGGTVTLVVLRQEETFIPREMNAEPAIQNTREWKVEEEELVLTPDGTR----EFLTLEVPLN----DSGSAGLGVSVKGNRSKESHADLGIFVKSIINGGAACKDGRLRVNDQLIAVNGESLLGKTNQDAMETLRKSM 665          
BLAST of partitioning defective 3 homolog isoform X2 vs. Ensembl Xenopus
Match: znf532 (zinc finger protein 532 [Source:Xenbase;Acc:XB-GENE-491148])

HSP 1 Score: 93.2041 bits (230), Expect = 1.694e-18
Identity = 69/199 (34.67%), Postives = 102/199 (51.26%), Query Frame = 2
Query:  911 GLGFTIVTRDNQVLYGSGADLSSSVVILVNKILSNGGAADDGRLRPGDRIIEVD--NVPVISARDTTEKLKTIPVNTTVELLISRIDND----------ESELNPPSSKLPKTSQLTFEISLNSKNKESQQLGLNIHYR-NEKDDPLLGTGIYIHSILSNSLASQQGNLHKNDKLVGVNGQSLANLSVEQTINLLKTAM 1468
            GLGFT+VTRD+ V +G G        I V  IL  G A  DGRL  GDRI+EV+  ++   +  +    L++  +  +V L+++R D            E+ + PP +    T+Q+TFEI LN    +S   GL I  + N+  +     GI+I SI+    A + G L  ND+LV VNG+SL   S    +  L+ +M
Sbjct:  389 GLGFTVVTRDSTV-HGPGP-------IFVKNILPKGAAVKDGRLLSGDRILEVNGKDIAGKTQEELVAMLRSTKLGESVSLVVARQDETFLPRELKGETENLVFPPDN----TAQMTFEIPLN----DSGSAGLGISLKGNKSRETGADLGIFIKSIIHGGAAFKDGRLRVNDQLVAVNGESLLGKSNRDAMETLRRSM 571          
BLAST of partitioning defective 3 homolog isoform X2 vs. Ensembl Xenopus
Match: znf532 (zinc finger protein 532 [Source:Xenbase;Acc:XB-GENE-491148])

HSP 1 Score: 92.8189 bits (229), Expect = 1.952e-18
Identity = 69/199 (34.67%), Postives = 102/199 (51.26%), Query Frame = 2
Query:  911 GLGFTIVTRDNQVLYGSGADLSSSVVILVNKILSNGGAADDGRLRPGDRIIEVD--NVPVISARDTTEKLKTIPVNTTVELLISRIDND----------ESELNPPSSKLPKTSQLTFEISLNSKNKESQQLGLNIHYR-NEKDDPLLGTGIYIHSILSNSLASQQGNLHKNDKLVGVNGQSLANLSVEQTINLLKTAM 1468
            GLGFT+VTRD+ V +G G        I V  IL  G A  DGRL  GDRI+EV+  ++   +  +    L++  +  +V L+++R D            E+ + PP +    T+Q+TFEI LN    +S   GL I  + N+  +     GI+I SI+    A + G L  ND+LV VNG+SL   S    +  L+ +M
Sbjct:  306 GLGFTVVTRDSTV-HGPGP-------IFVKNILPKGAAVKDGRLLSGDRILEVNGKDIAGKTQEELVAMLRSTKLGESVSLVVARQDETFLPRELKGETENLVFPPDN----TAQMTFEIPLN----DSGSAGLGISLKGNKSRETGADLGIFIKSIIHGGAAFKDGRLRVNDQLVAVNGESLLGKSNRDAMETLRRSM 488          
BLAST of partitioning defective 3 homolog isoform X2 vs. Ensembl Xenopus
Match: znf532 (zinc finger protein 532 [Source:Xenbase;Acc:XB-GENE-491148])

HSP 1 Score: 92.4337 bits (228), Expect = 2.663e-18
Identity = 69/199 (34.67%), Postives = 102/199 (51.26%), Query Frame = 2
Query:  911 GLGFTIVTRDNQVLYGSGADLSSSVVILVNKILSNGGAADDGRLRPGDRIIEVD--NVPVISARDTTEKLKTIPVNTTVELLISRIDND----------ESELNPPSSKLPKTSQLTFEISLNSKNKESQQLGLNIHYR-NEKDDPLLGTGIYIHSILSNSLASQQGNLHKNDKLVGVNGQSLANLSVEQTINLLKTAM 1468
            GLGFT+VTRD+ V +G G        I V  IL  G A  DGRL  GDRI+EV+  ++   +  +    L++  +  +V L+++R D            E+ + PP +    T+Q+TFEI LN    +S   GL I  + N+  +     GI+I SI+    A + G L  ND+LV VNG+SL   S    +  L+ +M
Sbjct:  306 GLGFTVVTRDSTV-HGPGP-------IFVKNILPKGAAVKDGRLLSGDRILEVNGKDIAGKTQEELVAMLRSTKLGESVSLVVARQDETFLPRELKGETENLVFPPDN----TAQMTFEIPLN----DSGSAGLGISLKGNKSRETGADLGIFIKSIIHGGAAFKDGRLRVNDQLVAVNGESLLGKSNRDAMETLRRSM 488          
BLAST of partitioning defective 3 homolog isoform X2 vs. Ensembl Xenopus
Match: kcna5 (potassium channel, voltage gated shaker related subfamily A, member 5 [Source:Xenbase;Acc:XB-GENE-6037401])

HSP 1 Score: 87.8113 bits (216), Expect = 7.759e-17
Identity = 67/208 (32.21%), Postives = 101/208 (48.56%), Query Frame = 2
Query:  911 GLGFTIVTRDNQVLYGSGADLSSSVVILVNKILSNGGAADDGRLRPGDRIIEVDNVPVI--SARDTTEKLKTIPVNTTVELLISRIDN--DESELNPPSSKLP-----KTSQ-------------LTFEISLNSKNKESQQLGLNIHYRNEKDDPLLGTGIYIHSILSNSLASQQGNLHKNDKLVGVNGQSLANLSVEQTINLLKTAM 1468
            GLGF+I +RD          L  S  I V  IL  G A  DGR++ GDR++EV+ V +   +  +    L++  +   V LL+ R D      ELNP  S++      KT +             LTFEI LN     S  LG+++     K++     GI++ SI++   AS+ G L  ND+LV VNG+SL   + +  +  L+ +M
Sbjct:  469 GLGFSITSRD--------VPLGGSAPIYVKNILPRGAAIQDGRMKAGDRLLEVNGVDLTGRTQEEVVSLLRSTKMGGAVNLLVLRQDETFHPRELNPEPSQVSNARETKTEEEELVLTPDGTREFLTFEIPLNDSG--SAGLGVSVKGNRSKEN-HADLGIFVKSIINGGAASKDGRLRVNDQLVAVNGESLLGKTNQDAMETLRKSM 665          
BLAST of partitioning defective 3 homolog isoform X2 vs. Ensembl Xenopus
Match: kcna5 (potassium channel, voltage gated shaker related subfamily A, member 5 [Source:Xenbase;Acc:XB-GENE-6037401])

HSP 1 Score: 87.8113 bits (216), Expect = 7.806e-17
Identity = 67/208 (32.21%), Postives = 101/208 (48.56%), Query Frame = 2
Query:  911 GLGFTIVTRDNQVLYGSGADLSSSVVILVNKILSNGGAADDGRLRPGDRIIEVDNVPVI--SARDTTEKLKTIPVNTTVELLISRIDN--DESELNPPSSKLP-----KTSQ-------------LTFEISLNSKNKESQQLGLNIHYRNEKDDPLLGTGIYIHSILSNSLASQQGNLHKNDKLVGVNGQSLANLSVEQTINLLKTAM 1468
            GLGF+I +RD          L  S  I V  IL  G A  DGR++ GDR++EV+ V +   +  +    L++  +   V LL+ R D      ELNP  S++      KT +             LTFEI LN     S  LG+++     K++     GI++ SI++   AS+ G L  ND+LV VNG+SL   + +  +  L+ +M
Sbjct:  469 GLGFSITSRD--------VPLGGSAPIYVKNILPRGAAIQDGRMKAGDRLLEVNGVDLTGRTQEEVVSLLRSTKMGGAVNLLVLRQDETFHPRELNPEPSQVSNARETKTEEEELVLTPDGTREFLTFEIPLNDSG--SAGLGVSVKGNRSKEN-HADLGIFVKSIINGGAASKDGRLRVNDQLVAVNGESLLGKTNQDAMETLRKSM 665          
BLAST of partitioning defective 3 homolog isoform X2 vs. Ensembl Mouse
Match: Pard3b (par-3 family cell polarity regulator beta [Source:MGI Symbol;Acc:MGI:1919301])

HSP 1 Score: 90.5077 bits (223), Expect = 8.934e-18
Identity = 67/196 (34.18%), Postives = 99/196 (50.51%), Query Frame = 2
Query:  911 GLGFTIVTRDNQVLYGSGADLSSSVVILVNKILSNGGAADDGRLRPGDRIIEVDNVPVI--SARDTTEKLKTIPVNTTVELLISRIDND------ESELNPPSSKLPKTSQLTFEISLNSKNKESQQLGLNIHYRNEKDDPLLGT--GIYIHSILSNSLASQQGNLHKNDKLVGVNGQSLANLSVEQTINLLKTAM 1468
            GLGFT+VTRD+ + +G G        I V  IL  G A  DGRL+ GDRI+EV+   V   +  +    L++     TV L+I+R +        + E +  +  L  + QLT EI LN    +S   GL +  +  K     GT  GI+I SI+    A + G L  ND+L+ VNG++L   S  + +  L+ +M
Sbjct:  392 GLGFTVVTRDSSI-HGPGP-------IFVKNILPKGAAVKDGRLQSGDRILEVNGRDVTGRTQEELVAMLRSTKQGETVSLVIARQEGSFLPRELKGEPDCYALSLESSEQLTLEIPLN----DSGSAGLGVSLKGNKSRET-GTDLGIFIKSIIHGGAAFKDGRLRMNDQLIAVNGETLLGKSNHEAMETLRRSM 574          
BLAST of partitioning defective 3 homolog isoform X2 vs. Ensembl Mouse
Match: Pard3b (par-3 family cell polarity regulator beta [Source:MGI Symbol;Acc:MGI:1919301])

HSP 1 Score: 90.5077 bits (223), Expect = 9.972e-18
Identity = 67/196 (34.18%), Postives = 99/196 (50.51%), Query Frame = 2
Query:  911 GLGFTIVTRDNQVLYGSGADLSSSVVILVNKILSNGGAADDGRLRPGDRIIEVDNVPVI--SARDTTEKLKTIPVNTTVELLISRIDND------ESELNPPSSKLPKTSQLTFEISLNSKNKESQQLGLNIHYRNEKDDPLLGT--GIYIHSILSNSLASQQGNLHKNDKLVGVNGQSLANLSVEQTINLLKTAM 1468
            GLGFT+VTRD+ + +G G        I V  IL  G A  DGRL+ GDRI+EV+   V   +  +    L++     TV L+I+R +        + E +  +  L  + QLT EI LN    +S   GL +  +  K     GT  GI+I SI+    A + G L  ND+L+ VNG++L   S  + +  L+ +M
Sbjct:  392 GLGFTVVTRDSSI-HGPGP-------IFVKNILPKGAAVKDGRLQSGDRILEVNGRDVTGRTQEELVAMLRSTKQGETVSLVIARQEGSFLPRELKGEPDCYALSLESSEQLTLEIPLN----DSGSAGLGVSLKGNKSRET-GTDLGIFIKSIIHGGAAFKDGRLRMNDQLIAVNGETLLGKSNHEAMETLRRSM 574          
BLAST of partitioning defective 3 homolog isoform X2 vs. Ensembl Mouse
Match: Pard3 (par-3 family cell polarity regulator [Source:MGI Symbol;Acc:MGI:2135608])

HSP 1 Score: 87.0409 bits (214), Expect = 2.813e-17
Identity = 64/208 (30.77%), Postives = 100/208 (48.08%), Query Frame = 2
Query:  911 GLGFTIVTRDNQVLYGSGADLSSSVVILVNKILSNGGAADDGRLRPGDRIIEVDNVPVI--SARDTTEKLKTIPVNTTVELLISRIDND----ESELNPPSSKLPKTSQ----------------LTFEISLNSKNKESQQLGLNIHYRNEKDDPLLGTGIYIHSILSNSLASQQGNLHKNDKLVGVNGQSLANLSVEQTINLLKTAM 1468
            GLGF+I +RD          +  S  I V  IL  G A  DGRL+ GDR+IEV+ V +   S  +    L++  +  TV LL+ R +      E    P   + PK ++                LTFE+ LN     S  LG+++     K++     GI++ SI++   AS+ G L  ND+L+ VNG+SL   + ++ +  L+ +M
Sbjct:  192 GLGFSITSRD--------VTIGGSAPIYVKNILPRGAAIQDGRLKAGDRLIEVNGVDLAGKSQEEVVSLLRSTKMEGTVSLLVFRQEEAFHPREMNAEPSQMQTPKETKAEDEDVVLTPDGTREFLTFEVPLNDSG--SAGLGVSVKGNRSKENHA-DLGIFVKSIINGGAASKDGRLRVNDQLIAVNGESLLGKANQEAMETLRRSM 388          
BLAST of partitioning defective 3 homolog isoform X2 vs. Ensembl Mouse
Match: Pard3 (par-3 family cell polarity regulator [Source:MGI Symbol;Acc:MGI:2135608])

HSP 1 Score: 88.9669 bits (219), Expect = 3.111e-17
Identity = 62/199 (31.16%), Postives = 100/199 (50.25%), Query Frame = 2
Query:  911 GLGFTIVTRDNQVLYGSGADLSSSVVILVNKILSNGGAADDGRLRPGDRIIEVDNVPVI--SARDTTEKLKTIPVNTTVELLISR-----------IDNDESELNPPSSKLPKTSQLTFEISLNSKNKESQQLGLNIHYRNEKDDPLLGTGIYIHSILSNSLASQQGNLHKNDKLVGVNGQSLANLSVEQTINLLKTAM 1468
            GLGF+I +RD          +  S  I V  IL  G A  DGRL+ GDR+IEV+ V +   S  +    L++  +  TV LL+ R            ++++  L P  ++      LTFE+ LN     S  LG+++     K++     GI++ SI++   AS+ G L  ND+L+ VNG+SL   + ++ +  L+ +M
Sbjct:  426 GLGFSITSRD--------VTIGGSAPIYVKNILPRGAAIQDGRLKAGDRLIEVNGVDLAGKSQEEVVSLLRSTKMEGTVSLLVFRQEEAFHPREMKAEDEDVVLTPDGTR----EFLTFEVPLNDSG--SAGLGVSVKGNRSKENHA-DLGIFVKSIINGGAASKDGRLRVNDQLIAVNGESLLGKANQEAMETLRRSM 609          
BLAST of partitioning defective 3 homolog isoform X2 vs. Ensembl Mouse
Match: Pard3 (par-3 family cell polarity regulator [Source:MGI Symbol;Acc:MGI:2135608])

HSP 1 Score: 88.5817 bits (218), Expect = 3.805e-17
Identity = 64/208 (30.77%), Postives = 100/208 (48.08%), Query Frame = 2
Query:  911 GLGFTIVTRDNQVLYGSGADLSSSVVILVNKILSNGGAADDGRLRPGDRIIEVDNVPVI--SARDTTEKLKTIPVNTTVELLISRIDND----ESELNPPSSKLPKTSQ----------------LTFEISLNSKNKESQQLGLNIHYRNEKDDPLLGTGIYIHSILSNSLASQQGNLHKNDKLVGVNGQSLANLSVEQTINLLKTAM 1468
            GLGF+I +RD          +  S  I V  IL  G A  DGRL+ GDR+IEV+ V +   S  +    L++  +  TV LL+ R +      E    P   + PK ++                LTFE+ LN     S  LG+++     K++     GI++ SI++   AS+ G L  ND+L+ VNG+SL   + ++ +  L+ +M
Sbjct:  470 GLGFSITSRD--------VTIGGSAPIYVKNILPRGAAIQDGRLKAGDRLIEVNGVDLAGKSQEEVVSLLRSTKMEGTVSLLVFRQEEAFHPREMNAEPSQMQTPKETKAEDEDVVLTPDGTREFLTFEVPLNDSG--SAGLGVSVKGNRSKEN-HADLGIFVKSIINGGAASKDGRLRVNDQLIAVNGESLLGKANQEAMETLRRSM 666          
BLAST of partitioning defective 3 homolog isoform X2 vs. UniProt/SwissProt
Match: sp|Q8TEW8|PAR3L_HUMAN (Partitioning defective 3 homolog B OS=Homo sapiens OX=9606 GN=PARD3B PE=1 SV=2)

HSP 1 Score: 93.5893 bits (231), Expect = 7.353e-18
Identity = 74/222 (33.33%), Postives = 111/222 (50.00%), Query Frame = 2
Query:  911 GLGFTIVTRDNQVLYGSGADLSSSVVILVNKILSNGGAADDGRLRPGDRIIEVDNVPVI--SARDTTEKLKTIPVNTTVELLISRIDND------ESELNPPSSKLPKTSQLTFEISLNSKNKESQQLGLNIHYRNEKDDPLLGT--GIYIHSILSNSLASQQGNLHKNDKLVGVNGQSLANLSVEQTINLLK--TAMQNN--SFLAITVMR--ESMNEDPS 1528
            GLGFT+VTRD+ + +G G        I V  IL  G A  DGRL+ GDRI+EV+   V   +  +    L++     T  L+I+R +        + E +  +  L  + QLTFEI LN    +S   GL +  +  K     GT  GI+I SI+    A + G L  ND+L+ VNG+SL   S  + +  L+   +M+ N    + + ++R  E   EDP+
Sbjct:  392 GLGFTVVTRDSSI-HGPGP-------IFVKNILPKGAAIKDGRLQSGDRILEVNGRDVTGRTQEELVAMLRSTKQGETASLVIARQEGHFLPRELKGEPDCCALSLETSEQLTFEIPLN----DSGSAGLGVSLKGNKSRET-GTDLGIFIKSIIHGGAAFKDGRLRMNDQLIAVNGESLLGKSNHEAMETLRRSMSMEGNIRGMIQLVILRRPERPMEDPA 600          
BLAST of partitioning defective 3 homolog isoform X2 vs. UniProt/SwissProt
Match: sp|Q8TEW0|PARD3_HUMAN (Partitioning defective 3 homolog OS=Homo sapiens OX=9606 GN=PARD3 PE=1 SV=2)

HSP 1 Score: 91.6633 bits (226), Expect = 2.701e-17
Identity = 94/323 (29.10%), Postives = 154/323 (47.68%), Query Frame = 2
Query:  572 QYDLESSKNKGNYYGSVNNTYRNEVDSSDSSISDLYPKPSNKSKAKLNRNMDLPMKGINNEEKFPMSKSAPASPTKPVPPLRSPQTHL--TMINVHNVRTXXXXXXXXXXXXPNGGLGFTIVTRDNQVLYGSGADLSSSVVILVNKILSNGGAADDGRLRPGDRIIEVDNVPVI--SARDTTEKLKTIPVNTTVELLISRIDN--DESELN--PPSSKLPKTSQ----------------LTFEISLNSKNKESQQLGLNIHYRNEKDDPLLGTGIYIHSILSNSLASQQGNLHKNDKLVGVNGQSLANLSVEQTINLLKTAM 1468
            QY+  S   K NYY S  +     +D+   + + L+   + +   +LN     P + I++  + P S      P  P  P  +PQ     T+ + +N + IGK++ I + K   G LGF+I +RD          +  S  I V  IL  G A  DGRL+ GDR+IEV+ V ++  S  +    L++  +  TV LL+ R ++     ELN  P   ++PK ++                LTFE+ LN     S  LG+++     K++     GI++ SI++   AS+ G L  ND+L+ VNG+SL   + +  +  L+ +M
Sbjct:  365 QYEQLSQSEKNNYYSSRFSPDSQYIDNRSVNSAGLH---TVQRAPRLNH----PPEQIDSHSRLPHSAHPSGKP--PSAPASAPQNVFSTTVSSGYNTKKIGKRLNIQLKKGTEG-LGFSITSRD--------VTIGGSAPIYVKNILPRGAAIQDGRLKAGDRLIEVNGVDLVGKSQEEVVSLLRSTKMEGTVSLLVFRQEDAFHPRELNAEPSQMQIPKETKAEDEDIVLTPDGTREFLTFEVPLNDSG--SAGLGVSVKGNRSKEN-HADLGIFVKSIINGGAASKDGRLRVNDQLIAVNGESLLGKTNQDAMETLRRSM 666          
BLAST of partitioning defective 3 homolog isoform X2 vs. UniProt/SwissProt
Match: sp|Q9CSB4|PAR3L_MOUSE (Partitioning defective 3 homolog B OS=Mus musculus OX=10090 GN=Pard3b PE=1 SV=2)

HSP 1 Score: 90.5077 bits (223), Expect = 6.249e-17
Identity = 67/196 (34.18%), Postives = 99/196 (50.51%), Query Frame = 2
Query:  911 GLGFTIVTRDNQVLYGSGADLSSSVVILVNKILSNGGAADDGRLRPGDRIIEVDNVPVI--SARDTTEKLKTIPVNTTVELLISRIDND------ESELNPPSSKLPKTSQLTFEISLNSKNKESQQLGLNIHYRNEKDDPLLGT--GIYIHSILSNSLASQQGNLHKNDKLVGVNGQSLANLSVEQTINLLKTAM 1468
            GLGFT+VTRD+ + +G G        I V  IL  G A  DGRL+ GDRI+EV+   V   +  +    L++     TV L+I+R +        + E +  +  L  + QLT EI LN    +S   GL +  +  K     GT  GI+I SI+    A + G L  ND+L+ VNG++L   S  + +  L+ +M
Sbjct:  392 GLGFTVVTRDSSI-HGPGP-------IFVKNILPKGAAVKDGRLQSGDRILEVNGRDVTGRTQEELVAMLRSTKQGETVSLVIARQEGSFLPRELKGEPDCYALSLESSEQLTLEIPLN----DSGSAGLGVSLKGNKSRET-GTDLGIFIKSIIHGGAAFKDGRLRMNDQLIAVNGETLLGKSNHEAMETLRRSM 574          
BLAST of partitioning defective 3 homolog isoform X2 vs. UniProt/SwissProt
Match: sp|Q99NH2|PARD3_MOUSE (Partitioning defective 3 homolog OS=Mus musculus OX=10090 GN=Pard3 PE=1 SV=2)

HSP 1 Score: 88.1965 bits (217), Expect = 3.010e-16
Identity = 64/208 (30.77%), Postives = 100/208 (48.08%), Query Frame = 2
Query:  911 GLGFTIVTRDNQVLYGSGADLSSSVVILVNKILSNGGAADDGRLRPGDRIIEVDNVPVI--SARDTTEKLKTIPVNTTVELLISRIDND----ESELNPPSSKLPKTSQ----------------LTFEISLNSKNKESQQLGLNIHYRNEKDDPLLGTGIYIHSILSNSLASQQGNLHKNDKLVGVNGQSLANLSVEQTINLLKTAM 1468
            GLGF+I +RD          +  S  I V  IL  G A  DGRL+ GDR+IEV+ V +   S  +    L++  +  TV LL+ R +      E    P   + PK ++                LTFE+ LN     S  LG+++     K++     GI++ SI++   AS+ G L  ND+L+ VNG+SL   + ++ +  L+ +M
Sbjct:  470 GLGFSITSRD--------VTIGGSAPIYVKNILPRGAAIQDGRLKAGDRLIEVNGVDLAGKSQEEVVSLLRSTKMEGTVSLLVFRQEEAFHPREMNAEPSQMQTPKETKAEDEDVVLTPDGTREFLTFEVPLNDSG--SAGLGVSVKGNRSKEN-HADLGIFVKSIINGGAASKDGRLRVNDQLIAVNGESLLGKANQEAMETLRRSM 666          
BLAST of partitioning defective 3 homolog isoform X2 vs. UniProt/SwissProt
Match: sp|Q9Z340|PARD3_RAT (Partitioning defective 3 homolog OS=Rattus norvegicus OX=10116 GN=Pard3 PE=1 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 5.055e-16
Identity = 64/208 (30.77%), Postives = 100/208 (48.08%), Query Frame = 2
Query:  911 GLGFTIVTRDNQVLYGSGADLSSSVVILVNKILSNGGAADDGRLRPGDRIIEVDNVPVI--SARDTTEKLKTIPVNTTVELLISRIDND----ESELNPPSSKLPKTSQ----------------LTFEISLNSKNKESQQLGLNIHYRNEKDDPLLGTGIYIHSILSNSLASQQGNLHKNDKLVGVNGQSLANLSVEQTINLLKTAM 1468
            GLGF+I +RD          +  S  I V  IL  G A  DGRL+ GDR+IEV+ V +   S  +    L++  +  TV LL+ R +      E    P   + PK ++                LTFE+ LN     S  LG+++     K++     GI++ SI++   AS+ G L  ND+L+ VNG+SL   + ++ +  L+ +M
Sbjct:  470 GLGFSITSRD--------VTIGGSAPIYVKNILPRGAAIQDGRLKAGDRLIEVNGVDLAGKSQEEVVSLLRSTKMEGTVSLLVFRQEEAFHPREMNAEPSQMQSPKETKAEDEDIVLTPDGTREFLTFEVPLNDSG--SAGLGVSVKGNRSKENHA-DLGIFVKSIINGGAASKDGRLRVNDQLIAVNGESLLGKANQEAMETLRRSM 666          
BLAST of partitioning defective 3 homolog isoform X2 vs. TrEMBL
Match: A0A075A3J9 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_00091 PE=4 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 1.302e-18
Identity = 112/387 (28.94%), Postives = 173/387 (44.70%), Query Frame = 2
Query:  842 INVHNVRTXXXXXXXXXXXXPNGGLGFTIVTRDNQVLYGSGADLSSSVVILVNKILSNGGAADDGRLRPGDRIIEVDNVPVISARDTTEKLKTIPVNTTVELLISRIDNDESELNPP-------------SSKLPKTSQLTFEI---SLNSKNKESQQLGLNIHYRNEKD--DPLLGT--GIYIHSILSNSLASQQG--NLHKNDKLVGVNGQSLANLSVEQTINLLKTAMQNNSF---------------LAITVMRESMNEDPSNLIVTNNSKFIINNENIPKSEITRCILPXXXXXXXXXXXXXXHRHQRNSSSDSCSQNEFDPSHSLTSNSFVREGPSRRSMSEKRKFCEDPSQYQVYQKRIGDITFEANE---RQYSTLPTA 1882
            +N  N RTIG+KI I ++K   GGLGFT+ +RD +V         ++  + V KILS G A  DGRL  GDR++ V+ V V +  D    L++IP   TVEL++SR      E                 +S       LTFE    SL     E  QLG+N  +       DP      G+Y+ S+L + L +Q G   L   DKLVG+NG++L   S +   + +K  +   +                 ++T+ R +  +  S+   + +    +  E   +S               +   +++H  + +  SD  ++    P   L +  F REG  RRS+SEKR    D +Q+  +Q  I    ++  E   +QYST+PTA
Sbjct:  312 VNAFNTRTIGQKISIDLVKLAKGGLGFTLTSRDTKV------SPQANEPVYVKKILSTGAAITDGRLLIGDRLLTVNGVEVENLEDAISHLRSIPPGRTVELVVSRQATIAGESRSSDRRSTRISSATGVASPCRPFRSLTFEFYLPSLEESRGEPPQLGVNFKWALHPPGCDPSYAESPGLYVDSVLPDGLITQYGRKTLLPGDKLVGLNGENLEGESGKIIASRIKQVLSGATLELPSPHVEGRNTHRRFSLTIHRYNGLDRVSSSSRSPHKSSTVFEEPEDESSAIHSSTIHWSDTRRRRISRAEHGPEYSGGSDK-TRYPSTPPRLLENPHFQREGLGRRSVSEKRHAHVDATQFSFFQTNILPNRYKMPEEVDKQYSTMPTA 691          
BLAST of partitioning defective 3 homolog isoform X2 vs. TrEMBL
Match: A0A1S8X1K2 (PDZ/DHR/GLGF domain protein OS=Opisthorchis viverrini OX=6198 GN=X801_03526 PE=4 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 1.602e-18
Identity = 112/387 (28.94%), Postives = 173/387 (44.70%), Query Frame = 2
Query:  842 INVHNVRTXXXXXXXXXXXXPNGGLGFTIVTRDNQVLYGSGADLSSSVVILVNKILSNGGAADDGRLRPGDRIIEVDNVPVISARDTTEKLKTIPVNTTVELLISRIDNDESELNPP-------------SSKLPKTSQLTFEI---SLNSKNKESQQLGLNIHYRNEKD--DPLLGT--GIYIHSILSNSLASQQG--NLHKNDKLVGVNGQSLANLSVEQTINLLKTAMQNNSF---------------LAITVMRESMNEDPSNLIVTNNSKFIINNENIPKSEITRCILPXXXXXXXXXXXXXXHRHQRNSSSDSCSQNEFDPSHSLTSNSFVREGPSRRSMSEKRKFCEDPSQYQVYQKRIGDITF---EANERQYSTLPTA 1882
            +N  N RTIG+KI I ++K   GGLGFT+ +RD +V         ++  + V KILS G A  DGRL  GDR++ V+ V V +  D    L++IP   TVEL++SR      E                 +S       LTFE    SL     E  QLG+N  +       DP      G+Y+ S+L + L +Q G   L   DKLVG+NG++L   S +   + +K  +   +                 ++T+ R +  +  S+   + +    +  E   +S               +   +++H  + +  SD  ++    P   L +  F REG  RRS+SEKR    D +Q+  +Q  I    +   E  ++QYST+PTA
Sbjct:  565 VNAFNTRTIGQKISIDLVKLAKGGLGFTLTSRDTKV------SPQANEPVYVKKILSTGAAITDGRLLIGDRLLTVNGVEVENLEDAISHLRSIPPGRTVELVVSRQATIAGESRSSDRRSTRISSATGVASPCRPFRSLTFEFYLPSLEESRGEPPQLGVNFKWALHPPGCDPSYAESPGLYVDSVLPDGLITQYGRKTLLPGDKLVGLNGENLEGESGKIIASRIKQVLSGATLELPSPHVEGRNTHRRFSLTIHRYNGLDRVSSSSRSPHKSSTVFEEPEDESSAIHSSTIHWSDTRRRRISRAEHGPEYSGGSDK-TRYPSTPPRLLENPHFQREGLGRRSVSEKRHAHVDATQFSFFQTNILPNRYKMPEEVDKQYSTMPTA 944          
BLAST of partitioning defective 3 homolog isoform X2 vs. TrEMBL
Match: A0A087TP09 (Partitioning defective 3-like protein (Fragment) OS=Stegodyphus mimosarum OX=407821 GN=X975_21477 PE=4 SV=1)

HSP 1 Score: 103.219 bits (256), Expect = 1.748e-18
Identity = 71/204 (34.80%), Postives = 107/204 (52.45%), Query Frame = 2
Query:  908 GGLGFTIVTRDNQVLYGSGADLSSSVVILVNKILSNGGAADDGRLRPGDRIIEVDNVPVI--SARDTTEKLKTIPVNTTVELLISRIDNDESE----LNPPSSKLPKTSQ--------LTFEISLNSKNKESQQLGLNIHYRNEKDDPLLGT---GIYIHSILSNSLASQQGNLHKNDKLVGVNGQSLANLSVEQTINLLKTAM 1468
             GLGF+I TRDN            +  I +  IL  G A +DGRL+PGDR++EV+++P+   S  +    L+ IP+  TV+L++SR + +ESE     N  SSKL +           LTF+I L     +S   GL +  + +    + G+   GI+I S++    AS+ G L  ND+LV +NG SL  +S    +  L+ AM
Sbjct:   11 AGLGFSITTRDNPA--------GGNSPIYIKNILPKGAAIEDGRLQPGDRLLEVNSMPMTGKSQAEAVSVLRNIPLGKTVQLVVSRQELEESENAEQDNDSSSKLDEAGIFPWKHREILTFQIPLT----DSHSAGLGVSVKGKSTSTVSGSVDLGIFIKSVIPGGAASKDGRLQTNDQLVNINGISLLGMSNSNAMETLRNAM 202          
BLAST of partitioning defective 3 homolog isoform X2 vs. TrEMBL
Match: A0A1I8FW05 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 4.062e-18
Identity = 71/233 (30.47%), Postives = 123/233 (52.79%), Query Frame = 2
Query:  827 THLTMINVHNVRTXXXXXXXXXXXXPNGGLGFTIVTRDNQVLYGSGADLSSSVVILVNKILSNGGAADDGRLRPGDRIIEVDNVPVI--SARDTTEKLKTIPVNTTVELLISR--------IDNDESELNPPSSKLPKTSQLTFEISLNSKNKESQQLGLNI--HYRNEKDDPLLGTGIYIHSILSNSLASQQGNLHKNDKLVGVNGQSLANLSVEQTINLLKTAMQNNSFLA 1489
            T  + +N  NVRT+G    + ++K  +G LGF++  RDN V  G          I V  IL+ G A  DGRL+ GDR++E+D   +   +  D    L+++P   TV L++SR        +  D + + P +    ++  L F+I LN  +  S  LG+++  H R+ +D     +G++I +++    A + G L +ND+L+ VNG SLA +  +  +  L+ A++++S L 
Sbjct:  370 TTASGLNAQNVRTLGHVFSVDLIKSTDG-LGFSVTARDNAVAAGDNP-------IFVKTILAKGSAIRDGRLKAGDRLLEIDGNKLTGKTQADVVSLLRSVPTGATVRLVLSRQGSAPPAGVGADGTAMGPTADN-SESRTLVFDIPLN--DSASAGLGVSVKGHTRDRED-----SGVFIKNVMKGGAAQKDGRLRENDRLLSVNGTSLAGVDNDAAMAALRQAIKDSSDLG 586          
BLAST of partitioning defective 3 homolog isoform X2 vs. TrEMBL
Match: H3A3L1 (Uncharacterized protein OS=Latimeria chalumnae OX=7897 GN=PARD3B PE=4 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 7.646e-18
Identity = 81/237 (34.18%), Postives = 118/237 (49.79%), Query Frame = 2
Query:  911 GLGFTIVTRDNQVLYGSGADLSSSVVILVNKILSNGGAADDGRLRPGDRIIEVDNVPVISARDTTEK--------LKTIPVNTTVELLISRIDN--------DESELNPPSSKLPKTSQLTFEISLNSKNKESQQLGLNIHYR-NEKDDPLLGTGIYIHSILSNSLASQQGNLHKNDKLVGVNGQSLANLSVEQTINLLK--TAMQNN--SFLAITVMR--ESMNEDPSNLIVTNNS 1552
            GLGFT+VTRD+  ++G G        ILV  IL  G A  DGRL+ GDRI+EV+       RD T K        L++     TV L+++R D          E +   P  ++ +  QLTFEI LN    +S   GL +  + N+  +     GI+I S++    A + G L  ND+L+ VNG+SL   S  + +  L+   +M+ N    + + V+R  E   EDPS L+V   S
Sbjct:  397 GLGFTVVTRDSS-MHGPGP-------ILVKNILPRGAAVKDGRLQSGDRILEVN------GRDITGKTQEELVAMLRSTKQGETVSLIVARQDEMFIPRELKGEPDYTFPLQEIKE--QLTFEIPLN----DSGSAGLGVSLKGNKSRETGADLGIFIKSVIHGGAAYKDGRLRVNDQLIAVNGESLLGKSNHEAMETLRRSMSMEGNIRGMIQLVVIRRFERQVEDPSELVVIQKS 613          
BLAST of partitioning defective 3 homolog isoform X2 vs. Ensembl Cavefish
Match: pard3ba (par-3 family cell polarity regulator beta a [Source:ZFIN;Acc:ZDB-GENE-080225-12])

HSP 1 Score: 95.9005 bits (237), Expect = 1.551e-19
Identity = 69/206 (33.50%), Postives = 98/206 (47.57%), Query Frame = 2
Query:  911 GLGFTIVTRDNQVLYGSGADLSSSVVILVNKILSNGGAADDGRLRPGDRIIEVDNVPVI--SARDTTEKLKTIPVNTTVELLISRIDN--------DESELNPPSSKLPKTSQLTFEISLNSKNKESQQLGLNIHYRNEKDDPLLGTGIYIHSILSNSLASQQGNLHKNDKLVGVNGQSLANLSVEQTINLLKTAMQNNSFLAITV 1498
            GLGFT+VTRD+ V +G G        ILV  IL  G A  DGRL+ GDRI+EV+ V +   S  +    L++  +  TV L ++R +          E    PPS       QL FE+ L+        L L  +   E  + L   GI+I S++    A + G L  ND+L+ VNG+SL   S    +  L+ +M     L  T+
Sbjct:  382 GLGFTVVTRDSSV-HGPGP-------ILVKSILPRGAAVKDGRLQSGDRILEVNGVDITGHSQEELVAMLRSTKLGETVSLFVTRQEELFLPRELKGEPSAPPPSED--GREQLMFEVPLSDSGSAGLGLSLKGNKSRETGEDL---GIFIKSVIHGGAAFKDGRLRPNDQLLAVNGESLLGRSNHDAMETLRRSMSMEGNLRGTI 574          
BLAST of partitioning defective 3 homolog isoform X2 vs. Ensembl Cavefish
Match: pard3bb (partitioning defective 3 homolog B [Source:NCBI gene;Acc:103029032])

HSP 1 Score: 86.6557 bits (213), Expect = 1.043e-16
Identity = 64/195 (32.82%), Postives = 96/195 (49.23%), Query Frame = 2
Query:  911 GLGFTIVTRDNQVLYGSGADLSSSVVILVNKILSNGGAADDGRLRPGDRIIEVDNVPVI--SARDTTEKLKTIPVNTTVELLISRIDN-------DESELNPPSSKLPKTSQLTFEISLNSKNKESQQLGLNIHYRNEKDDPLLGTGIYIHSILSNSLASQQGNLHKNDKLVGVNGQSLANLSVEQTINLLKTAM 1468
            GLGFT+VTRD+ V +G G        ILV  IL  G A  DGRL+ GDRI+EV+ V +   +  +    L++     +V L+++R +         E  +    S+  K  QL FE+ LN        + L  +   E  + L   GI+I SI+    A + G L  ND+L+ VNG+ L   S  + +  L+ +M
Sbjct:  409 GLGFTVVTRDSSV-HGPGP-------ILVKNILPRGAAVKDGRLQSGDRILEVNGVDITGRTQEELVAMLRSTKQGDSVCLVVARQEEMFLPRELKEEAVRAVLSEEGK-EQLMFEVPLNDSGSAGLGVSLKGNKSRETGEDL---GIFIKSIIHGGAAYKDGRLRVNDQLIAVNGEPLLGKSNHEAMETLRRSM 591          
BLAST of partitioning defective 3 homolog isoform X2 vs. Ensembl Cavefish
Match: pard3bb (partitioning defective 3 homolog B [Source:NCBI gene;Acc:103029032])

HSP 1 Score: 86.6557 bits (213), Expect = 1.208e-16
Identity = 64/195 (32.82%), Postives = 96/195 (49.23%), Query Frame = 2
Query:  911 GLGFTIVTRDNQVLYGSGADLSSSVVILVNKILSNGGAADDGRLRPGDRIIEVDNVPVI--SARDTTEKLKTIPVNTTVELLISRIDN-------DESELNPPSSKLPKTSQLTFEISLNSKNKESQQLGLNIHYRNEKDDPLLGTGIYIHSILSNSLASQQGNLHKNDKLVGVNGQSLANLSVEQTINLLKTAM 1468
            GLGFT+VTRD+ V +G G        ILV  IL  G A  DGRL+ GDRI+EV+ V +   +  +    L++     +V L+++R +         E  +    S+  K  QL FE+ LN        + L  +   E  + L   GI+I SI+    A + G L  ND+L+ VNG+ L   S  + +  L+ +M
Sbjct:  351 GLGFTVVTRDSSV-HGPGP-------ILVKNILPRGAAVKDGRLQSGDRILEVNGVDITGRTQEELVAMLRSTKQGDSVCLVVARQEEMFLPRELKEEAVRAVLSEEGK-EQLMFEVPLNDSGSAGLGVSLKGNKSRETGEDL---GIFIKSIIHGGAAYKDGRLRVNDQLIAVNGEPLLGKSNHEAMETLRRSM 533          
BLAST of partitioning defective 3 homolog isoform X2 vs. Ensembl Cavefish
Match: pard3bb (partitioning defective 3 homolog B [Source:NCBI gene;Acc:103029032])

HSP 1 Score: 86.2705 bits (212), Expect = 1.312e-16
Identity = 67/211 (31.75%), Postives = 103/211 (48.82%), Query Frame = 2
Query:  911 GLGFTIVTRDNQVLYGSGADLSSSVVILVNKILSNGGAADDGRLRPGDRIIEVDNVPVI--SARDTTEKLKTIPVNTTVELLISRIDN-------DESELNPPSSKLPKTSQLTFEISLNSKNKESQQLGLNIHYRNEKDDPLLGTGIYIHSILSNSLASQQGNLHKNDKLVGVNGQSLANLSVEQTINLLK--TAMQNN--SFLAITVMR 1504
            GLGFT+VTRD+ V +G G        ILV  IL  G A  DGRL+ GDRI+EV+ V +   +  +    L++     +V L+++R +         E  +    S+  K  QL FE+ LN        + L  +   E  + L   GI+I SI+    A + G L  ND+L+ VNG+ L   S  + +  L+   +M+ N    + + V+R
Sbjct:  409 GLGFTVVTRDSSV-HGPGP-------ILVKNILPRGAAVKDGRLQSGDRILEVNGVDITGRTQEELVAMLRSTKQGDSVCLVVARQEEMFLPRELKEEAVRAVLSEEGK-EQLMFEVPLNDSGSAGLGVSLKGNKSRETGEDL---GIFIKSIIHGGAAYKDGRLRVNDQLIAVNGEPLLGKSNHEAMETLRRSMSMEGNLRGMIQLVVLR 607          
BLAST of partitioning defective 3 homolog isoform X2 vs. Ensembl Cavefish
Match: pard3bb (partitioning defective 3 homolog B [Source:NCBI gene;Acc:103029032])

HSP 1 Score: 86.2705 bits (212), Expect = 1.316e-16
Identity = 64/195 (32.82%), Postives = 96/195 (49.23%), Query Frame = 2
Query:  911 GLGFTIVTRDNQVLYGSGADLSSSVVILVNKILSNGGAADDGRLRPGDRIIEVDNVPVI--SARDTTEKLKTIPVNTTVELLISRIDN-------DESELNPPSSKLPKTSQLTFEISLNSKNKESQQLGLNIHYRNEKDDPLLGTGIYIHSILSNSLASQQGNLHKNDKLVGVNGQSLANLSVEQTINLLKTAM 1468
            GLGFT+VTRD+ V +G G        ILV  IL  G A  DGRL+ GDRI+EV+ V +   +  +    L++     +V L+++R +         E  +    S+  K  QL FE+ LN        + L  +   E  + L   GI+I SI+    A + G L  ND+L+ VNG+ L   S  + +  L+ +M
Sbjct:  409 GLGFTVVTRDSSV-HGPGP-------ILVKNILPRGAAVKDGRLQSGDRILEVNGVDITGRTQEELVAMLRSTKQGDSVCLVVARQEEMFLPRELKEEAVRAVLSEEGK-EQLMFEVPLNDSGSAGLGVSLKGNKSRETGEDL---GIFIKSIIHGGAAYKDGRLRVNDQLIAVNGEPLLGKSNHEAMETLRRSM 591          
BLAST of partitioning defective 3 homolog isoform X2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006056.1 (pep scaffold:Pmarinus_7.0:GL477535:225:55869:1 gene:ENSPMAG00000005437.1 transcript:ENSPMAT00000006056.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 78.5666 bits (192), Expect = 5.847e-15
Identity = 64/224 (28.57%), Postives = 100/224 (44.64%), Query Frame = 2
Query:  911 GLGFTIVTRDNQVLYGSGADLSSSVVILVNKILSNGGAADDGRLRPGDRIIEVDNVPVIS--ARDTTEKLKTIPVNTTVELLISRID------NDESELNPPSSKLPKTSQ-------------LTFEISLNSKNKESQQLGLNIHYRNEKDDPL-LGTGIYIHSILSNSLASQQGNLHKNDKLVGVNGQSLANLSVEQTINLLKTAMQNN----SFLAITVMR 1504
            GLGFTI TRD  V             I V  I+S G A  DGRL+ GDR++EV+ + V S    +    L++  +  +V+LL+SR        +D + LN    +     +             LT  I L+     S    L +  +  KD       GI+I +I++   A++ G L  +D+L+ VN +SL   S  + +  L+ AM  +    S + + V R
Sbjct:  423 GLGFTIATRDTPV--------GGRTPIYVKSIMSKGAALSDGRLKSGDRLLEVNGLDVTSRTQEEVVAILRSTKLGGSVDLLVSRHHDVPLSPDDPAGLNSRVWRCSAAEEEDRLLSPDGSREFLTLHIPLHDMGAAS----LGVSVKGTKDRRTNADLGIFIKTIIAGGAAAKDGRLRVDDQLIAVNRESLLGRSNLEAMESLRCAMSRDAGDPSLIQLVVAR 634          
BLAST of partitioning defective 3 homolog isoform X2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002205.1 (pep scaffold:Pmarinus_7.0:GL477144:51012:68257:1 gene:ENSPMAG00000001988.1 transcript:ENSPMAT00000002205.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 71.633 bits (174), Expect = 6.710e-13
Identity = 61/216 (28.24%), Postives = 92/216 (42.59%), Query Frame = 2
Query:  911 GLGFTIVTRDNQVLYGSGADLSSSVVILVNKILSNGGAADDGRLRPGDRIIEVDNVPV--ISARDTTEKLKTIPVNTTVELLISRIDNDESELNPPSSKLPKTSQ-----------------------LTFEISLNSKNKESQQLGLNIHYR-NEKDDPLLGTGIYIHSILSNSLASQQGNLHKNDKLVGVNGQSLANLSVEQTINLLKTAMQNNS 1480
            GLGF++ +RD  V        S    + +  IL  G A  DGRL  GDR+I V+ V V  +S       L+ +   ++V+LL+SR D   + L PP+ +     Q                       L  EI+L+    E    GL +  + N   D     GIY+ SI++   A++ G L   D+LV VN + L   S    +  L+  M  + 
Sbjct:  396 GLGFSLTSRDTPV--------SGLGHVYIKHILPRGAAIADGRLHAGDRLIMVNGVDVSSMSQDQVVSILRGVHPGSSVDLLVSRHD---ALLTPPAQEARLVKQMHPDQQAERSGGMIVTASGPCECLNLEIALS----ECGPAGLGVSVKGNRSRDGAHDLGIYVKSIIAGGAAAKDGRLRIGDQLVAVNREPLLGRSNAAAMETLRRCMATDG 596          
BLAST of partitioning defective 3 homolog isoform X2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004677.1 (pep scaffold:Pmarinus_7.0:GL479538:28591:32639:-1 gene:ENSPMAG00000004260.1 transcript:ENSPMAT00000004677.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.1434 bits (126), Expect = 4.196e-8
Identity = 44/166 (26.51%), Postives = 78/166 (46.99%), Query Frame = 2
Query:  989 ILVNKILSNGGAADDGRLRPGDRIIEVDNVPVISA--RDTTEKLKTIPVNTTVELLISRID-----NDESELNPPSSKLPKTSQLTFEISLNSKNKESQQLGLNIHYRNEKDDPLLGTGIYIHSILSNSLASQQGNLHKNDKLVGVNGQSLANLSVEQTINLLKTA 1465
            I+++++   G AA DGRL  GD+I++V+   + SA   D    L+  P    V L + R +     +DES L+  + +L K              K  + LGL+I  +        G G+++  ++    A   G L + D+++ V+G+ + + S E    +LK A
Sbjct:    4 IMIHEVYEEGAAAKDGRLWAGDQILKVNGTDLRSATHEDAINALRASP--QLVRLYVYRDEARYRGDDESALHVFTVELLK--------------KAGRGLGLSIVGKKS------GNGVFVSEVVHGGAAEADGRLTQGDQILSVDGEDVRSASQETVAAILKCA 147          
BLAST of partitioning defective 3 homolog isoform X2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001444.1 (pep scaffold:Pmarinus_7.0:GL476357:122445:266872:1 gene:ENSPMAG00000001288.1 transcript:ENSPMAT00000001444.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.5286 bits (127), Expect = 2.818e-7
Identity = 42/163 (25.77%), Postives = 77/163 (47.24%), Query Frame = 2
Query:  989 ILVNKILSNGGAADDGRLRPGDRIIEVDNVPV--ISARDTTEKLKTIP--VNTTVELLISRIDNDESELNPPSSKLPKTSQLTFEISLNSKNKESQQLGLNIHYRNEKDDPLLGTGIYIHSILSNSLASQQGNLHKNDKLVGVNGQSLANLSVEQTINLLKTA 1465
            I+V+ +   G A  DG L+ GDR++ V+ +PV  +S  + +  LK         VE  +S +++ ++   P   ++ KTS     ISL+ ++   +Q+                  + I  I   S+A + G LH  D+++ V+G  +  +SVE+   LL  +
Sbjct:   41 IVVSHVRQGGPADRDGTLKAGDRLLAVEGIPVQGLSLCEASVVLKQSGQDARVLVEYDVSVMESVQNATGPLLVEIRKTSGANLGISLSKESCGMKQI------------------VVIDKIRPASIAERCGALHVGDRILSVDGSGVEQMSVEEASVLLACS 185          

HSP 2 Score: 53.1434 bits (126), Expect = 3.604e-7
Identity = 55/211 (26.07%), Postives = 95/211 (45.02%), Query Frame = 2
Query:  905 NGGLGFTIVTRDNQVLYGSGADLSSSVV---ILVNKILSNGGAADDGRLRPGDRIIEVDNVPVISARDTTEKLKTIPVNTTVELLISRIDNDESELNPPSSKLPKTSQLTFEISLNSKNKESQQLGLNIHYRNEK--DDPLLGTGIYIHSILSNSLASQQGNLHKNDKLVGVNGQSLANLSVEQTINLLKTAMQNNSFLAITVMRESMNED 1522
            +GG GF         L+  G   S+ V    +L+  I  +  A   G L+PGDRI+ V+ +P        E  + +     V      ++ D +E   PSS        TF ++L    K+  +LG+ I     +   +PL+     I  I   S+A + G L   D+L+ +N   L   SV++T+++L+   Q++ F+ + V ++  N D
Sbjct:  347 DGGPGFG--------LHLQGGTFSTDVFGAPLLIGYIEPDSPAERCGLLQPGDRILSVNGIPTAELGSLAEVSQYLHEQALVGSASLEVEFDVAESVIPSSG-------TFHVTL--PKKKGVELGITITSPTHRKPSEPLV-----ITEIKKGSVAHRLGTLEPGDRLLAINHTRLETSSVDETVHILQ---QSDDFVKLKVRKDEDNSD 532          
BLAST of partitioning defective 3 homolog isoform X2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005746.1 (pep scaffold:Pmarinus_7.0:GL479493:17594:33348:1 gene:ENSPMAG00000005206.1 transcript:ENSPMAT00000005746.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.9062 bits (115), Expect = 5.514e-6
Identity = 45/169 (26.63%), Postives = 75/169 (44.38%), Query Frame = 2
Query:  989 ILVNKILSNGGAADDGRLRPGDRIIEVDNVPVISARDTTEKLKTI-PVNTTVELLISRIDNDESELNPPSSKLPKT------------SQLTFEISLNSKNKESQQLGLNIHYRNEKDDPLLGTGIYIHSILSNSLASQQGNLHKNDKLVGVNGQSLANLSVEQTINLL 1456
            I+V  IL  G A  DGRL  GDRI+ + ++ V   + + E +  +    + V LL++  +  E     PS  L +T                 E+      K    LG+N+    +       TGI + S++  SLA + G +  +D++V V+G  +  LS    ++LL
Sbjct:  219 IIVKTILPGGVADRDGRLCTGDRILSIGDMDV-RGKGSEEVISILRQCGSRVHLLVAHGEPGEQLPATPSPALAQTPPYLPPVVDEEGVDDDVEVYDVELTKGGHGLGINLTSTGDN------TGIVVRSMVPGSLAERDGRIGVDDQIVAVDGIFIGALSSTDALSLL 380          
BLAST of partitioning defective 3 homolog isoform X2 vs. Ensembl Nematostella
Match: EDO45887 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRU6])

HSP 1 Score: 98.2117 bits (243), Expect = 9.485e-21
Identity = 77/232 (33.19%), Postives = 115/232 (49.57%), Query Frame = 2
Query:  911 GLGFTIVTRDNQVLYGSGADLSSSVVILVNKILSNGGAADDGRLRPGDRIIEVDNVPVISARDTTEKLKTI-PVNTTVELLISRIDNDES------ELNPPSSKLPKTSQ---LTFEISLNSKNKESQQLGLNIHYRNE-------KDDPLLGTGIYIHSILSNSLASQQGNLHKNDKLVGVNGQSLANLSVEQTINLLKTAMQN----NSFLAITVMRESMNEDPSNLIVT 1543
            GLGF+I TRDN               I V  IL+ G A +DGRLR GD+IIEV+ +P ++ ++  E +  +      V+LLI R +  +S      ELN  S++  +      LTF+I LN     S   GL +  + +       +D P +  GI++ S+++   A + G L   D+L+ VN  S   L+  + I+ L+ AMQN     +F+  TV RE    DP N I T
Sbjct:  321 GLGFSITTRDNPA--------GGHTPIFVKSILAKGAAIEDGRLRGGDQIIEVNGMP-MTGKNQGEAVNILRSTEGVVKLLIQREELVQSPTKPAIELNEDSTRYLREQGKQVLTFKIPLNM----SGAAGLGVSVKGKVADTDSGRDSP-IDMGIFVKSVIAGGAAFKDGRLKAEDQLLSVNNVSFMRLTNTEAIDGLRRAMQNTRLGQAFIETTVARE---RDPQNDIGT 535          
BLAST of partitioning defective 3 homolog isoform X2 vs. Ensembl Nematostella
Match: EDO46059 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR65])

HSP 1 Score: 49.2914 bits (116), Expect = 2.134e-6
Identity = 55/193 (28.50%), Postives = 83/193 (43.01%), Query Frame = 2
Query:  911 GLGFTIVTRDNQVLYGSGAD---LSSSVVILVNKILSNGGAADDGRLRPGDRIIEVD--NVPVISARDTTEKLKTIPVNTTVELLISRIDNDESELNPPSSK---LPKTSQ-LTFEISLNSKNKESQQLGLNIHYRNEKDDPLLGTGIYIHSILSNSLASQQGNLHKNDKLVGVNGQSLANLSVEQTINLLKT 1462
            GLGF+I           G D   +     I + K++  G AA DGRL+  D I+ V+  N   I  +   + LK     + V L+      ++   N P+ +   L K S+ L F I+  S N+         H   +        GIYI  I+    A Q G L   DK++ VN Q+L ++S E  + +LK 
Sbjct:   15 GLGFSIA---------GGTDNPHVDDDFGIYITKVIPGGAAAQDGRLQVNDCILSVNGTNTVDIEHQQAVDALK--AAGSQVTLV-----REKKRGNAPTREEIVLIKGSKGLGFSIAGGSGNQ---------HVPGDN-------GIYITKIIEGGAAQQDGRLQVGDKIISVNLQNLEDVSHEDAVQVLKA 175          
BLAST of partitioning defective 3 homolog isoform X2 vs. Ensembl Medaka
Match: ENSORLT00000036913.1 (partitioning defective 3 homolog B [Source:NCBI gene;Acc:101164537])

HSP 1 Score: 97.8265 bits (242), Expect = 4.394e-20
Identity = 74/231 (32.03%), Postives = 115/231 (49.78%), Query Frame = 2
Query:  911 GLGFTIVTRDNQVLYGSGADLSSSVVILVNKILSNGGAADDGRLRPGDRIIEVDNVPVI--SARDTTEKLKTIPVNTTVELLISRIDNDESELNPPSSKLPKTS---------QLTFEISLNSKNKESQQLGLNIHYR-NEKDDPLLGTGIYIHSILSNSLASQQGNLHKNDKLVGVNGQSLANLSVEQTINLLKTAMQNN----SFLAITVMRESMNEDPSNLIVTNNSK 1555
            GLGFT+VTRD+ V +G G        ILV  IL+ G A  DGRL+PGDRI+EV+ V ++  S  +    L++     +V LL++R D+    L P   K  + S         QL +EI LN    E+   GL +  + N+  +     GI+I SI+    A + G L  ND+L+ VNG++L   S    +  L+ +M +       + + V+R +     +N   T+  +
Sbjct:  411 GLGFTVVTRDSSV-HGPGP-------ILVKNILARGAAIKDGRLQPGDRILEVNGVNMMERSQEELVAMLRSTKQGESVRLLVARQDD----LLPRELKGEEASRQVMEDGREQLMYEIPLN----ETGSAGLGVSLKGNKSKETGEDLGIFIKSIIHGGAAQKDGRLSVNDQLIAVNGETLVGRSNHAAMETLRRSMSSEGNARGTIQLVVLRSARQAGSANNAPTSGGR 625          
BLAST of partitioning defective 3 homolog isoform X2 vs. Ensembl Medaka
Match: PARD3 (partitioning defective 3 homolog [Source:NCBI gene;Acc:101161760])

HSP 1 Score: 96.2857 bits (238), Expect = 1.266e-19
Identity = 64/197 (32.49%), Postives = 101/197 (51.27%), Query Frame = 2
Query:  911 GLGFTIVTRDNQVLYGSGADLSSSVVILVNKILSNGGAADDGRLRPGDRIIEV--DNVPVISARDTTEKLKTIPVNTTVELLISRIDNDESELNPPSSKLPKTSQ--------LTFEISLNSKNKESQQLGLNIHYR-NEKDDPLLGTGIYIHSILSNSLASQQGNLHKNDKLVGVNGQSLANLSVEQTINLLKTAM 1468
            GLGF+I +RD          +   V I +  IL  G A  DGRL+ GDR++EV  +++   S  +    L+  P++  V LL+ R   DE  L P   +   T+         +TFEI LN    +S   GL +  + N   D     GI++ SI++   AS+ G LH ND+L+ VNG+SL +++ ++ +  L+ +M
Sbjct:  425 GLGFSITSRD--------VPIGGMVPIYIKNILPRGAAIQDGRLKAGDRLLEVSGEDLSGKSQEEVVALLRAAPMDGIVNLLVVR---DEDSLLPREVEEEDTALTRDGTQEFMTFEIPLN----DSGSAGLGVSVKGNRSKDTQADLGIFVKSIMNGGAASKDGRLHVNDQLIAVNGESLLDMTNQEAMEALRKSM 606          
BLAST of partitioning defective 3 homolog isoform X2 vs. Ensembl Medaka
Match: PARD3 (partitioning defective 3 homolog [Source:NCBI gene;Acc:101161760])

HSP 1 Score: 95.9005 bits (237), Expect = 1.706e-19
Identity = 64/197 (32.49%), Postives = 101/197 (51.27%), Query Frame = 2
Query:  911 GLGFTIVTRDNQVLYGSGADLSSSVVILVNKILSNGGAADDGRLRPGDRIIEV--DNVPVISARDTTEKLKTIPVNTTVELLISRIDNDESELNPPSSKLPKTSQ--------LTFEISLNSKNKESQQLGLNIHYR-NEKDDPLLGTGIYIHSILSNSLASQQGNLHKNDKLVGVNGQSLANLSVEQTINLLKTAM 1468
            GLGF+I +RD          +   V I +  IL  G A  DGRL+ GDR++EV  +++   S  +    L+  P++  V LL+ R   DE  L P   +   T+         +TFEI LN    +S   GL +  + N   D     GI++ SI++   AS+ G LH ND+L+ VNG+SL +++ ++ +  L+ +M
Sbjct:  488 GLGFSITSRD--------VPIGGMVPIYIKNILPRGAAIQDGRLKAGDRLLEVSGEDLSGKSQEEVVALLRAAPMDGIVNLLVVR---DEDSLLPREVEEEDTALTRDGTQEFMTFEIPLN----DSGSAGLGVSVKGNRSKDTQADLGIFVKSIMNGGAASKDGRLHVNDQLIAVNGESLLDMTNQEAMEALRKSM 669          
BLAST of partitioning defective 3 homolog isoform X2 vs. Ensembl Medaka
Match: PARD3 (partitioning defective 3 homolog [Source:NCBI gene;Acc:101161760])

HSP 1 Score: 95.9005 bits (237), Expect = 1.769e-19
Identity = 64/197 (32.49%), Postives = 101/197 (51.27%), Query Frame = 2
Query:  911 GLGFTIVTRDNQVLYGSGADLSSSVVILVNKILSNGGAADDGRLRPGDRIIEV--DNVPVISARDTTEKLKTIPVNTTVELLISRIDNDESELNPPSSKLPKTSQ--------LTFEISLNSKNKESQQLGLNIHYR-NEKDDPLLGTGIYIHSILSNSLASQQGNLHKNDKLVGVNGQSLANLSVEQTINLLKTAM 1468
            GLGF+I +RD          +   V I +  IL  G A  DGRL+ GDR++EV  +++   S  +    L+  P++  V LL+ R   DE  L P   +   T+         +TFEI LN    +S   GL +  + N   D     GI++ SI++   AS+ G LH ND+L+ VNG+SL +++ ++ +  L+ +M
Sbjct:  442 GLGFSITSRD--------VPIGGMVPIYIKNILPRGAAIQDGRLKAGDRLLEVSGEDLSGKSQEEVVALLRAAPMDGIVNLLVVR---DEDSLLPREVEEEDTALTRDGTQEFMTFEIPLN----DSGSAGLGVSVKGNRSKDTQADLGIFVKSIMNGGAASKDGRLHVNDQLIAVNGESLLDMTNQEAMEALRKSM 623          
BLAST of partitioning defective 3 homolog isoform X2 vs. Ensembl Medaka
Match: PARD3 (partitioning defective 3 homolog [Source:NCBI gene;Acc:101161760])

HSP 1 Score: 90.1225 bits (222), Expect = 1.023e-17
Identity = 64/210 (30.48%), Postives = 102/210 (48.57%), Query Frame = 2
Query:  911 GLGFTIVTRDNQVLYGSGADLSSSVVILVNKILSNGGAADDGRLRPGDRIIEV--DNVPVISARDTTEKLKTIPVNTTVELLISRIDNDESELNP------PSSKLPKTSQ---------------LTFEISLNSKNKESQQLGLNIHYR-NEKDDPLLGTGIYIHSILSNSLASQQGNLHKNDKLVGVNGQSLANLSVEQTINLLKTAM 1468
            GLGF+I +RD          +   V I +  IL  G A  DGRL+ GDR++EV  +++   S  +    L+  P++  V LL+ R   DE  L P      P + +   +                +TFEI LN    +S   GL +  + N   D     GI++ SI++   AS+ G LH ND+L+ VNG+SL +++ ++ +  L+ +M
Sbjct:  460 GLGFSITSRD--------VPIGGMVPIYIKNILPRGAAIQDGRLKAGDRLLEVSGEDLSGKSQEEVVALLRAAPMDGIVNLLVVR---DEDSLLPREVVSTPFANIGAFTYEEEDTALTRDGTQEFMTFEIPLN----DSGSAGLGVSVKGNRSKDTQADLGIFVKSIMNGGAASKDGRLHVNDQLIAVNGESLLDMTNQEAMEALRKSM 654          
BLAST of partitioning defective 3 homolog isoform X2 vs. Planmine SMEST
Match: SMESG000071209.1 (SMESG000071209.1)

HSP 1 Score: 1959.5 bits (5075), Expect = 0.000e+0
Identity = 1026/1029 (99.71%), Postives = 1026/1029 (99.71%), Query Frame = 2
Query:   59 MNCQFYYKGQTVTITCVDNASIKKIYELSIPKFKQHLAQELRLLDNQVKFRLKRRNGLLDSNDSANSVLVNKDLIIIEPENQLPNSNQNCHTPKRYKNISNTENDFKPSELQNSKPNFPPKPTPQMEYVLPNKKNIYQKYDQSHNPSKENPKASNFSRSELRRSLGAGIAYQYDLESSKNKGNYYGSVNNTYRNEVDSSDSSISDLYPKPSNKSKAKLNRNMDLPMKGINNEEKFPMSKSAPASPTKPVPPLRSPQTHLTMINVHNVRTXXXXXXXXXXXXPNGGLGFTIVTRDNQVLYGSGADLSSSVVILVNKILSNGGAADDGRLRPGDRIIEVDNVPVISARDTTEKLKTIPVNTTVELLISRIDNDESELNPPSSKLPKTSQLTFEISLNSKNKESQQLGLNIHYRNEKDDPLLGTGIYIHSILSNSLASQQGNLHKNDKLVGVNGQSLANLSVEQTINLLKTAMQNNSFLAITVMRESMNEDPSNLIVTNNSKFIINNENIPKSEITRCILPXXXXXXXXXXXXXXHRHQRNSSSDSCSQNEFDPSHSLTSNSFVREGPSRRSMSEKRKFCEDPSQYQVYQKRIGDITFEANERQYSTLPTASHXXXXXXXXXXXXXXXXXXXXXSQIKIKSVLESGPRMTNVTPNRSVSLRDSPNTPNFAHKSRSPKHLSQTPSHELQPVFNREMNSSFKKAVQRSLPDANEHTLSTQYNNSLSRNTGKPSVSADPTTQSEKDFQNSNQSTTNHRNEKLPRSHSVKTTEKKKSFNIKDFLPFQTNPNHSVKYKPTNKSDTFPPEKRGEPQLPNYQSTNPNDLKHRPYSPFELPPEMQYSNDPAIIDSTKRVLEWQKKNADVISKENKNNKIYHPINSTNNDARIQKRRKSKTFNLTLLACCSPAAKTKPDLNLRSQSTKKNTTQYHYETDPYDTIDGTLSSPVGNWNPKSARSAPRSANNTIYGITGAISTNKNGALAPRSNSIIPYQTNSNRKPTSIGNDLYATVNKPNKKESTIKQSPNISQVHRNKYKF 3145
            MNCQFYYKGQTVTITCVDNASIKKIYELSIPKFKQHLAQELRLLDNQVKFRLKRRNGLLDSNDSANSVLVNKDLIIIEPENQLPNSNQNCHTPKRYKNISNTENDFKPSELQNSKPNFPPKPTPQMEYVLPNKKNIYQKYDQSHNPSKENPKASNFSRSELRRSLGAGIAYQYDLESSKNKGNYYGSVNNTYRNEVDSSDSSISDLYPKPSNKSKAKLNRNMDLPMKGINNEEKFPMSKSAPASPTKPVPPLRSPQTHLTMINVHNVRTIGKKIKISILKKPNGGLGFTIVTRDNQVLYGSGADLSSSVVILVNKILSNGGAADDGRLRPGDRIIEVDNVPV SARDTTEKLKTIPVNTTVELLISRIDNDESE NPPSSKLPKTSQLTFEISLNSKNKESQQLGLNIHYRNEKDDPLLGTGIYIHSILSNSLASQQGNLHKNDKLVGVNGQSLANLSVEQTINLLKTAMQNNSFLAITVMRESMNEDPSNLIVTNNSKFIINNENIPKSEITRCILPDKIKIDSKSKKKSKHRHQRNSSSDSCSQNEFDPSHSLTSNSFVREGPSRRSMSEKRKFCEDPSQYQVYQKRIGDITFEANERQYSTLPTASHKKKQDKSPPPPPLPNKTTMKPSQIKIKSVLESGPRMTNVTPNRSVSLRDSPNTPNFAHKSRSPKHLSQTPSHELQPVFNREMNSSFKKAVQRSLPDANEHTLSTQYNNSLSRNTGKPSVSADPTTQSEKDFQNSNQSTTNHRNEKLPRSHSVKTTEKKKSFNIKDFLPFQTNPNHSVKYKPTNKSDTFPPEKRGEPQLPNYQSTNPNDLKHRPYSPFELPPEMQYSND AIIDSTKRVLEWQKKNADVISKENKNNKIYHPINSTNNDARIQKRRKSKTFNLTLLACCSPAAKTKPDLNLRSQSTKKNTTQYHYETDPYDTIDGTLSSPVGNWNPKSARSAPRSANNTIYGITGAISTNKNGALAPRSNSIIPYQTNSNRKPTSIGNDLYATVNKPNKKESTIKQSPNISQVHRNKYKF
Sbjct:    1 MNCQFYYKGQTVTITCVDNASIKKIYELSIPKFKQHLAQELRLLDNQVKFRLKRRNGLLDSNDSANSVLVNKDLIIIEPENQLPNSNQNCHTPKRYKNISNTENDFKPSELQNSKPNFPPKPTPQMEYVLPNKKNIYQKYDQSHNPSKENPKASNFSRSELRRSLGAGIAYQYDLESSKNKGNYYGSVNNTYRNEVDSSDSSISDLYPKPSNKSKAKLNRNMDLPMKGINNEEKFPMSKSAPASPTKPVPPLRSPQTHLTMINVHNVRTIGKKIKISILKKPNGGLGFTIVTRDNQVLYGSGADLSSSVVILVNKILSNGGAADDGRLRPGDRIIEVDNVPVTSARDTTEKLKTIPVNTTVELLISRIDNDESEFNPPSSKLPKTSQLTFEISLNSKNKESQQLGLNIHYRNEKDDPLLGTGIYIHSILSNSLASQQGNLHKNDKLVGVNGQSLANLSVEQTINLLKTAMQNNSFLAITVMRESMNEDPSNLIVTNNSKFIINNENIPKSEITRCILPDKIKIDSKSKKKSKHRHQRNSSSDSCSQNEFDPSHSLTSNSFVREGPSRRSMSEKRKFCEDPSQYQVYQKRIGDITFEANERQYSTLPTASHKKKQDKSPPPPPLPNKTTMKPSQIKIKSVLESGPRMTNVTPNRSVSLRDSPNTPNFAHKSRSPKHLSQTPSHELQPVFNREMNSSFKKAVQRSLPDANEHTLSTQYNNSLSRNTGKPSVSADPTTQSEKDFQNSNQSTTNHRNEKLPRSHSVKTTEKKKSFNIKDFLPFQTNPNHSVKYKPTNKSDTFPPEKRGEPQLPNYQSTNPNDLKHRPYSPFELPPEMQYSNDSAIIDSTKRVLEWQKKNADVISKENKNNKIYHPINSTNNDARIQKRRKSKTFNLTLLACCSPAAKTKPDLNLRSQSTKKNTTQYHYETDPYDTIDGTLSSPVGNWNPKSARSAPRSANNTIYGITGAISTNKNGALAPRSNSIIPYQTNSNRKPTSIGNDLYATVNKPNKKESTIKQSPNISQVHRNKYKF 1029          
BLAST of partitioning defective 3 homolog isoform X2 vs. Planmine SMEST
Match: SMESG000071209.1 (SMESG000071209.1)

HSP 1 Score: 1953.72 bits (5060), Expect = 0.000e+0
Identity = 1026/1032 (99.42%), Postives = 1026/1032 (99.42%), Query Frame = 2
Query:   59 MNCQFYYKGQTVTITCVDNASIKKIYELSIPKFKQHLAQELRLLDNQVKFRLKRRNGLLDSNDSANSVLVNKDLIIIEPENQLPNSNQNCHTPKRYKNISNTENDFKPSELQNSKPNFPPKPTPQMEYVLPNKKNIYQKYDQSHNPSKENPKASNFSRSELRRSLGAGIAYQYDLESSKNKGNYYGSVNNTYRNEVDSSDSSISDLYPKPSNKSKAKLNRNMDLPMKGINNE---EKFPMSKSAPASPTKPVPPLRSPQTHLTMINVHNVRTXXXXXXXXXXXXPNGGLGFTIVTRDNQVLYGSGADLSSSVVILVNKILSNGGAADDGRLRPGDRIIEVDNVPVISARDTTEKLKTIPVNTTVELLISRIDNDESELNPPSSKLPKTSQLTFEISLNSKNKESQQLGLNIHYRNEKDDPLLGTGIYIHSILSNSLASQQGNLHKNDKLVGVNGQSLANLSVEQTINLLKTAMQNNSFLAITVMRESMNEDPSNLIVTNNSKFIINNENIPKSEITRCILPXXXXXXXXXXXXXXHRHQRNSSSDSCSQNEFDPSHSLTSNSFVREGPSRRSMSEKRKFCEDPSQYQVYQKRIGDITFEANERQYSTLPTASHXXXXXXXXXXXXXXXXXXXXXSQIKIKSVLESGPRMTNVTPNRSVSLRDSPNTPNFAHKSRSPKHLSQTPSHELQPVFNREMNSSFKKAVQRSLPDANEHTLSTQYNNSLSRNTGKPSVSADPTTQSEKDFQNSNQSTTNHRNEKLPRSHSVKTTEKKKSFNIKDFLPFQTNPNHSVKYKPTNKSDTFPPEKRGEPQLPNYQSTNPNDLKHRPYSPFELPPEMQYSNDPAIIDSTKRVLEWQKKNADVISKENKNNKIYHPINSTNNDARIQKRRKSKTFNLTLLACCSPAAKTKPDLNLRSQSTKKNTTQYHYETDPYDTIDGTLSSPVGNWNPKSARSAPRSANNTIYGITGAISTNKNGALAPRSNSIIPYQTNSNRKPTSIGNDLYATVNKPNKKESTIKQSPNISQVHRNKYKF 3145
            MNCQFYYKGQTVTITCVDNASIKKIYELSIPKFKQHLAQELRLLDNQVKFRLKRRNGLLDSNDSANSVLVNKDLIIIEPENQLPNSNQNCHTPKRYKNISNTENDFKPSELQNSKPNFPPKPTPQMEYVLPNKKNIYQKYDQSHNPSKENPKASNFSRSELRRSLGAGIAYQYDLESSKNKGNYYGSVNNTYRNEVDSSDSSISDLYPKPSNKSKAKLNRNMDLPMKGINNE   EKFPMSKSAPASPTKPVPPLRSPQTHLTMINVHNVRTIGKKIKISILKKPNGGLGFTIVTRDNQVLYGSGADLSSSVVILVNKILSNGGAADDGRLRPGDRIIEVDNVPV SARDTTEKLKTIPVNTTVELLISRIDNDESE NPPSSKLPKTSQLTFEISLNSKNKESQQLGLNIHYRNEKDDPLLGTGIYIHSILSNSLASQQGNLHKNDKLVGVNGQSLANLSVEQTINLLKTAMQNNSFLAITVMRESMNEDPSNLIVTNNSKFIINNENIPKSEITRCILPDKIKIDSKSKKKSKHRHQRNSSSDSCSQNEFDPSHSLTSNSFVREGPSRRSMSEKRKFCEDPSQYQVYQKRIGDITFEANERQYSTLPTASHKKKQDKSPPPPPLPNKTTMKPSQIKIKSVLESGPRMTNVTPNRSVSLRDSPNTPNFAHKSRSPKHLSQTPSHELQPVFNREMNSSFKKAVQRSLPDANEHTLSTQYNNSLSRNTGKPSVSADPTTQSEKDFQNSNQSTTNHRNEKLPRSHSVKTTEKKKSFNIKDFLPFQTNPNHSVKYKPTNKSDTFPPEKRGEPQLPNYQSTNPNDLKHRPYSPFELPPEMQYSND AIIDSTKRVLEWQKKNADVISKENKNNKIYHPINSTNNDARIQKRRKSKTFNLTLLACCSPAAKTKPDLNLRSQSTKKNTTQYHYETDPYDTIDGTLSSPVGNWNPKSARSAPRSANNTIYGITGAISTNKNGALAPRSNSIIPYQTNSNRKPTSIGNDLYATVNKPNKKESTIKQSPNISQVHRNKYKF
Sbjct:    1 MNCQFYYKGQTVTITCVDNASIKKIYELSIPKFKQHLAQELRLLDNQVKFRLKRRNGLLDSNDSANSVLVNKDLIIIEPENQLPNSNQNCHTPKRYKNISNTENDFKPSELQNSKPNFPPKPTPQMEYVLPNKKNIYQKYDQSHNPSKENPKASNFSRSELRRSLGAGIAYQYDLESSKNKGNYYGSVNNTYRNEVDSSDSSISDLYPKPSNKSKAKLNRNMDLPMKGINNEGIVEKFPMSKSAPASPTKPVPPLRSPQTHLTMINVHNVRTIGKKIKISILKKPNGGLGFTIVTRDNQVLYGSGADLSSSVVILVNKILSNGGAADDGRLRPGDRIIEVDNVPVTSARDTTEKLKTIPVNTTVELLISRIDNDESEFNPPSSKLPKTSQLTFEISLNSKNKESQQLGLNIHYRNEKDDPLLGTGIYIHSILSNSLASQQGNLHKNDKLVGVNGQSLANLSVEQTINLLKTAMQNNSFLAITVMRESMNEDPSNLIVTNNSKFIINNENIPKSEITRCILPDKIKIDSKSKKKSKHRHQRNSSSDSCSQNEFDPSHSLTSNSFVREGPSRRSMSEKRKFCEDPSQYQVYQKRIGDITFEANERQYSTLPTASHKKKQDKSPPPPPLPNKTTMKPSQIKIKSVLESGPRMTNVTPNRSVSLRDSPNTPNFAHKSRSPKHLSQTPSHELQPVFNREMNSSFKKAVQRSLPDANEHTLSTQYNNSLSRNTGKPSVSADPTTQSEKDFQNSNQSTTNHRNEKLPRSHSVKTTEKKKSFNIKDFLPFQTNPNHSVKYKPTNKSDTFPPEKRGEPQLPNYQSTNPNDLKHRPYSPFELPPEMQYSNDSAIIDSTKRVLEWQKKNADVISKENKNNKIYHPINSTNNDARIQKRRKSKTFNLTLLACCSPAAKTKPDLNLRSQSTKKNTTQYHYETDPYDTIDGTLSSPVGNWNPKSARSAPRSANNTIYGITGAISTNKNGALAPRSNSIIPYQTNSNRKPTSIGNDLYATVNKPNKKESTIKQSPNISQVHRNKYKF 1032          
BLAST of partitioning defective 3 homolog isoform X2 vs. Planmine SMEST
Match: SMESG000071209.1 (SMESG000071209.1)

HSP 1 Score: 1904.8 bits (4933), Expect = 0.000e+0
Identity = 1006/1029 (97.76%), Postives = 1006/1029 (97.76%), Query Frame = 2
Query:   59 MNCQFYYKGQTVTITCVDNASIKKIYELSIPKFKQHLAQELRLLDNQVKFRLKRRNGLLDSNDSANSVLVNKDLIIIEPENQLPNSNQNCHTPKRYKNISNTENDFKPSELQNSKPNFPPKPTPQMEYVLPNKKNIYQKYDQSHNPSKENPKASNFSRSELRRSLGAGIAYQYDLESSKNKGNYYGSVNNTYRNEVDSSDSSISDLYPKPSNKSKAKLNRNMDLPMKGINNEEKFPMSKSAPASPTKPVPPLRSPQTHLTMINVHNVRTXXXXXXXXXXXXPNGGLGFTIVTRDNQVLYGSGADLSSSVVILVNKILSNGGAADDGRLRPGDRIIEVDNVPVISARDTTEKLKTIPVNTTVELLISRIDNDESELNPPSSKLPKTSQLTFEISLNSKNKESQQLGLNIHYRNEKDDPLLGTGIYIHSILSNSLASQQGNLHKNDKLVGVNGQSLANLSVEQTINLLKTAMQNNSFLAITVMRESMNEDPSNLIVTNNSKFIINNENIPKSEITRCILPXXXXXXXXXXXXXXHRHQRNSSSDSCSQNEFDPSHSLTSNSFVREGPSRRSMSEKRKFCEDPSQYQVYQKRIGDITFEANERQYSTLPTASHXXXXXXXXXXXXXXXXXXXXXSQIKIKSVLESGPRMTNVTPNRSVSLRDSPNTPNFAHKSRSPKHLSQTPSHELQPVFNREMNSSFKKAVQRSLPDANEHTLSTQYNNSLSRNTGKPSVSADPTTQSEKDFQNSNQSTTNHRNEKLPRSHSVKTTEKKKSFNIKDFLPFQTNPNHSVKYKPTNKSDTFPPEKRGEPQLPNYQSTNPNDLKHRPYSPFELPPEMQYSNDPAIIDSTKRVLEWQKKNADVISKENKNNKIYHPINSTNNDARIQKRRKSKTFNLTLLACCSPAAKTKPDLNLRSQSTKKNTTQYHYETDPYDTIDGTLSSPVGNWNPKSARSAPRSANNTIYGITGAISTNKNGALAPRSNSIIPYQTNSNRKPTSIGNDLYATVNKPNKKESTIKQSPNISQVHRNKYKF 3145
            MNCQFYYKGQTVTITCVDNASIKKIYELSIPKFKQHLAQELRLLDNQVKFRLKRRNGLLDSNDSANSVLVNKDLIIIEPENQLPNSNQNCHTPKRYKNISNTENDFKPSELQNSKPNFPPKPTPQMEYVLPNKKNIYQKYDQSHNPSKENPKASNFSRSELRRSLGAGIAYQYDLESSKNKGNYYGSVNNTYRNEVDSSDSSISDLYPKPSNKSKAKLNRNMDLPMKGINNEEKFPMSKSAPASPTKPVPPLRSPQTHLTMINVHNVRTIGKKIKISILKKPNGGLGFTIVTRDNQVLYGSGADLSSSVVILVNKILSNGGAADDGRLRPGDRIIEVDNVPV SARDTTEKLKTIPVNTTVELLISRIDNDESE NPPSSKLPKTSQLTFEISLNSKNKESQQLGLNIHYRNEKDDPLLGTGIYIHSILSNSLASQQGNLHKNDKLVGVNGQSLANLSVEQTINLLKTAMQNNSFLAITVMRESMNEDPSNLIVTNNSKFIINNENIPKSEITRCILPDKIKIDSKSKKKSKHRHQRNSSSDSCSQNEFDPSHSLTSNSFVREGPSRRSMSEKRKFCEDPSQYQVYQKRIGDITFEANERQYSTLPTASHKKKQDKSPPPPPLPNKTTMKPSQIKIKSVLESGPRMTNVTPNRSVSLRDSPNTPNFAHKSRSPKHLSQTPSHELQPVFNREMNSSFKKAVQRSLPDANEHTLSTQYNNSLSRNTGKPSVSADPTTQSEKDFQNSNQSTTNHRNEKLPRSHSVKTTEKKKSFNIKDFLPFQTNPNHSVKYKPTNKSDTFPPEKRGEPQLPNYQSTNPNDLKHRPYSPFELPPEMQYSND AIIDSTKRVLEWQKKNADVISKENKNNKIYHPINSTNNDARIQ                    KTKPDLNLRSQSTKKNTTQYHYETDPYDTIDGTLSSPVGNWNPKSARSAPRSANNTIYGITGAISTNKNGALAPRSNSIIPYQTNSNRKPTSIGNDLYATVNKPNKKESTIKQSPNISQVHRNKYKF
Sbjct:    1 MNCQFYYKGQTVTITCVDNASIKKIYELSIPKFKQHLAQELRLLDNQVKFRLKRRNGLLDSNDSANSVLVNKDLIIIEPENQLPNSNQNCHTPKRYKNISNTENDFKPSELQNSKPNFPPKPTPQMEYVLPNKKNIYQKYDQSHNPSKENPKASNFSRSELRRSLGAGIAYQYDLESSKNKGNYYGSVNNTYRNEVDSSDSSISDLYPKPSNKSKAKLNRNMDLPMKGINNEEKFPMSKSAPASPTKPVPPLRSPQTHLTMINVHNVRTIGKKIKISILKKPNGGLGFTIVTRDNQVLYGSGADLSSSVVILVNKILSNGGAADDGRLRPGDRIIEVDNVPVTSARDTTEKLKTIPVNTTVELLISRIDNDESEFNPPSSKLPKTSQLTFEISLNSKNKESQQLGLNIHYRNEKDDPLLGTGIYIHSILSNSLASQQGNLHKNDKLVGVNGQSLANLSVEQTINLLKTAMQNNSFLAITVMRESMNEDPSNLIVTNNSKFIINNENIPKSEITRCILPDKIKIDSKSKKKSKHRHQRNSSSDSCSQNEFDPSHSLTSNSFVREGPSRRSMSEKRKFCEDPSQYQVYQKRIGDITFEANERQYSTLPTASHKKKQDKSPPPPPLPNKTTMKPSQIKIKSVLESGPRMTNVTPNRSVSLRDSPNTPNFAHKSRSPKHLSQTPSHELQPVFNREMNSSFKKAVQRSLPDANEHTLSTQYNNSLSRNTGKPSVSADPTTQSEKDFQNSNQSTTNHRNEKLPRSHSVKTTEKKKSFNIKDFLPFQTNPNHSVKYKPTNKSDTFPPEKRGEPQLPNYQSTNPNDLKHRPYSPFELPPEMQYSNDSAIIDSTKRVLEWQKKNADVISKENKNNKIYHPINSTNNDARIQ--------------------KTKPDLNLRSQSTKKNTTQYHYETDPYDTIDGTLSSPVGNWNPKSARSAPRSANNTIYGITGAISTNKNGALAPRSNSIIPYQTNSNRKPTSIGNDLYATVNKPNKKESTIKQSPNISQVHRNKYKF 1009          
BLAST of partitioning defective 3 homolog isoform X2 vs. Planmine SMEST
Match: SMESG000050856.1 (SMESG000050856.1)

HSP 1 Score: 74.7146 bits (182), Expect = 3.665e-13
Identity = 62/240 (25.83%), Postives = 110/240 (45.83%), Query Frame = 2
Query:  911 GLGFTIVTRDNQVLYGSGADLSSSV--VILVNKILSNGGAADDGRLRPGDRIIEVDNVPV--ISARDTTEKLKTIPVNTTVELLISR---------------IDNDESELNPPSSKLPK----TSQLTFEISLNSKNKESQQLGLNIHYRNE-------------KDDPLLGTGIYIHSILSNSLASQQGNLHKNDKLVGVNGQSLANLSVEQTI----NLLKTAMQN-NSFLAITVMRE 1507
            G GF+I  +DN         L  ++   + V  IL +G A  DGRL+ GDR++EVD + +  +S  +    L+  P  + V+LL+ R               +    SE++   S L K    T +L F+I LN  N   ++  L I  + E             K+D      +++ +++ N  A + G L   D+L+ VN Q+L+    E+ +    N++K A ++ +  + + V+R+
Sbjct:  596 GFGFSITGKDN---------LPPTIPSAVYVRHILPDGAAIKDGRLKSGDRLLEVDGLLLDGMSQSEVIALLREKPSGSRVKLLVERNPIKMSSQCSASHDSLMTSVSEIDEEGSTLSKNKRNTIKLQFDIPLNDCNYLGEKTNLGISVKVEPNWDKANITQFSSKEDIAASNIVWVKTVIENGAAYRHGKLMVGDQLLEVNNQTLSGFDSEEALKKLKNIIKDAQESEDGIVHVVVLRK 826          
BLAST of partitioning defective 3 homolog isoform X2 vs. Planmine SMEST
Match: SMESG000050856.1 (SMESG000050856.1)

HSP 1 Score: 73.9442 bits (180), Expect = 6.245e-13
Identity = 61/240 (25.42%), Postives = 108/240 (45.00%), Query Frame = 2
Query:  911 GLGFTIVTRDNQVLYGSGADLSSSV--VILVNKILSNGGAADDGRLRPGDRIIEVDNVPV--ISARDTTEKLKTIPVNTTVELLISR---------------IDNDESELNPPSSKLPK----TSQLTFEISLNSKNKESQQLGLNIHYRNE-------------KDDPLLGTGIYIHSILSNSLASQQGNLHKNDKLVGVNGQSLANLSVEQTINLLKTAMQN-----NSFLAITVMRE 1507
            G GF+I  +DN         L  ++   + V  IL +G A  DGRL+ GDR++EVD + +  +S  +    L+  P  + V+LL+ R               +    SE++   S L K    T +L F+I LN  N   ++  L I  + E             K+D      +++ +++ N  A + G L   D+L+ VN Q+L+    E+ +  LK  +++     +  + + V+R+
Sbjct:  596 GFGFSITGKDN---------LPPTIPSAVYVRHILPDGAAIKDGRLKSGDRLLEVDGLLLDGMSQSEVIALLREKPSGSRVKLLVERNPIKMSSQCSASHDSLMTSVSEIDEEGSTLSKNKRNTIKLQFDIPLNDCNYLGEKTNLGISVKVEPNWDKANITQFSSKEDIAASNIVWVKTVIENGAAYRHGKLMVGDQLLEVNNQTLSGFDSEEALKKLKNIIKDAQESEDGIVHVVVLRK 826          
The following BLAST results are available for this feature:
BLAST of partitioning defective 3 homolog isoform X2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PARD3B1.531e-1833.33par-3 family cell polarity regulator beta [Source:... [more]
PARD3B1.569e-1833.33par-3 family cell polarity regulator beta [Source:... [more]
PARD3B1.620e-1833.33par-3 family cell polarity regulator beta [Source:... [more]
PARD3B1.777e-1833.33par-3 family cell polarity regulator beta [Source:... [more]
PARD3B1.933e-1833.33par-3 family cell polarity regulator beta [Source:... [more]
back to top
BLAST of partitioning defective 3 homolog isoform X2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mpz-13.171e-1230.85Multiple PDZ domain protein [Source:UniProtKB/TrE... [more]
mpz-13.274e-1230.85Multiple PDZ domain protein [Source:UniProtKB/TrE... [more]
mpz-13.333e-1230.85Multiple PDZ domain protein [Source:UniProtKB/TrE... [more]
mpz-13.357e-1230.85Multiple PDZ domain protein [Source:UniProtKB/TrE... [more]
mpz-13.485e-1230.85Multiple PDZ domain protein [Source:UniProtKB/TrE... [more]
back to top
BLAST of partitioning defective 3 homolog isoform X2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
baz3.255e-1233.75gene:FBgn0000163 transcript:FBtr0343763[more]
baz3.294e-1233.75gene:FBgn0000163 transcript:FBtr0111000[more]
baz3.404e-1233.75gene:FBgn0000163 transcript:FBtr0074388[more]
baz3.475e-1233.75gene:FBgn0000163 transcript:FBtr0343764[more]
scrib6.585e-727.98gene:FBgn0263289 transcript:FBtr0335521[more]
back to top
BLAST of partitioning defective 3 homolog isoform X2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pard3ba2.313e-1932.02par-3 family cell polarity regulator beta a [Sourc... [more]
pard3bb5.227e-1733.51par-3 family cell polarity regulator beta b [Sourc... [more]
PARD36.801e-1731.16par-3 family cell polarity regulator [Source:HGNC ... [more]
pard3ab9.102e-1528.30par-3 family cell polarity regulator alpha, b [Sou... [more]
pard3ab9.223e-1528.30par-3 family cell polarity regulator alpha, b [Sou... [more]
back to top
BLAST of partitioning defective 3 homolog isoform X2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
znf5321.694e-1834.67zinc finger protein 532 [Source:Xenbase;Acc:XB-GEN... [more]
znf5321.952e-1834.67zinc finger protein 532 [Source:Xenbase;Acc:XB-GEN... [more]
znf5322.663e-1834.67zinc finger protein 532 [Source:Xenbase;Acc:XB-GEN... [more]
kcna57.759e-1732.21potassium channel, voltage gated shaker related su... [more]
kcna57.806e-1732.21potassium channel, voltage gated shaker related su... [more]
back to top
BLAST of partitioning defective 3 homolog isoform X2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pard3b8.934e-1834.18par-3 family cell polarity regulator beta [Source:... [more]
Pard3b9.972e-1834.18par-3 family cell polarity regulator beta [Source:... [more]
Pard32.813e-1730.77par-3 family cell polarity regulator [Source:MGI S... [more]
Pard33.111e-1731.16par-3 family cell polarity regulator [Source:MGI S... [more]
Pard33.805e-1730.77par-3 family cell polarity regulator [Source:MGI S... [more]
back to top
BLAST of partitioning defective 3 homolog isoform X2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8TEW8|PAR3L_HUMAN7.353e-1833.33Partitioning defective 3 homolog B OS=Homo sapiens... [more]
sp|Q8TEW0|PARD3_HUMAN2.701e-1729.10Partitioning defective 3 homolog OS=Homo sapiens O... [more]
sp|Q9CSB4|PAR3L_MOUSE6.249e-1734.18Partitioning defective 3 homolog B OS=Mus musculus... [more]
sp|Q99NH2|PARD3_MOUSE3.010e-1630.77Partitioning defective 3 homolog OS=Mus musculus O... [more]
sp|Q9Z340|PARD3_RAT5.055e-1630.77Partitioning defective 3 homolog OS=Rattus norvegi... [more]
back to top
BLAST of partitioning defective 3 homolog isoform X2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A075A3J91.302e-1828.94Uncharacterized protein OS=Opisthorchis viverrini ... [more]
A0A1S8X1K21.602e-1828.94PDZ/DHR/GLGF domain protein OS=Opisthorchis viverr... [more]
A0A087TP091.748e-1834.80Partitioning defective 3-like protein (Fragment) O... [more]
A0A1I8FW054.062e-1830.47Uncharacterized protein OS=Macrostomum lignano OX=... [more]
H3A3L17.646e-1834.18Uncharacterized protein OS=Latimeria chalumnae OX=... [more]
back to top
BLAST of partitioning defective 3 homolog isoform X2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pard3ba1.551e-1933.50par-3 family cell polarity regulator beta a [Sourc... [more]
pard3bb1.043e-1632.82partitioning defective 3 homolog B [Source:NCBI ge... [more]
pard3bb1.208e-1632.82partitioning defective 3 homolog B [Source:NCBI ge... [more]
pard3bb1.312e-1631.75partitioning defective 3 homolog B [Source:NCBI ge... [more]
pard3bb1.316e-1632.82partitioning defective 3 homolog B [Source:NCBI ge... [more]
back to top
BLAST of partitioning defective 3 homolog isoform X2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000006056.15.847e-1528.57pep scaffold:Pmarinus_7.0:GL477535:225:55869:1 gen... [more]
ENSPMAT00000002205.16.710e-1328.24pep scaffold:Pmarinus_7.0:GL477144:51012:68257:1 g... [more]
ENSPMAT00000004677.14.196e-826.51pep scaffold:Pmarinus_7.0:GL479538:28591:32639:-1 ... [more]
ENSPMAT00000001444.12.818e-725.77pep scaffold:Pmarinus_7.0:GL476357:122445:266872:1... [more]
ENSPMAT00000005746.15.514e-626.63pep scaffold:Pmarinus_7.0:GL479493:17594:33348:1 g... [more]
back to top
BLAST of partitioning defective 3 homolog isoform X2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of partitioning defective 3 homolog isoform X2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO458879.485e-2133.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO460592.134e-628.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of partitioning defective 3 homolog isoform X2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000036913.14.394e-2032.03partitioning defective 3 homolog B [Source:NCBI ge... [more]
PARD31.266e-1932.49partitioning defective 3 homolog [Source:NCBI gene... [more]
PARD31.706e-1932.49partitioning defective 3 homolog [Source:NCBI gene... [more]
PARD31.769e-1932.49partitioning defective 3 homolog [Source:NCBI gene... [more]
PARD31.023e-1730.48partitioning defective 3 homolog [Source:NCBI gene... [more]
back to top
BLAST of partitioning defective 3 homolog isoform X2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000071209.10.000e+099.71SMESG000071209.1[more]
SMESG000071209.10.000e+099.42SMESG000071209.1[more]
SMESG000071209.10.000e+097.76SMESG000071209.1[more]
SMESG000050856.13.665e-1325.83SMESG000050856.1[more]
SMESG000050856.16.245e-1325.42SMESG000050856.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011984 ID=SMED30011984|Name=partitioning defective 3 homolog isoform X2|organism=Schmidtea mediterranea sexual|type=transcript|length=3390bp
AATTGTTTTTTTTGGATTTTTAATTTTCAAATAAAGAATTTGTAAATATG
CAACGAAGATGAACTGCCAATTTTATTACAAAGGACAAACTGTCACAATT
ACGTGTGTGGATAATGCTAGTATAAAGAAAATTTATGAACTTTCTATACC
GAAATTCAAACAACATTTAGCGCAGGAGTTAAGATTACTTGACAATCAGG
TAAAATTTCGATTAAAGCGTAGAAATGGATTGTTAGACTCCAATGACTCA
GCCAATTCTGTTTTAGTTAATAAAGACTTAATAATAATTGAACCTGAAAA
CCAATTGCCTAATTCAAATCAAAATTGTCACACGCCTAAACGCTATAAAA
ACATATCAAACACTGAAAACGACTTCAAACCTTCCGAATTACAAAATTCC
AAACCAAATTTTCCACCAAAGCCTACACCTCAAATGGAATACGTTTTACC
CAATAAAAAGAATATTTATCAAAAATACGATCAATCACATAATCCGTCGA
AAGAAAATCCAAAAGCGTCGAATTTTAGTCGTTCAGAACTCAGAAGGTCA
CTCGGTGCTGGAATTGCATATCAGTATGATTTGGAGTCGTCGAAAAACAA
AGGAAATTATTACGGATCAGTGAACAATACATATCGTAACGAAGTCGATT
CTTCCGACTCGTCAATTTCGGATTTATATCCGAAACCATCCAACAAGTCT
AAAGCTAAACTAAACAGAAATATGGATTTGCCAATGAAAGGCATCAATAA
TGAAGAAAAATTCCCGATGTCCAAGTCTGCTCCAGCGTCTCCAACCAAAC
CAGTTCCTCCTCTCCGATCACCTCAAACTCATTTAACGATGATAAATGTA
CACAATGTGCGCACTATTGGGAAAAAAATTAAAATATCTATTCTCAAAAA
ACCCAATGGTGGATTGGGATTCACAATTGTCACTAGAGATAATCAAGTTC
TTTATGGATCTGGTGCAGATCTTTCTAGTTCTGTAGTAATTCTGGTGAAC
AAAATTCTTAGCAATGGTGGAGCAGCGGATGATGGACGGTTGAGACCTGG
TGATCGTATTATAGAAGTCGACAATGTGCCTGTCATAAGTGCTAGAGATA
CTACTGAAAAATTAAAAACGATACCTGTTAATACAACTGTTGAATTGTTG
ATATCCAGAATTGATAATGATGAGTCCGAATTGAATCCTCCTTCCTCAAA
ACTTCCAAAAACGTCTCAACTAACTTTTGAAATTTCTTTAAATTCCAAAA
ATAAAGAAAGTCAACAGCTTGGTCTTAATATTCACTATCGTAATGAAAAG
GATGATCCTCTATTGGGCACAGGAATATATATACATTCTATTCTCAGCAA
TAGCTTAGCTTCTCAGCAGGGAAACCTACATAAAAACGATAAACTAGTTG
GTGTAAATGGTCAAAGTCTGGCAAATTTATCTGTTGAACAAACAATAAAT
CTTCTGAAAACGGCAATGCAAAACAATTCTTTTCTCGCGATTACTGTGAT
GCGTGAATCCATGAATGAAGATCCATCAAATCTCATAGTTACCAATAATT
CAAAATTTATAATAAACAACGAAAATATTCCAAAGTCCGAAATTACTCGC
TGCATTTTGCCAGATAAAATAAAAATTGACAGTAAATCCAAAAAGAAATC
AAAACACAGACACCAAAGGAACTCATCCAGTGACAGCTGTTCACAGAACG
AATTCGATCCATCTCATTCGTTGACTTCAAATAGTTTTGTAAGAGAAGGT
CCAAGTCGTCGAAGCATGTCGGAAAAAAGAAAATTCTGCGAAGATCCATC
ACAATATCAGGTTTATCAAAAGCGTATCGGTGATATCACATTCGAGGCAA
ATGAGCGGCAATATTCTACGTTACCTACTGCTTCGCATAAAAAGAAACAA
GACAAGTCTCCTCCTCCTCCTCCTCTTCCAAATAAAACGACCATGAAACC
TTCTCAAATCAAAATCAAAAGTGTTCTAGAATCGGGACCGAGAATGACAA
ATGTGACACCGAATAGATCTGTGTCCTTGCGAGATTCACCGAACACACCC
AATTTTGCGCATAAATCTCGAAGTCCGAAACACCTTAGTCAAACTCCCTC
TCATGAATTACAACCAGTCTTTAATCGAGAAATGAACAGTAGCTTCAAAA
AGGCTGTCCAGAGATCTCTACCAGATGCAAATGAACACACGTTATCTACA
CAATATAACAATTCACTTTCACGCAATACCGGTAAACCTTCTGTTAGTGC
TGATCCAACGACTCAATCAGAAAAGGATTTTCAGAATTCCAACCAAAGCA
CAACCAATCACAGAAATGAAAAACTTCCCAGATCTCATTCCGTAAAAACT
ACCGAAAAAAAGAAGTCATTTAATATCAAAGATTTTTTACCATTCCAAAC
AAACCCAAATCATTCAGTGAAATACAAACCAACAAATAAATCGGACACCT
TTCCGCCGGAAAAGCGCGGAGAACCGCAGCTACCGAACTATCAGTCGACA
AATCCTAACGACCTGAAGCATCGGCCGTACAGTCCGTTTGAACTTCCCCC
GGAAATGCAGTATAGCAACGATCCGGCAATCATCGACTCGACCAAACGCG
TTCTCGAATGGCAGAAGAAAAATGCTGACGTAATATCCAAAGAAAATAAA
AACAATAAAATTTATCATCCAATCAATTCAACCAATAACGATGCGAGAAT
TCAAAAAAGAAGGAAATCGAAAACGTTCAACTTAACACTATTAGCGTGTT
GCTCCCCGGCTGCAAAAACAAAACCAGATTTGAATTTACGAAGTCAAAGT
ACAAAGAAAAATACGACCCAATATCATTACGAAACAGATCCTTACGATAC
AATAGACGGTACGTTATCATCTCCAGTGGGTAACTGGAATCCGAAAAGTG
CGCGCAGTGCACCTCGGTCTGCAAACAACACGATATATGGTATCACAGGA
GCGATATCGACTAACAAAAACGGGGCGTTGGCACCGCGTTCAAACAGCAT
CATACCATATCAAACCAACTCCAACAGAAAACCAACGTCAATAGGCAACG
ATCTTTATGCGACAGTCAACAAACCGAACAAAAAAGAGTCAACCATTAAA
CAAAGTCCAAACATATCTCAAGTTCACAGAAATAAATATAAATTTTGAAT
TCTTTCCGAAACCAAACAAAAATGTTTACATTTTCATCATATCTCTGACT
GTCACGAGTTTGATTAATCAAAAAATTTTGATCTTTTCTGTATGAATATT
TGTAAGTAATTTGATTATTTTTATAAATTATTTTGTAAAGTTTGAGAAAT
ACTGAATAGTGAAGAAAATATAATGGAAAATGTCCGTATTTTTCATTATG
AATGTATTACTGTTATTTGTATAATTTGATTGAATATTAG
back to top

protein sequence of SMED30011984-orf-1

>SMED30011984-orf-1 ID=SMED30011984-orf-1|Name=SMED30011984-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1030bp
MNCQFYYKGQTVTITCVDNASIKKIYELSIPKFKQHLAQELRLLDNQVKF
RLKRRNGLLDSNDSANSVLVNKDLIIIEPENQLPNSNQNCHTPKRYKNIS
NTENDFKPSELQNSKPNFPPKPTPQMEYVLPNKKNIYQKYDQSHNPSKEN
PKASNFSRSELRRSLGAGIAYQYDLESSKNKGNYYGSVNNTYRNEVDSSD
SSISDLYPKPSNKSKAKLNRNMDLPMKGINNEEKFPMSKSAPASPTKPVP
PLRSPQTHLTMINVHNVRTIGKKIKISILKKPNGGLGFTIVTRDNQVLYG
SGADLSSSVVILVNKILSNGGAADDGRLRPGDRIIEVDNVPVISARDTTE
KLKTIPVNTTVELLISRIDNDESELNPPSSKLPKTSQLTFEISLNSKNKE
SQQLGLNIHYRNEKDDPLLGTGIYIHSILSNSLASQQGNLHKNDKLVGVN
GQSLANLSVEQTINLLKTAMQNNSFLAITVMRESMNEDPSNLIVTNNSKF
IINNENIPKSEITRCILPDKIKIDSKSKKKSKHRHQRNSSSDSCSQNEFD
PSHSLTSNSFVREGPSRRSMSEKRKFCEDPSQYQVYQKRIGDITFEANER
QYSTLPTASHKKKQDKSPPPPPLPNKTTMKPSQIKIKSVLESGPRMTNVT
PNRSVSLRDSPNTPNFAHKSRSPKHLSQTPSHELQPVFNREMNSSFKKAV
QRSLPDANEHTLSTQYNNSLSRNTGKPSVSADPTTQSEKDFQNSNQSTTN
HRNEKLPRSHSVKTTEKKKSFNIKDFLPFQTNPNHSVKYKPTNKSDTFPP
EKRGEPQLPNYQSTNPNDLKHRPYSPFELPPEMQYSNDPAIIDSTKRVLE
WQKKNADVISKENKNNKIYHPINSTNNDARIQKRRKSKTFNLTLLACCSP
AAKTKPDLNLRSQSTKKNTTQYHYETDPYDTIDGTLSSPVGNWNPKSARS
APRSANNTIYGITGAISTNKNGALAPRSNSIIPYQTNSNRKPTSIGNDLY
ATVNKPNKKESTIKQSPNISQVHRNKYKF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036034PDZ_sf
IPR001478PDZ
IPR001024PLAT/LH2_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0008289lipid binding
GO:0019903protein phosphatase binding
GO:0032266phosphatidylinositol-3-phosphate binding
GO:0005546phosphatidylinositol-4,5-bisphosphate binding
GO:0005547phosphatidylinositol-3,4,5-trisphosphate binding
Vocabulary: biological process
TermDefinition
GO:0007179transforming growth factor beta receptor signaling pathway
GO:0007205protein kinase C-activating G-protein coupled receptor signaling pathway
GO:0007409axonogenesis
GO:0008356asymmetric cell division
GO:0010801negative regulation of peptidyl-threonine phosphorylation
GO:0022011myelination in peripheral nervous system
GO:0030154cell differentiation
GO:0031643positive regulation of myelination
GO:0051301cell division
GO:0060341regulation of cellular localization
GO:0070830bicellular tight junction assembly
GO:0090162establishment of epithelial cell polarity
GO:0006461protein complex assembly
GO:0006612protein targeting to membrane
GO:0007049cell cycle
GO:0007163establishment or maintenance of cell polarity
Vocabulary: cellular component
TermDefinition
GO:0012505endomembrane system
GO:0016020membrane
GO:0030054cell junction
GO:0033269internode region of axon
GO:0043025neuronal cell body
GO:0043234protein complex
GO:0044295axonal growth cone
GO:0005737cytoplasm
GO:0005829cytosol
GO:0005856cytoskeleton
GO:0005886plasma membrane
GO:0005911cell-cell junction
GO:0005923bicellular tight junction
GO:0005938cell cortex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001478PDZ domainSMARTSM00228pdz_newcoord: 284..369
e-value: 1.3E-12
score: 57.9
coord: 402..484
e-value: 8.3E-13
score: 58.6
IPR001478PDZ domainPFAMPF00595PDZcoord: 398..470
e-value: 3.3E-11
score: 43.4
coord: 277..365
e-value: 1.3E-10
score: 41.5
IPR001478PDZ domainPROSITEPS50106PDZcoord: 391..469
score: 15.521
IPR001478PDZ domainPROSITEPS50106PDZcoord: 275..367
score: 14.516
IPR036034PDZ superfamilyGENE3DG3DSA:2.30.42.10coord: 386..495
e-value: 8.8E-18
score: 66.3
IPR036034PDZ superfamilyGENE3DG3DSA:2.30.42.10coord: 264..370
e-value: 2.1E-16
score: 61.7
IPR036034PDZ superfamilySUPERFAMILYSSF50156PDZ domain-likecoord: 385..483
IPR036034PDZ superfamilySUPERFAMILYSSF50156PDZ domain-likecoord: 271..367
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 714..820
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 775..793
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 540..565
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 104..123
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 714..752
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 753..773
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 643..687
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 524..577
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 604..687
NoneNo IPR availablePANTHERPTHR16484PARTITIONING DEFECTIVE 3 RELATEDcoord: 210..812
NoneNo IPR availableCDDcd00992PDZ_signalingcoord: 282..365
e-value: 4.31892E-10
score: 54.8803
NoneNo IPR availableCDDcd00992PDZ_signalingcoord: 399..469
e-value: 5.94901E-11
score: 57.5767