60S ribosomal protein L17

Overview
Name60S ribosomal protein L17
Smed IDSMED30011982
Length (bp)645
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of 60S ribosomal protein L17 (SMED30011982) t-SNE clustered cells

Violin plots show distribution of expression levels for 60S ribosomal protein L17 (SMED30011982) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of 60S ribosomal protein L17 (SMED30011982) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for 60S ribosomal protein L17 (SMED30011982) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011982

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 16

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30011982SMESG000009564.1 SmedASXL_018671SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30011982SMESG000009564.1 dd_Smed_v4_95_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30011982SMESG000009564.1 dd_Smed_v4_95_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30011982SMESG000009564.1 dd_Smed_v4_95_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30011982SMESG000009564.1 dd_Smed_v4_95_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30011982SMESG000009564.1 dd_Smed_v4_95_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30011982SMESG000009564.1 dd_Smed_v4_95_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30011982SMESG000009564.1 dd_Smed_v4_95_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30011982SMESG000009564.1 dd_Smed_v4_95_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30011982SMESG000009564.1 dd_Smed_v4_95_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30011982SMESG000009564.1 dd_Smed_v4_95_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30011982SMESG000009564.1 dd_Smed_v4_95_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30011982SMESG000009564.1 dd_Smed_v4_95_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 2 cellSMED30011982SMESG000009564.1 dd_Smed_v6_95_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30011982SMESG000009564.1 dd_Smed_v6_95_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynx progenitor cellSMED30011982SMESG000009564.1 dd_Smed_v6_95_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of 60S ribosomal protein L17 vs. Ensembl Human
Match: RPL17 (ribosomal protein L17 [Source:HGNC Symbol;Acc:HGNC:10307])

HSP 1 Score: 225.713 bits (574), Expect = 4.080e-75
Identity = 105/150 (70.00%), Postives = 123/150 (82.00%), Query Frame = 2
Query:   53 MPNYCKEPENASKSCKAFAPHQRVHFKNTYEAASVIKGMTLRRAQKFLKNVIAQKEIVPYHRFNGGVGRKAQAKAWGTSQGRWPKKSAEHLLQLLKNAESNAEFKGLEVDQLVIEHIQVNRAPKMRRRTYRAHGRINAYMSSPCHVQVIL 502
            M  Y  +PEN +KSCK+   + RVHFKNT E A  IKGM +R+A K+LK+V  QK+ VP+ R+NGGVGR AQAK WG +QGRWPKKSAE LL +LKNAESNAE KGL+VD LVIEHIQVN+APKMRRRTYRAHGRIN YMSSPCH+++IL
Sbjct:    1 MVRYSLDPENPTKSCKSRGSNLRVHFKNTRETAQAIKGMHIRKATKYLKDVTLQKQCVPFRRYNGGVGRCAQAKQWGWTQGRWPKKSAEFLLHMLKNAESNAELKGLDVDSLVIEHIQVNKAPKMRRRTYRAHGRINPYMSSPCHIEMIL 150          
BLAST of 60S ribosomal protein L17 vs. Ensembl Human
Match: RPL17 (ribosomal protein L17 [Source:HGNC Symbol;Acc:HGNC:10307])

HSP 1 Score: 225.328 bits (573), Expect = 4.494e-75
Identity = 105/150 (70.00%), Postives = 123/150 (82.00%), Query Frame = 2
Query:   53 MPNYCKEPENASKSCKAFAPHQRVHFKNTYEAASVIKGMTLRRAQKFLKNVIAQKEIVPYHRFNGGVGRKAQAKAWGTSQGRWPKKSAEHLLQLLKNAESNAEFKGLEVDQLVIEHIQVNRAPKMRRRTYRAHGRINAYMSSPCHVQVIL 502
            M  Y  +PEN +KSCK+   + RVHFKNT E A  IKGM +R+A K+LK+V  QK+ VP+ R+NGGVGR AQAK WG +QGRWPKKSAE LL +LKNAESNAE KGL+VD LVIEHIQVN+APKMRRRTYRAHGRIN YMSSPCH+++IL
Sbjct:    1 MVRYSLDPENPTKSCKSRGSNLRVHFKNTRETAQAIKGMHIRKATKYLKDVTLQKQCVPFRRYNGGVGRCAQAKQWGWTQGRWPKKSAEFLLHMLKNAESNAELKGLDVDSLVIEHIQVNKAPKMRRRTYRAHGRINPYMSSPCHIEMIL 150          
BLAST of 60S ribosomal protein L17 vs. Ensembl Human
Match: RPL17 (ribosomal protein L17 [Source:HGNC Symbol;Acc:HGNC:10307])

HSP 1 Score: 225.328 bits (573), Expect = 4.497e-75
Identity = 105/150 (70.00%), Postives = 123/150 (82.00%), Query Frame = 2
Query:   53 MPNYCKEPENASKSCKAFAPHQRVHFKNTYEAASVIKGMTLRRAQKFLKNVIAQKEIVPYHRFNGGVGRKAQAKAWGTSQGRWPKKSAEHLLQLLKNAESNAEFKGLEVDQLVIEHIQVNRAPKMRRRTYRAHGRINAYMSSPCHVQVIL 502
            M  Y  +PEN +KSCK+   + RVHFKNT E A  IKGM +R+A K+LK+V  QK+ VP+ R+NGGVGR AQAK WG +QGRWPKKSAE LL +LKNAESNAE KGL+VD LVIEHIQVN+APKMRRRTYRAHGRIN YMSSPCH+++IL
Sbjct:    1 MVRYSLDPENPTKSCKSRGSNLRVHFKNTRETAQAIKGMHIRKATKYLKDVTLQKQCVPFRRYNGGVGRCAQAKQWGWTQGRWPKKSAEFLLHMLKNAESNAELKGLDVDSLVIEHIQVNKAPKMRRRTYRAHGRINPYMSSPCHIEMIL 150          
BLAST of 60S ribosomal protein L17 vs. Ensembl Human
Match: RPL17-C18orf32 (RPL17-C18orf32 readthrough [Source:HGNC Symbol;Acc:HGNC:44661])

HSP 1 Score: 225.328 bits (573), Expect = 7.465e-75
Identity = 105/150 (70.00%), Postives = 123/150 (82.00%), Query Frame = 2
Query:   53 MPNYCKEPENASKSCKAFAPHQRVHFKNTYEAASVIKGMTLRRAQKFLKNVIAQKEIVPYHRFNGGVGRKAQAKAWGTSQGRWPKKSAEHLLQLLKNAESNAEFKGLEVDQLVIEHIQVNRAPKMRRRTYRAHGRINAYMSSPCHVQVIL 502
            M  Y  +PEN +KSCK+   + RVHFKNT E A  IKGM +R+A K+LK+V  QK+ VP+ R+NGGVGR AQAK WG +QGRWPKKSAE LL +LKNAESNAE KGL+VD LVIEHIQVN+APKMRRRTYRAHGRIN YMSSPCH+++IL
Sbjct:    1 MVRYSLDPENPTKSCKSRGSNLRVHFKNTRETAQAIKGMHIRKATKYLKDVTLQKQCVPFRRYNGGVGRCAQAKQWGWTQGRWPKKSAEFLLHMLKNAESNAELKGLDVDSLVIEHIQVNKAPKMRRRTYRAHGRINPYMSSPCHIEMIL 150          
BLAST of 60S ribosomal protein L17 vs. Ensembl Human
Match: RPL17 (ribosomal protein L17 [Source:HGNC Symbol;Acc:HGNC:10307])

HSP 1 Score: 225.328 bits (573), Expect = 7.465e-75
Identity = 105/150 (70.00%), Postives = 123/150 (82.00%), Query Frame = 2
Query:   53 MPNYCKEPENASKSCKAFAPHQRVHFKNTYEAASVIKGMTLRRAQKFLKNVIAQKEIVPYHRFNGGVGRKAQAKAWGTSQGRWPKKSAEHLLQLLKNAESNAEFKGLEVDQLVIEHIQVNRAPKMRRRTYRAHGRINAYMSSPCHVQVIL 502
            M  Y  +PEN +KSCK+   + RVHFKNT E A  IKGM +R+A K+LK+V  QK+ VP+ R+NGGVGR AQAK WG +QGRWPKKSAE LL +LKNAESNAE KGL+VD LVIEHIQVN+APKMRRRTYRAHGRIN YMSSPCH+++IL
Sbjct:    1 MVRYSLDPENPTKSCKSRGSNLRVHFKNTRETAQAIKGMHIRKATKYLKDVTLQKQCVPFRRYNGGVGRCAQAKQWGWTQGRWPKKSAEFLLHMLKNAESNAELKGLDVDSLVIEHIQVNKAPKMRRRTYRAHGRINPYMSSPCHIEMIL 150          
BLAST of 60S ribosomal protein L17 vs. Ensembl Celegans
Match: rpl-17 (60S ribosomal protein L17 [Source:UniProtKB/Swiss-Prot;Acc:Q9BL19])

HSP 1 Score: 221.09 bits (562), Expect = 1.573e-73
Identity = 102/149 (68.46%), Postives = 120/149 (80.54%), Query Frame = 2
Query:   59 NYCKEPENASKSCKAFAPHQRVHFKNTYEAASVIKGMTLRRAQKFLKNVIAQKEIVPYHRFNGGVGRKAQAKAWGTSQGRWPKKSAEHLLQLLKNAESNAEFKGLEVDQLVIEHIQVNRAPKMRRRTYRAHGRINAYMSSPCHVQVILG 505
            +Y + PEN++KSCKA     RVHFKNT+EAA  ++GM LRRAQ FL +V   KEIVP+ RF+GG+GR AQ K W T+QGRWP KSA+ LL LLKNAESNAE+KGL+VD LVIEHI V RA K+RRRTYRAHGRIN YMSSPCH++VIL 
Sbjct:    5 HYSRAPENSTKSCKARGSDLRVHFKNTHEAAMALRGMPLRRAQAFLNHVKEHKEIVPFRRFHGGIGRAAQTKQWNTTQGRWPVKSADFLLDLLKNAESNAEYKGLDVDHLVIEHINVQRAAKLRRRTYRAHGRINPYMSSPCHIEVILA 153          
BLAST of 60S ribosomal protein L17 vs. Ensembl Fly
Match: RpL17 (gene:FBgn0029897 transcript:FBtr0070983)

HSP 1 Score: 224.557 bits (571), Expect = 7.523e-75
Identity = 106/150 (70.67%), Postives = 123/150 (82.00%), Query Frame = 2
Query:   53 MPNYCKEPENASKSCKAFAPHQRVHFKNTYEAASVIKGMTLRRAQKFLKNVIAQKEIVPYHRFNGGVGRKAQAKAWGTSQGRWPKKSAEHLLQLLKNAESNAEFKGLEVDQLVIEHIQVNRAPKMRRRTYRAHGRINAYMSSPCHVQVIL 502
            M  Y +E +N +KSCKA  P+ RVHFKNT+E A  IK M LRRAQ++LK VI QKE VP+ RFNGGVGR AQAK W T+QGRWPKKSAE LLQLL+NAE+NA+ KGL+ D+LV+ HIQVNRA  +RRRTYRAHGRIN YMSSPCHV+VIL
Sbjct:    1 MGRYSRESDNVAKSCKARGPNLRVHFKNTHETAQAIKRMPLRRAQRYLKAVIDQKECVPFRRFNGGVGRCAQAKQWKTTQGRWPKKSAEFLLQLLRNAEANADCKGLDADRLVVHHIQVNRAQCLRRRTYRAHGRINPYMSSPCHVEVIL 150          
BLAST of 60S ribosomal protein L17 vs. Ensembl Fly
Match: RpL17 (gene:FBgn0029897 transcript:FBtr0345292)

HSP 1 Score: 224.557 bits (571), Expect = 7.523e-75
Identity = 106/150 (70.67%), Postives = 123/150 (82.00%), Query Frame = 2
Query:   53 MPNYCKEPENASKSCKAFAPHQRVHFKNTYEAASVIKGMTLRRAQKFLKNVIAQKEIVPYHRFNGGVGRKAQAKAWGTSQGRWPKKSAEHLLQLLKNAESNAEFKGLEVDQLVIEHIQVNRAPKMRRRTYRAHGRINAYMSSPCHVQVIL 502
            M  Y +E +N +KSCKA  P+ RVHFKNT+E A  IK M LRRAQ++LK VI QKE VP+ RFNGGVGR AQAK W T+QGRWPKKSAE LLQLL+NAE+NA+ KGL+ D+LV+ HIQVNRA  +RRRTYRAHGRIN YMSSPCHV+VIL
Sbjct:    1 MGRYSRESDNVAKSCKARGPNLRVHFKNTHETAQAIKRMPLRRAQRYLKAVIDQKECVPFRRFNGGVGRCAQAKQWKTTQGRWPKKSAEFLLQLLRNAEANADCKGLDADRLVVHHIQVNRAQCLRRRTYRAHGRINPYMSSPCHVEVIL 150          
BLAST of 60S ribosomal protein L17 vs. Ensembl Fly
Match: RpL17 (gene:FBgn0029897 transcript:FBtr0070982)

HSP 1 Score: 224.557 bits (571), Expect = 7.523e-75
Identity = 106/150 (70.67%), Postives = 123/150 (82.00%), Query Frame = 2
Query:   53 MPNYCKEPENASKSCKAFAPHQRVHFKNTYEAASVIKGMTLRRAQKFLKNVIAQKEIVPYHRFNGGVGRKAQAKAWGTSQGRWPKKSAEHLLQLLKNAESNAEFKGLEVDQLVIEHIQVNRAPKMRRRTYRAHGRINAYMSSPCHVQVIL 502
            M  Y +E +N +KSCKA  P+ RVHFKNT+E A  IK M LRRAQ++LK VI QKE VP+ RFNGGVGR AQAK W T+QGRWPKKSAE LLQLL+NAE+NA+ KGL+ D+LV+ HIQVNRA  +RRRTYRAHGRIN YMSSPCHV+VIL
Sbjct:    1 MGRYSRESDNVAKSCKARGPNLRVHFKNTHETAQAIKRMPLRRAQRYLKAVIDQKECVPFRRFNGGVGRCAQAKQWKTTQGRWPKKSAEFLLQLLRNAEANADCKGLDADRLVVHHIQVNRAQCLRRRTYRAHGRINPYMSSPCHVEVIL 150          
BLAST of 60S ribosomal protein L17 vs. Ensembl Fly
Match: RpL17 (gene:FBgn0029897 transcript:FBtr0070980)

HSP 1 Score: 224.557 bits (571), Expect = 7.523e-75
Identity = 106/150 (70.67%), Postives = 123/150 (82.00%), Query Frame = 2
Query:   53 MPNYCKEPENASKSCKAFAPHQRVHFKNTYEAASVIKGMTLRRAQKFLKNVIAQKEIVPYHRFNGGVGRKAQAKAWGTSQGRWPKKSAEHLLQLLKNAESNAEFKGLEVDQLVIEHIQVNRAPKMRRRTYRAHGRINAYMSSPCHVQVIL 502
            M  Y +E +N +KSCKA  P+ RVHFKNT+E A  IK M LRRAQ++LK VI QKE VP+ RFNGGVGR AQAK W T+QGRWPKKSAE LLQLL+NAE+NA+ KGL+ D+LV+ HIQVNRA  +RRRTYRAHGRIN YMSSPCHV+VIL
Sbjct:    1 MGRYSRESDNVAKSCKARGPNLRVHFKNTHETAQAIKRMPLRRAQRYLKAVIDQKECVPFRRFNGGVGRCAQAKQWKTTQGRWPKKSAEFLLQLLRNAEANADCKGLDADRLVVHHIQVNRAQCLRRRTYRAHGRINPYMSSPCHVEVIL 150          
BLAST of 60S ribosomal protein L17 vs. Ensembl Fly
Match: RpL17 (gene:FBgn0029897 transcript:FBtr0070981)

HSP 1 Score: 224.557 bits (571), Expect = 7.523e-75
Identity = 106/150 (70.67%), Postives = 123/150 (82.00%), Query Frame = 2
Query:   53 MPNYCKEPENASKSCKAFAPHQRVHFKNTYEAASVIKGMTLRRAQKFLKNVIAQKEIVPYHRFNGGVGRKAQAKAWGTSQGRWPKKSAEHLLQLLKNAESNAEFKGLEVDQLVIEHIQVNRAPKMRRRTYRAHGRINAYMSSPCHVQVIL 502
            M  Y +E +N +KSCKA  P+ RVHFKNT+E A  IK M LRRAQ++LK VI QKE VP+ RFNGGVGR AQAK W T+QGRWPKKSAE LLQLL+NAE+NA+ KGL+ D+LV+ HIQVNRA  +RRRTYRAHGRIN YMSSPCHV+VIL
Sbjct:    1 MGRYSRESDNVAKSCKARGPNLRVHFKNTHETAQAIKRMPLRRAQRYLKAVIDQKECVPFRRFNGGVGRCAQAKQWKTTQGRWPKKSAEFLLQLLRNAEANADCKGLDADRLVVHHIQVNRAQCLRRRTYRAHGRINPYMSSPCHVEVIL 150          
BLAST of 60S ribosomal protein L17 vs. Ensembl Zebrafish
Match: rpl17 (ribosomal protein L17 [Source:ZFIN;Acc:ZDB-GENE-030131-8585])

HSP 1 Score: 215.698 bits (548), Expect = 2.551e-71
Identity = 102/150 (68.00%), Postives = 121/150 (80.67%), Query Frame = 2
Query:   53 MPNYCKEPENASKSCKAFAPHQRVHFKNTYEAASVIKGMTLRRAQKFLKNVIAQKEIVPYHRFNGGVGRKAQAKAWGTSQGRWPKKSAEHLLQLLKNAESNAEFKGLEVDQLVIEHIQVNRAPKMRRRTYRAHGRINAYMSSPCHVQVIL 502
            M  Y  +PEN +KSCK+   + RVHFKNT E A  IKGM +R+A K+LK+VI + + VP+ R+NGGVGR AQAK    +QGRWPKKSAE LL +LKNAESNAE KGL+VD LVIEHIQVN+APKMRRRTYRAHGRIN YMSSPCH+++IL
Sbjct:    1 MVRYSLDPENPTKSCKSRGSNLRVHFKNTRETAQAIKGMHIRKANKYLKDVIVKHQCVPFRRYNGGVGRCAQAKQHDWTQGRWPKKSAEFLLHMLKNAESNAELKGLDVDSLVIEHIQVNKAPKMRRRTYRAHGRINPYMSSPCHIEMIL 150          
BLAST of 60S ribosomal protein L17 vs. Ensembl Zebrafish
Match: rpl17 (ribosomal protein L17 [Source:ZFIN;Acc:ZDB-GENE-030131-8585])

HSP 1 Score: 215.698 bits (548), Expect = 2.551e-71
Identity = 102/150 (68.00%), Postives = 121/150 (80.67%), Query Frame = 2
Query:   53 MPNYCKEPENASKSCKAFAPHQRVHFKNTYEAASVIKGMTLRRAQKFLKNVIAQKEIVPYHRFNGGVGRKAQAKAWGTSQGRWPKKSAEHLLQLLKNAESNAEFKGLEVDQLVIEHIQVNRAPKMRRRTYRAHGRINAYMSSPCHVQVIL 502
            M  Y  +PEN +KSCK+   + RVHFKNT E A  IKGM +R+A K+LK+VI + + VP+ R+NGGVGR AQAK    +QGRWPKKSAE LL +LKNAESNAE KGL+VD LVIEHIQVN+APKMRRRTYRAHGRIN YMSSPCH+++IL
Sbjct:    1 MVRYSLDPENPTKSCKSRGSNLRVHFKNTRETAQAIKGMHIRKANKYLKDVIVKHQCVPFRRYNGGVGRCAQAKQHDWTQGRWPKKSAEFLLHMLKNAESNAELKGLDVDSLVIEHIQVNKAPKMRRRTYRAHGRINPYMSSPCHIEMIL 150          
BLAST of 60S ribosomal protein L17 vs. Ensembl Zebrafish
Match: rpl17 (ribosomal protein L17 [Source:ZFIN;Acc:ZDB-GENE-030131-8585])

HSP 1 Score: 215.698 bits (548), Expect = 2.551e-71
Identity = 102/150 (68.00%), Postives = 121/150 (80.67%), Query Frame = 2
Query:   53 MPNYCKEPENASKSCKAFAPHQRVHFKNTYEAASVIKGMTLRRAQKFLKNVIAQKEIVPYHRFNGGVGRKAQAKAWGTSQGRWPKKSAEHLLQLLKNAESNAEFKGLEVDQLVIEHIQVNRAPKMRRRTYRAHGRINAYMSSPCHVQVIL 502
            M  Y  +PEN +KSCK+   + RVHFKNT E A  IKGM +R+A K+LK+VI + + VP+ R+NGGVGR AQAK    +QGRWPKKSAE LL +LKNAESNAE KGL+VD LVIEHIQVN+APKMRRRTYRAHGRIN YMSSPCH+++IL
Sbjct:    1 MVRYSLDPENPTKSCKSRGSNLRVHFKNTRETAQAIKGMHIRKANKYLKDVIVKHQCVPFRRYNGGVGRCAQAKQHDWTQGRWPKKSAEFLLHMLKNAESNAELKGLDVDSLVIEHIQVNKAPKMRRRTYRAHGRINPYMSSPCHIEMIL 150          
BLAST of 60S ribosomal protein L17 vs. Ensembl Zebrafish
Match: rpl17 (ribosomal protein L17 [Source:ZFIN;Acc:ZDB-GENE-030131-8585])

HSP 1 Score: 215.698 bits (548), Expect = 2.551e-71
Identity = 102/150 (68.00%), Postives = 121/150 (80.67%), Query Frame = 2
Query:   53 MPNYCKEPENASKSCKAFAPHQRVHFKNTYEAASVIKGMTLRRAQKFLKNVIAQKEIVPYHRFNGGVGRKAQAKAWGTSQGRWPKKSAEHLLQLLKNAESNAEFKGLEVDQLVIEHIQVNRAPKMRRRTYRAHGRINAYMSSPCHVQVIL 502
            M  Y  +PEN +KSCK+   + RVHFKNT E A  IKGM +R+A K+LK+VI + + VP+ R+NGGVGR AQAK    +QGRWPKKSAE LL +LKNAESNAE KGL+VD LVIEHIQVN+APKMRRRTYRAHGRIN YMSSPCH+++IL
Sbjct:    1 MVRYSLDPENPTKSCKSRGSNLRVHFKNTRETAQAIKGMHIRKANKYLKDVIVKHQCVPFRRYNGGVGRCAQAKQHDWTQGRWPKKSAEFLLHMLKNAESNAELKGLDVDSLVIEHIQVNKAPKMRRRTYRAHGRINPYMSSPCHIEMIL 150          
BLAST of 60S ribosomal protein L17 vs. Ensembl Zebrafish
Match: rpl17 (ribosomal protein L17 [Source:ZFIN;Acc:ZDB-GENE-030131-8585])

HSP 1 Score: 205.297 bits (521), Expect = 1.356e-67
Identity = 99/144 (68.75%), Postives = 115/144 (79.86%), Query Frame = 2
Query:   50 KMPNYCKEPENASKSCKAFAPHQRVHFKNTYEAASVIKGMTLRRAQKFLKNVIAQKEIVPYHRFNGGVGRKAQAKAWGTSQGRWPKKSAEHLLQLLKNAESNAEFKGLEVDQLVIEHIQVNRAPKMRRRTYRAHGRINAYMSSP 481
            KM  Y  +PEN +KSCK+   + RVHFKNT E A  IKGM +R+A K+LK+VI + + VP+ R+NGGVGR AQAK    +QGRWPKKSAE LL +LKNAESNAE KGL+VD LVIEHIQVN+APKMRRRTYRAHGRIN YMSSP
Sbjct:   12 KMVRYSLDPENPTKSCKSRGSNLRVHFKNTRETAQAIKGMHIRKANKYLKDVIVKHQCVPFRRYNGGVGRCAQAKQHDWTQGRWPKKSAEFLLHMLKNAESNAELKGLDVDSLVIEHIQVNKAPKMRRRTYRAHGRINPYMSSP 155          
BLAST of 60S ribosomal protein L17 vs. Ensembl Xenopus
Match: rgs20 (regulator of G-protein signaling 20 [Source:Xenbase;Acc:XB-GENE-976969])

HSP 1 Score: 219.55 bits (558), Expect = 1.243e-72
Identity = 103/150 (68.67%), Postives = 121/150 (80.67%), Query Frame = 2
Query:   53 MPNYCKEPENASKSCKAFAPHQRVHFKNTYEAASVIKGMTLRRAQKFLKNVIAQKEIVPYHRFNGGVGRKAQAKAWGTSQGRWPKKSAEHLLQLLKNAESNAEFKGLEVDQLVIEHIQVNRAPKMRRRTYRAHGRINAYMSSPCHVQVIL 502
            M  Y  +PEN +KSCKA   + RVHFKNT E A  IKGM +R+A K+LK+V  +K+ VP+ R+NGGVGR AQAK W  +QGRWPKKSA  LL +LKNAESNAE KGL+VD LVIEHIQVN+APKMRRRTYRAHGRIN YMSSPCH+++IL
Sbjct:    1 MVRYSLDPENPTKSCKARGSNLRVHFKNTRETAQAIKGMHIRKATKYLKDVTLKKQCVPFRRYNGGVGRCAQAKQWDWTQGRWPKKSANFLLHILKNAESNAEVKGLDVDSLVIEHIQVNKAPKMRRRTYRAHGRINPYMSSPCHIELIL 150          
BLAST of 60S ribosomal protein L17 vs. Ensembl Mouse
Match: Rpl17 (ribosomal protein L17 [Source:MGI Symbol;Acc:MGI:2448270])

HSP 1 Score: 223.787 bits (569), Expect = 2.169e-74
Identity = 104/150 (69.33%), Postives = 123/150 (82.00%), Query Frame = 2
Query:   53 MPNYCKEPENASKSCKAFAPHQRVHFKNTYEAASVIKGMTLRRAQKFLKNVIAQKEIVPYHRFNGGVGRKAQAKAWGTSQGRWPKKSAEHLLQLLKNAESNAEFKGLEVDQLVIEHIQVNRAPKMRRRTYRAHGRINAYMSSPCHVQVIL 502
            M  Y  +PEN +KSCK+   + RVHFKNT E A  IKGM +R+A K+LK+V  +K+ VP+ R+NGGVGR AQAK WG +QGRWPKKSAE LL +LKNAESNAE KGL+VD LVIEHIQVN+APKMRRRTYRAHGRIN YMSSPCH+++IL
Sbjct:    1 MVRYSLDPENPTKSCKSRGSNLRVHFKNTRETAQAIKGMHIRKATKYLKDVTLKKQCVPFRRYNGGVGRCAQAKQWGWTQGRWPKKSAEFLLHMLKNAESNAELKGLDVDSLVIEHIQVNKAPKMRRRTYRAHGRINPYMSSPCHIEMIL 150          
BLAST of 60S ribosomal protein L17 vs. Ensembl Mouse
Match: Rpl17 (ribosomal protein L17 [Source:MGI Symbol;Acc:MGI:2448270])

HSP 1 Score: 223.787 bits (569), Expect = 2.169e-74
Identity = 104/150 (69.33%), Postives = 123/150 (82.00%), Query Frame = 2
Query:   53 MPNYCKEPENASKSCKAFAPHQRVHFKNTYEAASVIKGMTLRRAQKFLKNVIAQKEIVPYHRFNGGVGRKAQAKAWGTSQGRWPKKSAEHLLQLLKNAESNAEFKGLEVDQLVIEHIQVNRAPKMRRRTYRAHGRINAYMSSPCHVQVIL 502
            M  Y  +PEN +KSCK+   + RVHFKNT E A  IKGM +R+A K+LK+V  +K+ VP+ R+NGGVGR AQAK WG +QGRWPKKSAE LL +LKNAESNAE KGL+VD LVIEHIQVN+APKMRRRTYRAHGRIN YMSSPCH+++IL
Sbjct:    1 MVRYSLDPENPTKSCKSRGSNLRVHFKNTRETAQAIKGMHIRKATKYLKDVTLKKQCVPFRRYNGGVGRCAQAKQWGWTQGRWPKKSAEFLLHMLKNAESNAELKGLDVDSLVIEHIQVNKAPKMRRRTYRAHGRINPYMSSPCHIEMIL 150          
BLAST of 60S ribosomal protein L17 vs. Ensembl Mouse
Match: Gm6133 (predicted gene 6133 [Source:MGI Symbol;Acc:MGI:3647029])

HSP 1 Score: 194.512 bits (493), Expect = 1.012e-62
Identity = 92/150 (61.33%), Postives = 114/150 (76.00%), Query Frame = 2
Query:   53 MPNYCKEPENASKSCKAFAPHQRVHFKNTYEAASVIKGMTLRRAQKFLKNVIAQKEIVPYHRFNGGVGRKAQAKAWGTSQGRWPKKSAEHLLQLLKNAESNAEFKGLEVDQLVIEHIQVNRAPKMRRRTYRAHGRINAYMSSPCHVQVIL 502
            M  Y  +PE  +KSCK+   +  VH KNT+E A  IKGM + +A K+LK+V  +K+ VP+ R++GGVG   QAK WG  QGRWP+ SAE LL +L+NAESNAE K L+VD LVIEHIQVN+APKMRRRTYRAHG IN YMSSPCH+++IL
Sbjct:    1 MVPYSFDPEAPTKSCKSRGSNFCVHSKNTWETAQAIKGMNIHKATKYLKDVTLKKQCVPFRRYHGGVGTCTQAKHWGWIQGRWPEMSAEFLLHMLENAESNAELKSLDVDSLVIEHIQVNKAPKMRRRTYRAHGPINPYMSSPCHIEMIL 150          
BLAST of 60S ribosomal protein L17 vs. UniProt/SwissProt
Match: sp|Q09JW2|RL17_ARGMO (60S ribosomal protein L17 OS=Argas monolakensis OX=34602 GN=RpL17 PE=2 SV=1)

HSP 1 Score: 249.21 bits (635), Expect = 1.200e-83
Identity = 123/167 (73.65%), Postives = 141/167 (84.43%), Query Frame = 2
Query:   53 MPNYCKEPENASKSCKAFAPHQRVHFKNTYEAASVIKGMTLRRAQKFLKNVIAQKEIVPYHRFNGGVGRKAQAKAWGTSQGRWPKKSAEHLLQLLKNAESNAEFKGLEVDQLVIEHIQVNRAPKMRRRTYRAHGRINAYMSSPCHVQVILGXXXXXXXXXXXDGETP 553
            M  Y  EP+NA+KSCKA   + RVHFKNT E A  IK M+LRRAQ++LKNVIA+KEIVP+ RFNGGVGRKAQAKAWG +QGRWPKKSAE L QLL+NAESNA++KGL+VD+LVI+HIQVNRAPKMRRRTYRAHGRIN YMSSPCHV+VIL EKE+VV     D + P
Sbjct:    1 MGRYSVEPDNATKSCKARGSNLRVHFKNTRETAQAIKRMSLRRAQRYLKNVIAKKEIVPFRRFNGGVGRKAQAKAWGCTQGRWPKKSAEFLWQLLRNAESNADYKGLDVDRLVIDHIQVNRAPKMRRRTYRAHGRINPYMSSPCHVEVILSEKEQVVAAPTPDEDAP 167          
BLAST of 60S ribosomal protein L17 vs. UniProt/SwissProt
Match: sp|Q4PM54|RL17_IXOSC (60S ribosomal protein L17 OS=Ixodes scapularis OX=6945 GN=RpL17 PE=2 SV=1)

HSP 1 Score: 242.276 bits (617), Expect = 6.765e-81
Identity = 114/151 (75.50%), Postives = 131/151 (86.75%), Query Frame = 2
Query:   53 MPNYCKEPENASKSCKAFAPHQRVHFKNTYEAASVIKGMTLRRAQKFLKNVIAQKEIVPYHRFNGGVGRKAQAKAWGTSQGRWPKKSAEHLLQLLKNAESNAEFKGLEVDQLVIEHIQVNRAPKMRRRTYRAHGRINAYMSSPCHVQVILG 505
            M  Y  EP+NA+KSCKA   + RVHFKNT E A  IK M LRRAQ++LKNVIA+KEIVP+ RFNGGVGRKAQAKA+G +QGRWPKKSAE L QLL+NAESNA++KGL+VD+LVI+HIQVNRAPKMRRRTYRAHGRIN YMSSPCH++VIL 
Sbjct:    1 MGRYSVEPDNATKSCKARGSNLRVHFKNTRETAQAIKHMALRRAQRYLKNVIAKKEIVPFRRFNGGVGRKAQAKAFGCTQGRWPKKSAEFLWQLLRNAESNADYKGLDVDRLVIDHIQVNRAPKMRRRTYRAHGRINPYMSSPCHIEVILS 151          
BLAST of 60S ribosomal protein L17 vs. UniProt/SwissProt
Match: sp|A8CAG3|RL17_PHLPP (60S ribosomal protein L17 OS=Phlebotomus papatasi OX=29031 GN=RpL17 PE=2 SV=1)

HSP 1 Score: 241.121 bits (614), Expect = 2.255e-80
Identity = 111/150 (74.00%), Postives = 131/150 (87.33%), Query Frame = 2
Query:   53 MPNYCKEPENASKSCKAFAPHQRVHFKNTYEAASVIKGMTLRRAQKFLKNVIAQKEIVPYHRFNGGVGRKAQAKAWGTSQGRWPKKSAEHLLQLLKNAESNAEFKGLEVDQLVIEHIQVNRAPKMRRRTYRAHGRINAYMSSPCHVQVIL 502
            M  Y +EP+NA+KSCK+   H RVHFKNT+EAA+ IK M LRRAQ+FLKNV+ +KE VP+ RFNGGVGR AQAK W T+QGRWPKKSAE LLQLL+NAESNA++KGL+VD+LVI+HIQVNRAP +RRRTYRAHGRIN YMSSPCH++VIL
Sbjct:    1 MGRYAREPDNATKSCKSRGSHLRVHFKNTHEAANAIKHMPLRRAQRFLKNVVEKKECVPFRRFNGGVGRCAQAKQWKTTQGRWPKKSAEFLLQLLRNAESNADYKGLDVDRLVIDHIQVNRAPCLRRRTYRAHGRINPYMSSPCHIEVIL 150          
BLAST of 60S ribosomal protein L17 vs. UniProt/SwissProt
Match: sp|A0NGY0|RL17_ANOGA (60S ribosomal protein L17 OS=Anopheles gambiae OX=7165 GN=RpL17 PE=3 SV=1)

HSP 1 Score: 233.417 bits (594), Expect = 2.239e-77
Identity = 111/150 (74.00%), Postives = 126/150 (84.00%), Query Frame = 2
Query:   53 MPNYCKEPENASKSCKAFAPHQRVHFKNTYEAASVIKGMTLRRAQKFLKNVIAQKEIVPYHRFNGGVGRKAQAKAWGTSQGRWPKKSAEHLLQLLKNAESNAEFKGLEVDQLVIEHIQVNRAPKMRRRTYRAHGRINAYMSSPCHVQVIL 502
            M  Y KEP+NASKSCK+   + RVHFKNT E A  IK M LRRAQ+FLKNVI +KE VP+ RFNGGVGR AQAK WGTS GRWPKKSAE LLQLLKNAE+NA++KGL+VD+LVI HIQVNRAP +RRRTYRAHGRIN YMSSPCH+++ L
Sbjct:    1 MGRYAKEPDNASKSCKSRGSNLRVHFKNTRETALAIKRMPLRRAQRFLKNVIEKKECVPFRRFNGGVGRCAQAKHWGTSVGRWPKKSAEFLLQLLKNAEANADYKGLDVDRLVINHIQVNRAPCLRRRTYRAHGRINPYMSSPCHIELSL 150          
BLAST of 60S ribosomal protein L17 vs. UniProt/SwissProt
Match: sp|Q0PXV9|RL17_DIACI (60S ribosomal protein L17 OS=Diaphorina citri OX=121845 GN=RpL17 PE=2 SV=1)

HSP 1 Score: 228.794 bits (582), Expect = 1.736e-75
Identity = 107/151 (70.86%), Postives = 123/151 (81.46%), Query Frame = 2
Query:   53 MPNYCKEPENASKSCKAFAPHQRVHFKNTYEAASVIKGMTLRRAQKFLKNVIAQKEIVPYHRFNGGVGRKAQAKAWGTSQGRWPKKSAEHLLQLLKNAESNAEFKGLEVDQLVIEHIQVNRAPKMRRRTYRAHGRINAYMSSPCHVQVILG 505
            M  Y KEP N +KSCKA   + RVHFKNT E A  I  M LRRA KFLKNV  Q E VP+ R+NGGVGR AQAK WGT+QGRWP+KSA+ LLQLLKNAESNA+++GL+ D+LVIEHIQVNRAP++RRRTYRAHGRIN YMSSPCH++VIL 
Sbjct:    1 MGRYSKEPRNPTKSCKARGSNLRVHFKNTRETAKTISKMPLRRAIKFLKNVKDQLECVPFRRYNGGVGRCAQAKQWGTTQGRWPRKSADFLLQLLKNAESNADYRGLDTDRLVIEHIQVNRAPRLRRRTYRAHGRINPYMSSPCHIEVILS 151          
BLAST of 60S ribosomal protein L17 vs. TrEMBL
Match: A0A087UMH4 (60S ribosomal protein L17 (Fragment) OS=Stegodyphus mimosarum OX=407821 GN=X975_04728 PE=3 SV=1)

HSP 1 Score: 249.595 bits (636), Expect = 1.575e-81
Identity = 116/151 (76.82%), Postives = 131/151 (86.75%), Query Frame = 2
Query:   53 MPNYCKEPENASKSCKAFAPHQRVHFKNTYEAASVIKGMTLRRAQKFLKNVIAQKEIVPYHRFNGGVGRKAQAKAWGTSQGRWPKKSAEHLLQLLKNAESNAEFKGLEVDQLVIEHIQVNRAPKMRRRTYRAHGRINAYMSSPCHVQVILG 505
            M  Y  EP+NA+KSCKA   + RVHFKNT E A  IK M+LRRAQ+FLKNVIA+KEIVP+ RFNGGVGRKAQAK WG +QGRWPKKSAE LLQLL+NAESNA++KGL+VD+LVIEHIQVNRAPKMRRRTYRAHGRIN YMSSP H++VIL 
Sbjct:    1 MARYSMEPDNATKSCKARGSNLRVHFKNTRETAQAIKKMSLRRAQRFLKNVIAKKEIVPFRRFNGGVGRKAQAKQWGATQGRWPKKSAEFLLQLLRNAESNADYKGLDVDRLVIEHIQVNRAPKMRRRTYRAHGRINPYMSSPSHIEVILS 151          
BLAST of 60S ribosomal protein L17 vs. TrEMBL
Match: A0A443SJW2 (60S ribosomal protein l17-like protein OS=Leptotrombidium deliense OX=299467 GN=B4U80_03840 PE=3 SV=1)

HSP 1 Score: 250.366 bits (638), Expect = 1.583e-81
Identity = 124/167 (74.25%), Postives = 140/167 (83.83%), Query Frame = 2
Query:   53 MPNYCKEPENASKSCKAFAPHQRVHFKNTYEAASVIKGMTLRRAQKFLKNVIAQKEIVPYHRFNGGVGRKAQAKAWGTSQGRWPKKSAEHLLQLLKNAESNAEFKGLEVDQLVIEHIQVNRAPKMRRRTYRAHGRINAYMSSPCHVQVILGXXXXXXXXXXXDGETP 553
            M  Y  EPEN +KSCKA   + RVHFKNT E A  IK M LRRAQ+FLKNVIA+KE+VP+ RFNGGVGRKAQAKAWG +QGRWPKKSAE +LQLL+NAESNA++KGL+VD+LVIEHIQVNRAPKMRRRTYRAHGRIN YMSSP H++VIL EKE+VV K   D E P
Sbjct:    1 MTRYSTEPENPTKSCKARGSNLRVHFKNTRETAQAIKKMPLRRAQRFLKNVIAKKEVVPFRRFNGGVGRKAQAKAWGCTQGRWPKKSAEFMLQLLRNAESNADYKGLDVDRLVIEHIQVNRAPKMRRRTYRAHGRINPYMSSPSHIEVILSEKEQVVAKPSADEEAP 167          
BLAST of 60S ribosomal protein L17 vs. TrEMBL
Match: A0A2I9LPK2 (60S ribosomal protein L17 OS=Centruroides hentzi OX=88313 PE=3 SV=1)

HSP 1 Score: 249.595 bits (636), Expect = 2.507e-81
Identity = 123/167 (73.65%), Postives = 141/167 (84.43%), Query Frame = 2
Query:   53 MPNYCKEPENASKSCKAFAPHQRVHFKNTYEAASVIKGMTLRRAQKFLKNVIAQKEIVPYHRFNGGVGRKAQAKAWGTSQGRWPKKSAEHLLQLLKNAESNAEFKGLEVDQLVIEHIQVNRAPKMRRRTYRAHGRINAYMSSPCHVQVILGXXXXXXXXXXXDGETP 553
            M  Y +EPENA+KSCKA   + RVHFKNT E A  +K M LRRAQ+FLKNV+AQKEIVP+ RFNGGVGRKAQAK WG +QGRWP+KSAE LLQLL+N ESNA++KGL+VD+LVIEHIQVNRAPKMRRRTYRAHGRIN YMSSPCH++VIL EKE+VV K   + E P
Sbjct:    1 MGRYSQEPENATKSCKARGSNLRVHFKNTRETAQAVKRMPLRRAQRFLKNVMAQKEIVPFRRFNGGVGRKAQAKQWGCTQGRWPRKSAEFLLQLLRNGESNADYKGLDVDRLVIEHIQVNRAPKMRRRTYRAHGRINPYMSSPCHIEVILSEKEQVVAKPTAEEEAP 167          
BLAST of 60S ribosomal protein L17 vs. TrEMBL
Match: A0A4Y2P1A7 (60S ribosomal protein L17 OS=Araneus ventricosus OX=182803 GN=RpL17_1 PE=3 SV=1)

HSP 1 Score: 248.825 bits (634), Expect = 6.711e-81
Identity = 122/167 (73.05%), Postives = 141/167 (84.43%), Query Frame = 2
Query:   53 MPNYCKEPENASKSCKAFAPHQRVHFKNTYEAASVIKGMTLRRAQKFLKNVIAQKEIVPYHRFNGGVGRKAQAKAWGTSQGRWPKKSAEHLLQLLKNAESNAEFKGLEVDQLVIEHIQVNRAPKMRRRTYRAHGRINAYMSSPCHVQVILGXXXXXXXXXXXDGETP 553
            M  Y  EP+NA+KSCKA   + RVHFKNT E A  IK M+LRRAQ+FLKNVI++KEIVP+ RFNGGVGRKAQAK WG +QGRWPKKSAE LLQLL+NAESNA++KGL+VD+LV+EHIQVNRAPKMRRRTYRAHGRIN YMSSP H++VIL EKE+VV K   + E P
Sbjct:    1 MGRYSMEPDNATKSCKARGSNLRVHFKNTRETAQAIKKMSLRRAQRFLKNVISKKEIVPFRRFNGGVGRKAQAKQWGATQGRWPKKSAEFLLQLLRNAESNADYKGLDVDRLVVEHIQVNRAPKMRRRTYRAHGRINPYMSSPSHIEVILSEKEQVVAKPTAEEEAP 167          
BLAST of 60S ribosomal protein L17 vs. TrEMBL
Match: A0A3S3P1H1 (Uncharacterized protein OS=Dinothrombium tinctorium OX=1965070 GN=B4U79_10334 PE=3 SV=1)

HSP 1 Score: 248.44 bits (633), Expect = 8.919e-81
Identity = 124/167 (74.25%), Postives = 140/167 (83.83%), Query Frame = 2
Query:   53 MPNYCKEPENASKSCKAFAPHQRVHFKNTYEAASVIKGMTLRRAQKFLKNVIAQKEIVPYHRFNGGVGRKAQAKAWGTSQGRWPKKSAEHLLQLLKNAESNAEFKGLEVDQLVIEHIQVNRAPKMRRRTYRAHGRINAYMSSPCHVQVILGXXXXXXXXXXXDGETP 553
            M  Y  EPEN +KSCKA   + RVHFKNT E A  IK M LRRAQ++LKNVIA+KE+VP+ RFNGGVGRKAQAKAWG +QGRWPKKSAE LLQLL+NAESNA++KGL+VD+LVIEHIQVNRAPKMRRRTYRAHGRIN YMSSP H++VIL EKE+VV K   D E P
Sbjct:    1 MTRYSTEPENPTKSCKARGSNLRVHFKNTRETAQAIKHMPLRRAQRYLKNVIAKKEVVPFRRFNGGVGRKAQAKAWGCTQGRWPKKSAEFLLQLLRNAESNADYKGLDVDRLVIEHIQVNRAPKMRRRTYRAHGRINPYMSSPSHIEVILSEKEQVVAKPSGDEEAP 167          
BLAST of 60S ribosomal protein L17 vs. Ensembl Cavefish
Match: rpl17 (ribosomal protein L17 [Source:ZFIN;Acc:ZDB-GENE-030131-8585])

HSP 1 Score: 217.238 bits (552), Expect = 2.569e-71
Identity = 102/151 (67.55%), Postives = 122/151 (80.79%), Query Frame = 2
Query:   50 KMPNYCKEPENASKSCKAFAPHQRVHFKNTYEAASVIKGMTLRRAQKFLKNVIAQKEIVPYHRFNGGVGRKAQAKAWGTSQGRWPKKSAEHLLQLLKNAESNAEFKGLEVDQLVIEHIQVNRAPKMRRRTYRAHGRINAYMSSPCHVQVIL 502
            +M  Y  +PEN +KSCK+   + RVHFKNT E A  IKGM +R+A K+LK+V+ Q + VP+ R+NGGVGR AQAK    +QGRWPKKSAE LL +LKNAESNAE KGL+VD LVIEHIQVN+APKMRRRTYRAHGRIN YMSSPCH+++IL
Sbjct:   40 EMVRYSLDPENPTKSCKSRGSNLRVHFKNTRETAQAIKGMHIRKASKYLKDVVVQHQCVPFRRYNGGVGRCAQAKQHNWTQGRWPKKSAEFLLHMLKNAESNAELKGLDVDSLVIEHIQVNKAPKMRRRTYRAHGRINPYMSSPCHIEMIL 190          
BLAST of 60S ribosomal protein L17 vs. Ensembl Cavefish
Match: rpl17 (ribosomal protein L17 [Source:ZFIN;Acc:ZDB-GENE-030131-8585])

HSP 1 Score: 194.512 bits (493), Expect = 4.072e-63
Identity = 97/150 (64.67%), Postives = 115/150 (76.67%), Query Frame = 2
Query:   53 MPNYCKEPENASKSCKAFAPHQRVHFKNTYEAASVIKGMTLRRAQKFLKNVIAQKEIVPYHRFNGGVGRKAQAKAWGTSQGRWPKKSAEHLLQLLKNAESNAEFKGLEVDQLVIEHIQVNRAPKMRRRTYRAHGRINAYMSSPCHVQVIL 502
            M  Y  +PEN +K CK    +  V   NT E A  IKGM +R+A K+LK+V+ Q + VP+ R+NGGVGR AQAK    +QGRWPKKSAE LL +LKNAESNAE KGL+VD LVIEHIQVN+APKMRRRTYRAHGRIN YMSSPCH+++IL
Sbjct:    1 MVRYSLDPENPTK-CK----YNCVGIVNTRETAQAIKGMHIRKASKYLKDVVVQHQCVPFRRYNGGVGRCAQAKQHNWTQGRWPKKSAEFLLHMLKNAESNAELKGLDVDSLVIEHIQVNKAPKMRRRTYRAHGRINPYMSSPCHIEMIL 145          
BLAST of 60S ribosomal protein L17 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006801.1 (pep scaffold:Pmarinus_7.0:GL481121:8924:11538:-1 gene:ENSPMAG00000006142.1 transcript:ENSPMAT00000006801.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 144.821 bits (364), Expect = 2.866e-45
Identity = 70/105 (66.67%), Postives = 82/105 (78.10%), Query Frame = 2
Query:   53 MPNYCKEPENASKSCKAFAPHQRVHFKNTYEAASVIKGMTLRRAQKFLKNVIAQKEIVPYHRFNGGVGRKAQAKAWGTSQGRWPKKSAEHLLQLLKNAESNAEFK 367
            M  Y  +PEN +KSCKA   + RVHFKNT E A  IKGM +R+A K+LK+V+  K+ VP+ R+NGGVGR AQAKAW  +QGRWPKKSAE LLQLLKNAESNAEFK
Sbjct:    1 MGRYSLDPENPTKSCKARGSNLRVHFKNTRETAHTIKGMHIRKATKYLKDVVLMKQCVPFRRYNGGVGRCAQAKAWDWTQGRWPKKSAEFLLQLLKNAESNAEFK 105          
BLAST of 60S ribosomal protein L17 vs. Ensembl Yeast
Match: RPL17A (Ribosomal 60S subunit protein L17A; required for processing of 27SB pre-rRNA and formation of stable 66S assembly intermediates; copurifies with the Dam1 complex (aka DASH complex); homologous to mammalian ribosomal protein L17 and bacterial L22; RPL17A has a paralog, RPL17B, that arose from the whole genome duplication; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000001663])

HSP 1 Score: 157.918 bits (398), Expect = 2.041e-49
Identity = 73/150 (48.67%), Postives = 99/150 (66.00%), Query Frame = 2
Query:   53 MPNYCKEPENASKSCKAFAPHQRVHFKNTYEAASVIKGMTLRRAQKFLKNVIAQKEIVPYHRFNGGVGRKAQAKAWGTSQGRWPKKSAEHLLQLLKNAESNAEFKGLEVDQLVIEHIQVNRAPKMRRRTYRAHGRINAYMSSPCHVQVIL 502
            M  Y     N +KS  A   + RV FKNT E A  I G  L +AQK+L+ V+  +  +P+ RFN  +GR AQ K +G ++ RWP KS + +  LL+NA +NAE KGL+  +L + HIQVN+APK RRRTYRAHGRIN Y SSP H+++++
Sbjct:    1 MARYGATSTNPAKSASARGSYLRVSFKNTRETAQAINGWELTKAQKYLEQVLDHQRAIPFRRFNSSIGRTAQGKEFGVTKARWPAKSVKFVQGLLQNAAANAEAKGLDATKLYVSHIQVNQAPKQRRRTYRAHGRINKYESSPSHIELVV 150          
BLAST of 60S ribosomal protein L17 vs. Ensembl Yeast
Match: RPL17B (Ribosomal 60S subunit protein L17B; required for processing of 27SB pre-rRNA and formation of stable 66S assembly intermediates; homologous to mammalian ribosomal protein L17 and bacterial L22; RPL17B has a paralog, RPL17A, that arose from the whole genome duplication [Source:SGD;Acc:S000003713])

HSP 1 Score: 157.532 bits (397), Expect = 2.275e-49
Identity = 73/150 (48.67%), Postives = 98/150 (65.33%), Query Frame = 2
Query:   53 MPNYCKEPENASKSCKAFAPHQRVHFKNTYEAASVIKGMTLRRAQKFLKNVIAQKEIVPYHRFNGGVGRKAQAKAWGTSQGRWPKKSAEHLLQLLKNAESNAEFKGLEVDQLVIEHIQVNRAPKMRRRTYRAHGRINAYMSSPCHVQVIL 502
            M  Y     N +KS  A   + RV FKNT E A  I G  L +AQK+L  V+  +  +P+ RFN  +GR AQ K +G ++ RWP KS + +  LL+NA +NAE KGL+  +L + HIQVN+APK RRRTYRAHGRIN Y SSP H+++++
Sbjct:    1 MARYGATSTNPAKSASARGSYLRVSFKNTRETAQAINGWELTKAQKYLDQVLDHQRAIPFRRFNSSIGRTAQGKEFGVTKARWPAKSVKFVQGLLQNAAANAEAKGLDATKLYVSHIQVNQAPKQRRRTYRAHGRINKYESSPSHIELVV 150          
BLAST of 60S ribosomal protein L17 vs. Ensembl Nematostella
Match: EDO45625 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSF0])

HSP 1 Score: 222.246 bits (565), Expect = 2.603e-74
Identity = 105/153 (68.63%), Postives = 126/153 (82.35%), Query Frame = 2
Query:   53 MPNYCKEPENASKSCKAFAPHQRVHFKNTYEAASVIKGMTLRRAQKFLKNVIAQKEIVPYHRFNGGVGRKAQAKAWGT--SQGRWPKKSAEHLLQLLKNAESNAEFKGLEVDQLVIEHIQVNRAPKMRRRTYRAHGRINAYMSSPCHVQVILG 505
            M  Y  +PEN +KSCKA   + RVH+KNT+EAA  IKGM +R+A ++LK+V A+K++VP+ ++NGGVGRKAQAK      SQGRWPKKSAE LLQLLKNAESNAEFKGL+VD LV+EHIQVN AP MRRRTYRAHGRIN YMSSPCH+++IL 
Sbjct:    1 MTRYATDPENPTKSCKARGSNLRVHYKNTHEAAMAIKGMHVRKANRYLKDVCAKKQLVPFRKYNGGVGRKAQAKNLKVPGSQGRWPKKSAEILLQLLKNAESNAEFKGLDVDSLVVEHIQVNEAPSMRRRTYRAHGRINPYMSSPCHIELILS 153          
BLAST of 60S ribosomal protein L17 vs. Ensembl Medaka
Match: rpl17 (ribosomal protein L17 [Source:NCBI gene;Acc:101159487])

HSP 1 Score: 219.55 bits (558), Expect = 4.232e-72
Identity = 102/151 (67.55%), Postives = 124/151 (82.12%), Query Frame = 2
Query:   50 KMPNYCKEPENASKSCKAFAPHQRVHFKNTYEAASVIKGMTLRRAQKFLKNVIAQKEIVPYHRFNGGVGRKAQAKAWGTSQGRWPKKSAEHLLQLLKNAESNAEFKGLEVDQLVIEHIQVNRAPKMRRRTYRAHGRINAYMSSPCHVQVIL 502
            KM  Y  +PEN +KSCKA   + RVHFKNT E A  IKGM +R+A K+L++V+ +++ VP+ R+NGGVGR AQAK +  +QGRWPKKSAE LL +LKNAESNAE KGL+VD LVIEHIQVN+APKMRRRTYRAHGRIN YMSSPCH+++IL
Sbjct:   51 KMVRYSLDPENPTKSCKARGSNLRVHFKNTRETAQAIKGMHIRKANKYLRDVVVKRQCVPFRRYNGGVGRCAQAKQFDWTQGRWPKKSAEFLLHMLKNAESNAELKGLDVDSLVIEHIQVNKAPKMRRRTYRAHGRINPYMSSPCHIEMIL 201          
BLAST of 60S ribosomal protein L17 vs. Ensembl Medaka
Match: rpl17 (ribosomal protein L17 [Source:NCBI gene;Acc:101159487])

HSP 1 Score: 220.705 bits (561), Expect = 4.883e-72
Identity = 102/151 (67.55%), Postives = 124/151 (82.12%), Query Frame = 2
Query:   50 KMPNYCKEPENASKSCKAFAPHQRVHFKNTYEAASVIKGMTLRRAQKFLKNVIAQKEIVPYHRFNGGVGRKAQAKAWGTSQGRWPKKSAEHLLQLLKNAESNAEFKGLEVDQLVIEHIQVNRAPKMRRRTYRAHGRINAYMSSPCHVQVIL 502
            KM  Y  +PEN +KSCKA   + RVHFKNT E A  IKGM +R+A K+L++V+ +++ VP+ R+NGGVGR AQAK +  +QGRWPKKSAE LL +LKNAESNAE KGL+VD LVIEHIQVN+APKMRRRTYRAHGRIN YMSSPCH+++IL
Sbjct:   85 KMVRYSLDPENPTKSCKARGSNLRVHFKNTRETAQAIKGMHIRKANKYLRDVVVKRQCVPFRRYNGGVGRCAQAKQFDWTQGRWPKKSAEFLLHMLKNAESNAELKGLDVDSLVIEHIQVNKAPKMRRRTYRAHGRINPYMSSPCHIEMIL 235          
BLAST of 60S ribosomal protein L17 vs. Ensembl Medaka
Match: rpl17 (ribosomal protein L17 [Source:NCBI gene;Acc:101159487])

HSP 1 Score: 193.356 bits (490), Expect = 1.301e-62
Identity = 93/150 (62.00%), Postives = 116/150 (77.33%), Query Frame = 2
Query:   53 MPNYCKEPENASKSCKAFAPHQRVHFKNTYEAASVIKGMTLRRAQKFLKNVIAQKEIVPYHRFNGGVGRKAQAKAWGTSQGRWPKKSAEHLLQLLKNAESNAEFKGLEVDQLVIEHIQVNRAPKMRRRTYRAHGRINAYMSSPCHVQVIL 502
            M  Y  +PEN +K C+          +NT E A  IKGM +R+A K+L++V+ +++ VP+ R+NGGVGR AQAK +  +QGRWPKKSAE LL +LKNAESNAE KGL+VD LVIEHIQVN+APKMRRRTYRAHGRIN YMSSPCH+++IL
Sbjct:    1 MVRYSLDPENPTK-CEYLK-----GVRNTRETAQAIKGMHIRKANKYLRDVVVKRQCVPFRRYNGGVGRCAQAKQFDWTQGRWPKKSAEFLLHMLKNAESNAELKGLDVDSLVIEHIQVNKAPKMRRRTYRAHGRINPYMSSPCHIEMIL 144          
BLAST of 60S ribosomal protein L17 vs. Planmine SMEST
Match: SMESG000009564.1 (SMESG000009564.1)

HSP 1 Score: 330.102 bits (845), Expect = 1.062e-116
Identity = 184/184 (100.00%), Postives = 184/184 (100.00%), Query Frame = 2
Query:   53 MPNYCKEPENASKSCKAFAPHQRVHFKNTYEAASVIKGMTLRRAQKFLKNVIAQKEIVPYHRFNGGVGRKAQAKAWGTSQGRWPKKSAEHLLQLLKNAESNAEFKGLEVDQLVIEHIQVNRAPKMRRRTYRAHGRINAYMSSPCHVQVILGXXXXXXXXXXXDGETPXXXXXXXXXXXXXMQMT 604
            MPNYCKEPENASKSCKAFAPHQRVHFKNTYEAASVIKGMTLRRAQKFLKNVIAQKEIVPYHRFNGGVGRKAQAKAWGTSQGRWPKKSAEHLLQLLKNAESNAEFKGLEVDQLVIEHIQVNRAPKMRRRTYRAHGRINAYMSSPCHVQVILGEKEEVVPKVVEDGETPKKKESKKKLKKQKMQMT
Sbjct:    1 MPNYCKEPENASKSCKAFAPHQRVHFKNTYEAASVIKGMTLRRAQKFLKNVIAQKEIVPYHRFNGGVGRKAQAKAWGTSQGRWPKKSAEHLLQLLKNAESNAEFKGLEVDQLVIEHIQVNRAPKMRRRTYRAHGRINAYMSSPCHVQVILGEKEEVVPKVVEDGETPKKKESKKKLKKQKMQMT 184          
The following BLAST results are available for this feature:
BLAST of 60S ribosomal protein L17 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RPL174.080e-7570.00ribosomal protein L17 [Source:HGNC Symbol;Acc:HGNC... [more]
RPL174.494e-7570.00ribosomal protein L17 [Source:HGNC Symbol;Acc:HGNC... [more]
RPL174.497e-7570.00ribosomal protein L17 [Source:HGNC Symbol;Acc:HGNC... [more]
RPL17-C18orf327.465e-7570.00RPL17-C18orf32 readthrough [Source:HGNC Symbol;Acc... [more]
RPL177.465e-7570.00ribosomal protein L17 [Source:HGNC Symbol;Acc:HGNC... [more]
back to top
BLAST of 60S ribosomal protein L17 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rpl-171.573e-7368.4660S ribosomal protein L17 [Source:UniProtKB/Swiss... [more]
back to top
BLAST of 60S ribosomal protein L17 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RpL177.523e-7570.67gene:FBgn0029897 transcript:FBtr0070983[more]
RpL177.523e-7570.67gene:FBgn0029897 transcript:FBtr0345292[more]
RpL177.523e-7570.67gene:FBgn0029897 transcript:FBtr0070982[more]
RpL177.523e-7570.67gene:FBgn0029897 transcript:FBtr0070980[more]
RpL177.523e-7570.67gene:FBgn0029897 transcript:FBtr0070981[more]
back to top
BLAST of 60S ribosomal protein L17 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rpl172.551e-7168.00ribosomal protein L17 [Source:ZFIN;Acc:ZDB-GENE-03... [more]
rpl172.551e-7168.00ribosomal protein L17 [Source:ZFIN;Acc:ZDB-GENE-03... [more]
rpl172.551e-7168.00ribosomal protein L17 [Source:ZFIN;Acc:ZDB-GENE-03... [more]
rpl172.551e-7168.00ribosomal protein L17 [Source:ZFIN;Acc:ZDB-GENE-03... [more]
rpl171.356e-6768.75ribosomal protein L17 [Source:ZFIN;Acc:ZDB-GENE-03... [more]
back to top
BLAST of 60S ribosomal protein L17 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rgs201.243e-7268.67regulator of G-protein signaling 20 [Source:Xenbas... [more]
back to top
BLAST of 60S ribosomal protein L17 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Rpl172.169e-7469.33ribosomal protein L17 [Source:MGI Symbol;Acc:MGI:2... [more]
Rpl172.169e-7469.33ribosomal protein L17 [Source:MGI Symbol;Acc:MGI:2... [more]
Gm61331.012e-6261.33predicted gene 6133 [Source:MGI Symbol;Acc:MGI:364... [more]
back to top
BLAST of 60S ribosomal protein L17 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q09JW2|RL17_ARGMO1.200e-8373.6560S ribosomal protein L17 OS=Argas monolakensis OX... [more]
sp|Q4PM54|RL17_IXOSC6.765e-8175.5060S ribosomal protein L17 OS=Ixodes scapularis OX=... [more]
sp|A8CAG3|RL17_PHLPP2.255e-8074.0060S ribosomal protein L17 OS=Phlebotomus papatasi ... [more]
sp|A0NGY0|RL17_ANOGA2.239e-7774.0060S ribosomal protein L17 OS=Anopheles gambiae OX=... [more]
sp|Q0PXV9|RL17_DIACI1.736e-7570.8660S ribosomal protein L17 OS=Diaphorina citri OX=1... [more]
back to top
BLAST of 60S ribosomal protein L17 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A087UMH41.575e-8176.8260S ribosomal protein L17 (Fragment) OS=Stegodyphu... [more]
A0A443SJW21.583e-8174.2560S ribosomal protein l17-like protein OS=Leptotro... [more]
A0A2I9LPK22.507e-8173.6560S ribosomal protein L17 OS=Centruroides hentzi O... [more]
A0A4Y2P1A76.711e-8173.0560S ribosomal protein L17 OS=Araneus ventricosus O... [more]
A0A3S3P1H18.919e-8174.25Uncharacterized protein OS=Dinothrombium tinctoriu... [more]
back to top
BLAST of 60S ribosomal protein L17 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rpl172.569e-7167.55ribosomal protein L17 [Source:ZFIN;Acc:ZDB-GENE-03... [more]
rpl174.072e-6364.67ribosomal protein L17 [Source:ZFIN;Acc:ZDB-GENE-03... [more]
back to top
BLAST of 60S ribosomal protein L17 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000006801.12.866e-4566.67pep scaffold:Pmarinus_7.0:GL481121:8924:11538:-1 g... [more]
back to top
BLAST of 60S ribosomal protein L17 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
RPL17A2.041e-4948.67Ribosomal 60S subunit protein L17A; required for p... [more]
RPL17B2.275e-4948.67Ribosomal 60S subunit protein L17B; required for p... [more]
back to top
BLAST of 60S ribosomal protein L17 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO456252.603e-7468.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of 60S ribosomal protein L17 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
rpl174.232e-7267.55ribosomal protein L17 [Source:NCBI gene;Acc:101159... [more]
rpl174.883e-7267.55ribosomal protein L17 [Source:NCBI gene;Acc:101159... [more]
rpl171.301e-6262.00ribosomal protein L17 [Source:NCBI gene;Acc:101159... [more]
back to top
BLAST of 60S ribosomal protein L17 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000009564.11.062e-116100.00SMESG000009564.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011982 ID=SMED30011982|Name=60S ribosomal protein L17|organism=Schmidtea mediterranea sexual|type=transcript|length=645bp
AATAAATTTGTTTTAAATAGCACGTACAAAAGTTCTCTAAATATTTAAAA
AAATGCCAAATTATTGTAAGGAACCTGAAAATGCAAGCAAATCTTGCAAG
GCATTTGCACCCCATCAACGCGTCCATTTTAAAAATACTTATGAAGCTGC
CTCAGTTATCAAAGGAATGACTTTACGTAGAGCTCAAAAGTTCTTGAAAA
ATGTTATCGCCCAAAAAGAGATTGTTCCATATCACCGATTTAACGGTGGT
GTTGGAAGAAAAGCTCAAGCTAAAGCATGGGGAACAAGTCAAGGTAGATG
GCCAAAGAAATCTGCTGAACATCTTCTCCAATTGTTGAAAAACGCTGAAT
CAAATGCTGAATTCAAAGGACTTGAAGTTGATCAATTAGTTATTGAACAT
ATCCAAGTTAACAGAGCACCAAAAATGAGAAGACGTACATACAGAGCCCA
CGGTAGAATTAATGCCTACATGAGCTCACCATGCCACGTTCAAGTGATTC
TTGGTGAAAAGGAAGAAGTCGTTCCTAAAGTAGTTGAAGATGGAGAAACA
CCAAAAAAGAAAGAAAGCAAGAAAAAGCTTAAGAAACAAAAGATGCAAAT
GACCGATTAAATTATAAAATAAAAGTTCTTGGATTTCAAAAAAAA
back to top

protein sequence of SMED30011982-orf-1

>SMED30011982-orf-1 ID=SMED30011982-orf-1|Name=SMED30011982-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=186bp
MPNYCKEPENASKSCKAFAPHQRVHFKNTYEAASVIKGMTLRRAQKFLKN
VIAQKEIVPYHRFNGGVGRKAQAKAWGTSQGRWPKKSAEHLLQLLKNAES
NAEFKGLEVDQLVIEHIQVNRAPKMRRRTYRAHGRINAYMSSPCHVQVIL
GEKEEVVPKVVEDGETPKKKESKKKLKKQKMQMTD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000028Category 2 cell
PLANA:0000110pharynx progenitor cell
PLANA:0000429neoblast
PLANA:0002032epidermal cell
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR005721Ribosomal_L22/L17_euk/arc
IPR036394Ribosomal_L22/L17_sf
IPR001063Ribosomal_L22
IPR018260Ribosomal_L22/L17_CS
Vocabulary: biological process
TermDefinition
GO:0006412translation
Vocabulary: molecular function
TermDefinition
GO:0003735structural constituent of ribosome
Vocabulary: cellular component
TermDefinition
GO:0005840ribosome
GO:0005622intracellular
GO:0015934large ribosomal subunit
GO:0030529intracellular ribonucleoprotein complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR005721Ribosomal protein L22/L17, eukaryotic/archaealTIGRFAMTIGR01038TIGR01038coord: 4..153
e-value: 1.5E-56
score: 188.4
IPR005721Ribosomal protein L22/L17, eukaryotic/archaealPANTHERPTHR1159360S RIBOSOMAL PROTEIN L17coord: 4..181
IPR036394Ribosomal protein L22/L17 superfamilyGENE3DG3DSA:3.90.470.10coord: 1..185
e-value: 4.4E-76
score: 256.6
IPR036394Ribosomal protein L22/L17 superfamilySUPERFAMILYSSF54843Ribosomal protein L22coord: 2..153
IPR001063Ribosomal protein L22/L17PFAMPF00237Ribosomal_L22coord: 20..150
e-value: 3.5E-39
score: 133.2
IPR001063Ribosomal protein L22/L17CDDcd00336Ribosomal_L22coord: 15..150
e-value: 2.30829E-36
score: 120.288
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 161..185
IPR018260Ribosomal protein L22/L17, conserved sitePROSITEPS00464RIBOSOMAL_L22coord: 126..150