Protein SCAI

Overview
NameProtein SCAI
Smed IDSMED30011974
Length (bp)1592
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein SCAI (SMED30011974) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein SCAI (SMED30011974) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein SCAI (SMED30011974) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein SCAI (SMED30011974) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011974

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30011974h1SMcG0010711 SmedASXL_014453SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30011974h1SMcG0010711 SmedASXL_014453SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
posterior sideSMED30011974h1SMcG0010711 dd_Smed_v4_12456_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30011974h1SMcG0010711 dd_Smed_v4_12456_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein SCAI vs. Ensembl Human
Match: SCAI (suppressor of cancer cell invasion [Source:HGNC Symbol;Acc:HGNC:26709])

HSP 1 Score: 77.411 bits (189), Expect = 2.216e-14
Identity = 77/320 (24.06%), Postives = 134/320 (41.88%), Query Frame = 2
Query:  467 AVIVGSCAGQPSYRGFTADMLRMWIALEYKP-NPAPD-HKLGGDHTIPKNCRKWT----FCYESIFDVSITINDAT-HNMSKRGIFLLYVSA------DRFHLDQSHNINSTIIMNNRFGLKMKQSPDPKVKHPDEECMLPIDIQSFIVVPTVLIIDSSVS---SHFLQIKDQTKXXXXXXXXXXXXXNQFVKHEMKIGKLFTLFLTCPIIAFVIICGHLDTNVQTFKELERIFTRFANAVESDLW--RISDEKLRLFMGDPFCRSLIVRYLFCNISLRLHCEFPVDGYLPKCNLIEVESTIVNDKRFQNFIYSMATVVN 1372
            A+I+G+C  Q  +   T DM RM  ALE +P N A   +K G   +  K  R+        Y+  F    T   A+   +    + L+Y+SA       R   +  ++    +  +NR  +           H +  C+ P D+  F   P  +I+DSS S    +F  +  Q     L  L       + ++ + + G LFTLFL  P++AF+ + G        +++ +    +    +   L   R  D+    F GD F R L+ R++FC+ ++R+H  F      P+          V +   Q  I  +A++++
Sbjct:  301 ALIIGNCNNQVKFSELTVDMFRMLQALEREPMNLASQMNKPGMQESADKPTRRENPHKYLLYKPTFSQLYTFLAASFKELPANSVLLIYLSATGVFPTGRSDSEGPYDFGGVLTNSNRDIINGDAIHKRNQSHKEMHCLHPGDLYPFTRKPLFIIVDSSNSVAYKNFTNLFGQP----LVCLLSPTAYPKALQDQSQRGSLFTLFLNNPLMAFLFVSGLSSMRRGLWEKCQEYLRKINRDIAQLLTHSRSIDQAFLQFFGDEFLRLLLTRFIFCSATMRMHKIFRETRNYPESYPQLPRDETVENPHLQKHILELASILD 616          
BLAST of Protein SCAI vs. Ensembl Human
Match: SCAI (suppressor of cancer cell invasion [Source:HGNC Symbol;Acc:HGNC:26709])

HSP 1 Score: 77.411 bits (189), Expect = 2.575e-14
Identity = 77/320 (24.06%), Postives = 134/320 (41.88%), Query Frame = 2
Query:  467 AVIVGSCAGQPSYRGFTADMLRMWIALEYKP-NPAPD-HKLGGDHTIPKNCRKWT----FCYESIFDVSITINDAT-HNMSKRGIFLLYVSA------DRFHLDQSHNINSTIIMNNRFGLKMKQSPDPKVKHPDEECMLPIDIQSFIVVPTVLIIDSSVS---SHFLQIKDQTKXXXXXXXXXXXXXNQFVKHEMKIGKLFTLFLTCPIIAFVIICGHLDTNVQTFKELERIFTRFANAVESDLW--RISDEKLRLFMGDPFCRSLIVRYLFCNISLRLHCEFPVDGYLPKCNLIEVESTIVNDKRFQNFIYSMATVVN 1372
            A+I+G+C  Q  +   T DM RM  ALE +P N A   +K G   +  K  R+        Y+  F    T   A+   +    + L+Y+SA       R   +  ++    +  +NR  +           H +  C+ P D+  F   P  +I+DSS S    +F  +  Q     L  L       + ++ + + G LFTLFL  P++AF+ + G        +++ +    +    +   L   R  D+    F GD F R L+ R++FC+ ++R+H  F      P+          V +   Q  I  +A++++
Sbjct:  278 ALIIGNCNNQVKFSELTVDMFRMLQALEREPMNLASQMNKPGMQESADKPTRRENPHKYLLYKPTFSQLYTFLAASFKELPANSVLLIYLSATGVFPTGRSDSEGPYDFGGVLTNSNRDIINGDAIHKRNQSHKEMHCLHPGDLYPFTRKPLFIIVDSSNSVAYKNFTNLFGQP----LVCLLSPTAYPKALQDQSQRGSLFTLFLNNPLMAFLFVSGLSSMRRGLWEKCQEYLRKINRDIAQLLTHSRSIDQAFLQFFGDEFLRLLLTRFIFCSATMRMHKIFRETRNYPESYPQLPRDETVENPHLQKHILELASILD 593          
BLAST of Protein SCAI vs. Ensembl Fly
Match: CG13293 (gene:FBgn0035677 transcript:FBtr0332062)

HSP 1 Score: 82.4185 bits (202), Expect = 3.032e-16
Identity = 91/357 (25.49%), Postives = 140/357 (39.22%), Query Frame = 2
Query:  470 VIVGSCAGQPSYRGFTADMLRMWIALEYKP-----NP-APDHKLGGDHTIPKNCR------------------------KWTFCYESIFDVSITINDATHNMSKRGIFLLYVSAD------RFHLDQSHNINSTIIMNNRFGLKMKQSPDPKVKHPDEECMLPIDIQSFIVVPTVLIIDSSVSSHFLQIKDQTKXXXXXXXXXXXXXNQFVKHEMKIGKLFTLFLTCPIIAFVIICGHLDTNV------QTF-----KELERIFTRFA-NAVESDLWRISDEKLRLFMGDPFCRSLIVRYLFCNISLRLHCEFPVDGYLPKCNLIEVESTIVNDKRFQNFIYSMATVVNSSGKFASA 1396
            +IVGS   Q  +   T DM RM   LE +P     NP +  H L G    P   R                        K+     SI  + + +   +  +   G  LLY+SAD      +   D  + +        R  +           + +  C+ P D+  F   P  ++IDS  S  F  I      P++ L+SP  +P  F       G LFTLFL  P+ A   IC   D  +      QT+      E  R+ TR   + +E  +  I D     F GD F R+LI+R++FC++ LRLH  F      P+C      + ++      + I+ +A+ ++  G F+  
Sbjct:  235 LIVGSACEQAKFSELTMDMFRMLQTLEREPTESTTNPLSMAHGLHGHDASPAASRIPPYGVPGSKGYMENGRAFRDNPHKYLLYKPSISQLLVFLASGSKELPLGGALLLYMSADGCFSTTKHPEDFGYELGGLATSVKRDSVDGGGLSCRGKSYKENHCLYPGDLYPFTRRPMFVVIDSDNSFVFQHIPRYFGQPLVVLMSPQDVPPAFQADVQHHGSLFTLFLHSPLTALCYICNVGDVPIHHWERCQTYVDRFITEASRLVTRCRIDEIEQGIGFI-DSSYVQFFGDDFLRTLILRFVFCDVVLRLHRGFRGRHMRPRCEPQLPANELLEHPSLSHIIFQLASALDVRGHFSEG 590          
BLAST of Protein SCAI vs. Ensembl Fly
Match: CG13293 (gene:FBgn0035677 transcript:FBtr0332064)

HSP 1 Score: 82.0333 bits (201), Expect = 3.555e-16
Identity = 91/357 (25.49%), Postives = 140/357 (39.22%), Query Frame = 2
Query:  470 VIVGSCAGQPSYRGFTADMLRMWIALEYKP-----NP-APDHKLGGDHTIPKNCR------------------------KWTFCYESIFDVSITINDATHNMSKRGIFLLYVSAD------RFHLDQSHNINSTIIMNNRFGLKMKQSPDPKVKHPDEECMLPIDIQSFIVVPTVLIIDSSVSSHFLQIKDQTKXXXXXXXXXXXXXNQFVKHEMKIGKLFTLFLTCPIIAFVIICGHLDTNV------QTF-----KELERIFTRFA-NAVESDLWRISDEKLRLFMGDPFCRSLIVRYLFCNISLRLHCEFPVDGYLPKCNLIEVESTIVNDKRFQNFIYSMATVVNSSGKFASA 1396
            +IVGS   Q  +   T DM RM   LE +P     NP +  H L G    P   R                        K+     SI  + + +   +  +   G  LLY+SAD      +   D  + +        R  +           + +  C+ P D+  F   P  ++IDS  S  F  I      P++ L+SP  +P  F       G LFTLFL  P+ A   IC   D  +      QT+      E  R+ TR   + +E  +  I D     F GD F R+LI+R++FC++ LRLH  F      P+C      + ++      + I+ +A+ ++  G F+  
Sbjct:  240 LIVGSACEQAKFSELTMDMFRMLQTLEREPTESTTNPLSMAHGLHGHDASPAASRIPPYGVPGSKGYMENGRAFRDNPHKYLLYKPSISQLLVFLASGSKELPLGGALLLYMSADGCFSTTKHPEDFGYELGGLATSVKRDSVDGGGLSCRGKSYKENHCLYPGDLYPFTRRPMFVVIDSDNSFVFQHIPRYFGQPLVVLMSPQDVPPAFQADVQHHGSLFTLFLHSPLTALCYICNVGDVPIHHWERCQTYVDRFITEASRLVTRCRIDEIEQGIGFI-DSSYVQFFGDDFLRTLILRFVFCDVVLRLHRGFRGRHMRPRCEPQLPANELLEHPSLSHIIFQLASALDVRGHFSEG 595          
BLAST of Protein SCAI vs. Ensembl Fly
Match: CG13293 (gene:FBgn0035677 transcript:FBtr0332061)

HSP 1 Score: 82.0333 bits (201), Expect = 3.555e-16
Identity = 91/357 (25.49%), Postives = 140/357 (39.22%), Query Frame = 2
Query:  470 VIVGSCAGQPSYRGFTADMLRMWIALEYKP-----NP-APDHKLGGDHTIPKNCR------------------------KWTFCYESIFDVSITINDATHNMSKRGIFLLYVSAD------RFHLDQSHNINSTIIMNNRFGLKMKQSPDPKVKHPDEECMLPIDIQSFIVVPTVLIIDSSVSSHFLQIKDQTKXXXXXXXXXXXXXNQFVKHEMKIGKLFTLFLTCPIIAFVIICGHLDTNV------QTF-----KELERIFTRFA-NAVESDLWRISDEKLRLFMGDPFCRSLIVRYLFCNISLRLHCEFPVDGYLPKCNLIEVESTIVNDKRFQNFIYSMATVVNSSGKFASA 1396
            +IVGS   Q  +   T DM RM   LE +P     NP +  H L G    P   R                        K+     SI  + + +   +  +   G  LLY+SAD      +   D  + +        R  +           + +  C+ P D+  F   P  ++IDS  S  F  I      P++ L+SP  +P  F       G LFTLFL  P+ A   IC   D  +      QT+      E  R+ TR   + +E  +  I D     F GD F R+LI+R++FC++ LRLH  F      P+C      + ++      + I+ +A+ ++  G F+  
Sbjct:  240 LIVGSACEQAKFSELTMDMFRMLQTLEREPTESTTNPLSMAHGLHGHDASPAASRIPPYGVPGSKGYMENGRAFRDNPHKYLLYKPSISQLLVFLASGSKELPLGGALLLYMSADGCFSTTKHPEDFGYELGGLATSVKRDSVDGGGLSCRGKSYKENHCLYPGDLYPFTRRPMFVVIDSDNSFVFQHIPRYFGQPLVVLMSPQDVPPAFQADVQHHGSLFTLFLHSPLTALCYICNVGDVPIHHWERCQTYVDRFITEASRLVTRCRIDEIEQGIGFI-DSSYVQFFGDDFLRTLILRFVFCDVVLRLHRGFRGRHMRPRCEPQLPANELLEHPSLSHIIFQLASALDVRGHFSEG 595          
BLAST of Protein SCAI vs. Ensembl Fly
Match: CG13293 (gene:FBgn0035677 transcript:FBtr0332063)

HSP 1 Score: 82.0333 bits (201), Expect = 3.555e-16
Identity = 91/357 (25.49%), Postives = 140/357 (39.22%), Query Frame = 2
Query:  470 VIVGSCAGQPSYRGFTADMLRMWIALEYKP-----NP-APDHKLGGDHTIPKNCR------------------------KWTFCYESIFDVSITINDATHNMSKRGIFLLYVSAD------RFHLDQSHNINSTIIMNNRFGLKMKQSPDPKVKHPDEECMLPIDIQSFIVVPTVLIIDSSVSSHFLQIKDQTKXXXXXXXXXXXXXNQFVKHEMKIGKLFTLFLTCPIIAFVIICGHLDTNV------QTF-----KELERIFTRFA-NAVESDLWRISDEKLRLFMGDPFCRSLIVRYLFCNISLRLHCEFPVDGYLPKCNLIEVESTIVNDKRFQNFIYSMATVVNSSGKFASA 1396
            +IVGS   Q  +   T DM RM   LE +P     NP +  H L G    P   R                        K+     SI  + + +   +  +   G  LLY+SAD      +   D  + +        R  +           + +  C+ P D+  F   P  ++IDS  S  F  I      P++ L+SP  +P  F       G LFTLFL  P+ A   IC   D  +      QT+      E  R+ TR   + +E  +  I D     F GD F R+LI+R++FC++ LRLH  F      P+C      + ++      + I+ +A+ ++  G F+  
Sbjct:  240 LIVGSACEQAKFSELTMDMFRMLQTLEREPTESTTNPLSMAHGLHGHDASPAASRIPPYGVPGSKGYMENGRAFRDNPHKYLLYKPSISQLLVFLASGSKELPLGGALLLYMSADGCFSTTKHPEDFGYELGGLATSVKRDSVDGGGLSCRGKSYKENHCLYPGDLYPFTRRPMFVVIDSDNSFVFQHIPRYFGQPLVVLMSPQDVPPAFQADVQHHGSLFTLFLHSPLTALCYICNVGDVPIHHWERCQTYVDRFITEASRLVTRCRIDEIEQGIGFI-DSSYVQFFGDDFLRTLILRFVFCDVVLRLHRGFRGRHMRPRCEPQLPANELLEHPSLSHIIFQLASALDVRGHFSEG 595          
BLAST of Protein SCAI vs. Ensembl Zebrafish
Match: scai (suppressor of cancer cell invasion [Source:ZFIN;Acc:ZDB-GENE-060526-57])

HSP 1 Score: 80.1073 bits (196), Expect = 1.875e-15
Identity = 84/334 (25.15%), Postives = 144/334 (43.11%), Query Frame = 2
Query:  467 AVIVGSCAGQPSYRGFTADMLRMWIALEYKP-NPAPDHKLGGDHTIPKNCRKWT-------FCYESIFDVSITINDAT-HNMSKRGIFLLYVSA------DRFHLDQSHNINSTIIMNNRFGLKMKQSPDPKVKHPDEECMLPIDIQSFIVVPTVLIIDSSVSSHFLQIKDQTKXXXXXXXXXXXXXNQFVKHEMKIGKLFTLFLTCPIIAFVIICGHLDTNVQTFKE----LERIFTRFANAVESDLWRISDEKLRLFMGDPFCRSLIVRYLFCNISLRLHCEFPVDGYLPKCNLIEVESTIVNDKRFQNFIYSMATVVNSSGKFASASHTGY 1411
            A+IVG+C  Q  +   T DM RM  ALE +P N A      G  T+  N +            Y+  F    T   A+   +    + L+Y+SA       R   +  ++    +   NR  +  +          +  C+ P D+  F   P  +I+DSS S+ +    +    P++CLLSP + P   ++ + + G LFTLFL  P++ F+ +CG        +++    L ++F      + S   R+ D+    F GD F R L++R++FC+ +LRLH  F      P+      +  +V     Q  +  +A +++    F+      Y
Sbjct:  237 ALIVGNCNNQVKFSELTIDMFRMLQALEREPVNLATQSSKPG--TLEPNEKPAKRENPHKYLLYKPTFSQLYTFLSASFKELPANSVLLVYLSATGVFPTGRSESEGPYDFGGVLTNTNRDVVNGETVQKRNQAQKEMHCLHPGDLFPFTRKPLFIIVDSSNSTAYKNFSNLFGQPLVCLLSPTVYPKS-MQDQSQRGSLFTLFLYNPLMGFLSVCGLSSMRYGLWEKAQELLRKVFHDIGQMITSS--RVIDQAYLQFYGDEFLRLLMIRFVFCSSALRLHKLFREARSFPESYPPLPKQEMVESSLLQKHVLELAAMLDVQNLFSDGMLDNY 565          
BLAST of Protein SCAI vs. Ensembl Zebrafish
Match: scai (suppressor of cancer cell invasion [Source:ZFIN;Acc:ZDB-GENE-060526-57])

HSP 1 Score: 68.9366 bits (167), Expect = 7.718e-12
Identity = 79/328 (24.09%), Postives = 137/328 (41.77%), Query Frame = 2
Query:  485 CAGQPSYRGFTADMLRMWIALEYKP-NPAPDHKLGGDHTIPKNCRKWT-------FCYESIFDVSITINDAT-HNMSKRGIFLLYVSA------DRFHLDQSHNINSTIIMNNRFGLKMKQSPDPKVKHPDEECMLPIDIQSFIVVPTVLIIDSSVSSHFLQIKDQTKXXXXXXXXXXXXXNQFVKHEMKIGKLFTLFLTCPIIAFVIICGHLDTNVQTFKE----LERIFTRFANAVESDLWRISDEKLRLFMGDPFCRSLIVRYLFCNISLRLHCEFPVDGYLPKCNLIEVESTIVNDKRFQNFIYSMATVVNSSGKFASASHTGY 1411
            C     +   T DM RM  ALE +P N A      G  T+  N +            Y+  F    T   A+   +    + L+Y+SA       R   +  ++    +   NR  +  +          +  C+ P D+  F   P  +I+DSS S+ +    +    P++CLLSP + P   ++ + + G LFTLFL  P++ F+ +CG        +++    L ++F      + S   R+ D+    F GD F R L++R++FC+ +LRLH  F      P+      +  +V     Q  +  +A +++    F+      Y
Sbjct:  266 CNDWVKFSELTIDMFRMLQALEREPVNLATQSSKPG--TLEPNEKPAKRENPHKYLLYKPTFSQLYTFLSASFKELPANSVLLVYLSATGVFPTGRSESEGPYDFGGVLTNTNRDVVNGETVQKRNQAQKEMHCLHPGDLFPFTRKPLFIIVDSSNSTAYKNFSNLFGQPLVCLLSPTVYPKS-MQDQSQRGSLFTLFLYNPLMGFLSVCGLSSMRYGLWEKAQELLRKVFHDIGQMITSS--RVIDQAYLQFYGDEFLRLLMIRFVFCSSALRLHKLFREARSFPESYPPLPKQEMVESSLLQKHVLELAAMLDVQNLFSDGMLDNY 588          
BLAST of Protein SCAI vs. Ensembl Zebrafish
Match: scai (suppressor of cancer cell invasion [Source:ZFIN;Acc:ZDB-GENE-060526-57])

HSP 1 Score: 68.5514 bits (166), Expect = 9.089e-12
Identity = 79/328 (24.09%), Postives = 137/328 (41.77%), Query Frame = 2
Query:  485 CAGQPSYRGFTADMLRMWIALEYKP-NPAPDHKLGGDHTIPKNCRKWT-------FCYESIFDVSITINDAT-HNMSKRGIFLLYVSA------DRFHLDQSHNINSTIIMNNRFGLKMKQSPDPKVKHPDEECMLPIDIQSFIVVPTVLIIDSSVSSHFLQIKDQTKXXXXXXXXXXXXXNQFVKHEMKIGKLFTLFLTCPIIAFVIICGHLDTNVQTFKE----LERIFTRFANAVESDLWRISDEKLRLFMGDPFCRSLIVRYLFCNISLRLHCEFPVDGYLPKCNLIEVESTIVNDKRFQNFIYSMATVVNSSGKFASASHTGY 1411
            C     +   T DM RM  ALE +P N A      G  T+  N +            Y+  F    T   A+   +    + L+Y+SA       R   +  ++    +   NR  +  +          +  C+ P D+  F   P  +I+DSS S+ +    +    P++CLLSP + P   ++ + + G LFTLFL  P++ F+ +CG        +++    L ++F      + S   R+ D+    F GD F R L++R++FC+ +LRLH  F      P+      +  +V     Q  +  +A +++    F+      Y
Sbjct:  252 CNDWVKFSELTIDMFRMLQALEREPVNLATQSSKPG--TLEPNEKPAKRENPHKYLLYKPTFSQLYTFLSASFKELPANSVLLVYLSATGVFPTGRSESEGPYDFGGVLTNTNRDVVNGETVQKRNQAQKEMHCLHPGDLFPFTRKPLFIIVDSSNSTAYKNFSNLFGQPLVCLLSPTVYPKS-MQDQSQRGSLFTLFLYNPLMGFLSVCGLSSMRYGLWEKAQELLRKVFHDIGQMITSS--RVIDQAYLQFYGDEFLRLLMIRFVFCSSALRLHKLFREARSFPESYPPLPKQEMVESSLLQKHVLELAAMLDVQNLFSDGMLDNY 574          
BLAST of Protein SCAI vs. Ensembl Zebrafish
Match: scai (suppressor of cancer cell invasion [Source:ZFIN;Acc:ZDB-GENE-060526-57])

HSP 1 Score: 68.5514 bits (166), Expect = 9.518e-12
Identity = 79/328 (24.09%), Postives = 137/328 (41.77%), Query Frame = 2
Query:  485 CAGQPSYRGFTADMLRMWIALEYKP-NPAPDHKLGGDHTIPKNCRKWT-------FCYESIFDVSITINDAT-HNMSKRGIFLLYVSA------DRFHLDQSHNINSTIIMNNRFGLKMKQSPDPKVKHPDEECMLPIDIQSFIVVPTVLIIDSSVSSHFLQIKDQTKXXXXXXXXXXXXXNQFVKHEMKIGKLFTLFLTCPIIAFVIICGHLDTNVQTFKE----LERIFTRFANAVESDLWRISDEKLRLFMGDPFCRSLIVRYLFCNISLRLHCEFPVDGYLPKCNLIEVESTIVNDKRFQNFIYSMATVVNSSGKFASASHTGY 1411
            C     +   T DM RM  ALE +P N A      G  T+  N +            Y+  F    T   A+   +    + L+Y+SA       R   +  ++    +   NR  +  +          +  C+ P D+  F   P  +I+DSS S+ +    +    P++CLLSP + P   ++ + + G LFTLFL  P++ F+ +CG        +++    L ++F      + S   R+ D+    F GD F R L++R++FC+ +LRLH  F      P+      +  +V     Q  +  +A +++    F+      Y
Sbjct:  286 CNDWVKFSELTIDMFRMLQALEREPVNLATQSSKPG--TLEPNEKPAKRENPHKYLLYKPTFSQLYTFLSASFKELPANSVLLVYLSATGVFPTGRSESEGPYDFGGVLTNTNRDVVNGETVQKRNQAQKEMHCLHPGDLFPFTRKPLFIIVDSSNSTAYKNFSNLFGQPLVCLLSPTVYPKS-MQDQSQRGSLFTLFLYNPLMGFLSVCGLSSMRYGLWEKAQELLRKVFHDIGQMITSS--RVIDQAYLQFYGDEFLRLLMIRFVFCSSALRLHKLFREARSFPESYPPLPKQEMVESSLLQKHVLELAAMLDVQNLFSDGMLDNY 608          
BLAST of Protein SCAI vs. Ensembl Xenopus
Match: SCAI (suppressor of cancer cell invasion [Source:NCBI gene;Acc:100493243])

HSP 1 Score: 73.1738 bits (178), Expect = 4.493e-13
Identity = 81/331 (24.47%), Postives = 138/331 (41.69%), Query Frame = 2
Query:  467 AVIVGSCAGQPSYRGFTADMLRMWIALEYKPNP------APDHKLGGDHTIPKNCRKWTFCYESIFDVSITINDAT-HNMSKRGIFLLYVSA------DRFHLDQSHNINSTIIMNNRFGLKMKQSPDPKVKHPDEECMLPIDIQSFIVVPTVLIIDSSVSSHFLQIKDQTKXXXXXXXXXXXXXNQFVKHEMKIGKLFTLFLTCPIIAFVIICGHLDTNVQTFKELERIFTRFANAVESDLW---RISDEKLRLFMGDPFCRSLIVRYLFCNISLRLHCEFPVDGYLPKCNLIEVESTIVNDKRFQNFIYSMATVVNSSGKFASASHTGY 1411
            A+I+G+C  Q  +   T DM RM  ALE +P         P  +   +  + +        Y+  F    T   A+   +      L+Y+SA       R   +  ++    +  +NR  +           + +  C+ P D+  F   P  +I+DSS S  +    +    P++CLLSP   P     H  + G LFTLFL  P++AF+ + G L +  +   E  +   R  N   + L    R  D+    F GD F R L+ R++FC+ +LR+H  F      P+         +V +   Q  I  +A++++    +  ++   Y
Sbjct:  236 ALIIGNCNNQVKFSELTIDMFRMLQALEREPMNLTSQMNKPGLQDPAEKPMKRENPHKYLLYKPTFSQLYTFLAASFKELPANSALLIYLSATGVFPTGRSDYEGPYDFGGVLTNSNRDVVNGDAVHKRNQSYKEMHCLHPGDLYPFTRKPLFIIVDSSNSVAYKNFTNLFGQPLVCLLSPTAYPKALQDHSQR-GSLFTLFLKKPLMAFLFVSG-LSSMRKGLWEKCQDHVRKINRDIAQLLTHSRSIDQAFLQFFGDEFLRLLLTRFIFCSATLRMHKSFRETRNYPETYPPLPRDELVENLHLQKQILELASILDVRNLYLESTMDEY 564          
BLAST of Protein SCAI vs. Ensembl Mouse
Match: Scai (suppressor of cancer cell invasion [Source:MGI Symbol;Acc:MGI:2443716])

HSP 1 Score: 76.6406 bits (187), Expect = 2.718e-14
Identity = 79/333 (23.72%), Postives = 136/333 (40.84%), Query Frame = 2
Query:  467 AVIVGSCAGQPSYRGFTADMLRMWIALEYKP-NPAPD-HKLGGDHTIPKNCRKWT----FCYESIFDVSITINDAT-HNMSKRGIFLLYVSA------DRFHLDQSHNINSTIIMNNRFGLKMKQSPDPKVKHPDEECMLPIDIQSFIVVPTVLIIDSSVS---SHFLQIKDQTKXXXXXXXXXXXXXNQFVKHEMKIGKLFTLFLTCPIIAFVIICGHLDTNVQTFKELERIFTRFANAVESDLW--RISDEKLRLFMGDPFCRSLIVRYLFCNISLRLHCEFPVDGYLPKCNLIEVESTIVNDKRFQNFIYSMATVVNSSGKFASASHTGY 1411
            A+I+G+C  Q  +   T DM RM  ALE +P N A   +K G      K  R+        Y+  F    T   A+   +    + L+Y+SA       R   +  ++    +  +NR  +           H +  C+ P D+  F   P  +++DSS S    +F  +  Q     L  L       + ++ + + G LFTLFL  P++AF+ + G        +++ +    +    +   L   R  D+    F GD F R L+ R++FC+ ++R+H  F      P+          V +   Q  I  +A++++    F   S   Y
Sbjct:  278 ALIIGNCNNQVKFSELTVDMFRMLQALEREPMNLASQMNKPGIQEPADKPTRRENPHKYLLYKPTFSQLYTFLAASFKELPANSVLLIYLSATGVFPTGRSDGEGPYDFGGVLTNSNRDIINGDAIHKRNQSHKEMHCLHPGDLYPFTRKPLFIVVDSSNSVAYKNFTNLFGQP----LVCLLSPTAYPKALQDQSQRGSLFTLFLNNPLMAFLFVSGLSSMRRGLWEKCQEYLRKINRDIAQLLTHSRSIDQAFLQFFGDEFLRLLLTRFVFCSATMRMHKAFRETRNYPESYPQLPRDETVENPHLQKHILELASILDVRNIFFENSMDDY 606          
BLAST of Protein SCAI vs. UniProt/SwissProt
Match: sp|Q8N9R8|SCAI_HUMAN (Protein SCAI OS=Homo sapiens OX=9606 GN=SCAI PE=1 SV=2)

HSP 1 Score: 77.411 bits (189), Expect = 1.237e-13
Identity = 77/320 (24.06%), Postives = 134/320 (41.88%), Query Frame = 2
Query:  467 AVIVGSCAGQPSYRGFTADMLRMWIALEYKP-NPAPD-HKLGGDHTIPKNCRKWT----FCYESIFDVSITINDAT-HNMSKRGIFLLYVSA------DRFHLDQSHNINSTIIMNNRFGLKMKQSPDPKVKHPDEECMLPIDIQSFIVVPTVLIIDSSVS---SHFLQIKDQTKXXXXXXXXXXXXXNQFVKHEMKIGKLFTLFLTCPIIAFVIICGHLDTNVQTFKELERIFTRFANAVESDLW--RISDEKLRLFMGDPFCRSLIVRYLFCNISLRLHCEFPVDGYLPKCNLIEVESTIVNDKRFQNFIYSMATVVN 1372
            A+I+G+C  Q  +   T DM RM  ALE +P N A   +K G   +  K  R+        Y+  F    T   A+   +    + L+Y+SA       R   +  ++    +  +NR  +           H +  C+ P D+  F   P  +I+DSS S    +F  +  Q     L  L       + ++ + + G LFTLFL  P++AF+ + G        +++ +    +    +   L   R  D+    F GD F R L+ R++FC+ ++R+H  F      P+          V +   Q  I  +A++++
Sbjct:  278 ALIIGNCNNQVKFSELTVDMFRMLQALEREPMNLASQMNKPGMQESADKPTRRENPHKYLLYKPTFSQLYTFLAASFKELPANSVLLIYLSATGVFPTGRSDSEGPYDFGGVLTNSNRDIINGDAIHKRNQSHKEMHCLHPGDLYPFTRKPLFIIVDSSNSVAYKNFTNLFGQP----LVCLLSPTAYPKALQDQSQRGSLFTLFLNNPLMAFLFVSGLSSMRRGLWEKCQEYLRKINRDIAQLLTHSRSIDQAFLQFFGDEFLRLLLTRFIFCSATMRMHKIFRETRNYPESYPQLPRDETVENPHLQKHILELASILD 593          
BLAST of Protein SCAI vs. UniProt/SwissProt
Match: sp|Q8C8N2|SCAI_MOUSE (Protein SCAI OS=Mus musculus OX=10090 GN=Scai PE=1 SV=2)

HSP 1 Score: 76.6406 bits (187), Expect = 1.901e-13
Identity = 79/333 (23.72%), Postives = 136/333 (40.84%), Query Frame = 2
Query:  467 AVIVGSCAGQPSYRGFTADMLRMWIALEYKP-NPAPD-HKLGGDHTIPKNCRKWT----FCYESIFDVSITINDAT-HNMSKRGIFLLYVSA------DRFHLDQSHNINSTIIMNNRFGLKMKQSPDPKVKHPDEECMLPIDIQSFIVVPTVLIIDSSVS---SHFLQIKDQTKXXXXXXXXXXXXXNQFVKHEMKIGKLFTLFLTCPIIAFVIICGHLDTNVQTFKELERIFTRFANAVESDLW--RISDEKLRLFMGDPFCRSLIVRYLFCNISLRLHCEFPVDGYLPKCNLIEVESTIVNDKRFQNFIYSMATVVNSSGKFASASHTGY 1411
            A+I+G+C  Q  +   T DM RM  ALE +P N A   +K G      K  R+        Y+  F    T   A+   +    + L+Y+SA       R   +  ++    +  +NR  +           H +  C+ P D+  F   P  +++DSS S    +F  +  Q     L  L       + ++ + + G LFTLFL  P++AF+ + G        +++ +    +    +   L   R  D+    F GD F R L+ R++FC+ ++R+H  F      P+          V +   Q  I  +A++++    F   S   Y
Sbjct:  278 ALIIGNCNNQVKFSELTVDMFRMLQALEREPMNLASQMNKPGIQEPADKPTRRENPHKYLLYKPTFSQLYTFLAASFKELPANSVLLIYLSATGVFPTGRSDGEGPYDFGGVLTNSNRDIINGDAIHKRNQSHKEMHCLHPGDLYPFTRKPLFIVVDSSNSVAYKNFTNLFGQP----LVCLLSPTAYPKALQDQSQRGSLFTLFLNNPLMAFLFVSGLSSMRRGLWEKCQEYLRKINRDIAQLLTHSRSIDQAFLQFFGDEFLRLLLTRFVFCSATMRMHKAFRETRNYPESYPQLPRDETVENPHLQKHILELASILDVRNIFFENSMDDY 606          
BLAST of Protein SCAI vs. UniProt/SwissProt
Match: sp|Q54YY1|SCAI_DICDI (Protein SCAI homolog OS=Dictyostelium discoideum OX=44689 GN=scai PE=3 SV=1)

HSP 1 Score: 53.1434 bits (126), Expect = 5.759e-6
Identity = 51/187 (27.27%), Postives = 84/187 (44.92%), Query Frame = 2
Query:  836 ECMLPIDIQSFIVVPTVLIIDSSVSSHFLQIKDQTKXXXXXXXXXXXXXNQFVKHEMKIGKLFTLFLTCPIIAFV-IICGHLDTNVQTFKELERIFTRFANAVESDLWRISD--EKLRLFMGDPFCRSLIVRYLFCNISLRLHCEFPVDGYLPKCNLIEVESTIVNDKRFQNFIYSMATVVNSSGKF 1387
            E + P+D+  F   P  LI++S  S  F ++   T       L       + +   +K G LFT FL  PI AF  I CG+     +TF  +  +       +   L+   D       F+ D F RS I+R++FC+ +  LH EF  + Y  K N    +S + N    ++ I+ + + ++ S +F
Sbjct:  578 ESLYPMDLLPFCRKPFFLIVNSQSSDIFNELP--TFNQPFVSLLSPQSIPKKLVSNLKCGNLFTFFLHDPISAFCDISCGN-KIPSKTFNNISLLAQNSLEIISKLLFECVDLHPSFSFFLLDDFLRSFIIRFIFCHATFYLHKEFQDNIYQVKSNPPLPKSLLYNQSILKS-IHQLVSELDVSDQF 760          
BLAST of Protein SCAI vs. TrEMBL
Match: A0A077ZIP8 (Protein SCAI OS=Trichuris trichiura OX=36087 GN=TTRE_0000863101 PE=4 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 1.646e-19
Identity = 91/297 (30.64%), Postives = 139/297 (46.80%), Query Frame = 2
Query:  467 AVIVGSCAGQPSYRGFTADMLRMWIALEYK-------------PNPAPDHKLGG-DHTIPKNCRKWTFCYESIFDVSIT-INDATHNMSKRGIFLLYVSADRFHLDQSHNINST----IIMNNRFGLKMKQSPDPKVKHP--DEECMLPIDIQSFIVVPTVLIIDSSVSSHFLQIKDQTKXXXXXXXXXXXXXNQFVKHEMKIGKLFTLFLTCPIIAFVIICGHLDTNVQTFKELERIFTRFANAVESDLWR--ISDEKLRLFMGDPFCRSLIVRYLFCNISLRLHCEFPVD-GYLP 1285
            AVIVGS + Q ++  FT DM  M   LE +              +PAP       D    +N RK +  Y+  FD  +  +  +   ++   I LLY+SAD          + T    +++N  FG  M+   +P +     D +C+ P D++ F   P +LI+DSS S  FL I+ Q   P+  L SP  +  +F++   + G LFTLFL CP+ A+  IC      +  + + +    +F       L R  + D   R F  D F R +I+R+LFC  +LR+H  F  +  YLP
Sbjct:  149 AVIVGSNSSQVTFGEFTLDMYWMLQVLEREIEEDLSYSNHRLDSSPAPGKSFNTVDEYYNENPRK-SLLYKPTFDQFLKYLYRSYEELAPYRILLLYLSADATQGATQTRSDRTWCGGLVLNGGFGQNMRDLAEPSMTDACADVQCLYPGDLRLFFRKPIMLIVDSSSSDAFLNIESQFGQPVAVLCSPVEM-PKFLQGRPQRGSLFTLFLHCPLTAYCFICNISRLPLSLWDKCQAQVEKFYAEASKLLLRSKLVDLSYRAFYSDMFLRVMILRFLFCQCTLRMHRSFRDNPKYLP 443          
BLAST of Protein SCAI vs. TrEMBL
Match: E2AJZ7 (Uncharacterized protein C9orf126-like protein OS=Camponotus floridanus OX=104421 GN=EAG_10150 PE=4 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 2.951e-18
Identity = 88/337 (26.11%), Postives = 145/337 (43.03%), Query Frame = 2
Query:  470 VIVGSCAGQPSYRGFTADMLRMWIALEYKPNPAPDH----------------KLGGDHTIPK--NCRKWTFCYESIFDVSITINDATHNMSKRGIFLLYVSAD------RFHLDQSHNINSTIIMNNRFGLKMKQSPDPKVKHPDEECMLPIDIQSFIVVPTVLIIDSSVSSHFLQIKDQTKXXXXXXXXXXXXXNQF--VKHEMKIGKLFTLFLTCPIIAFVIICGHLDTNVQTFKELERIFTRFANAVESDLWRISDEKLRL-FMGDPFCRSLIVRYLFCNISLRLHCEFPVDGYLPKCNLIEVESTIVNDKRFQNFIYSMATVVNSSGKFASAS 1399
            +IVG+CA Q  +   + DM RM   LE +P   P+H                  G ++  P+  N  K+     +   V + +      +   G  LLY+SAD      +   +  +++      + R     K+    K  H    C+ P D+  F   P  +++DS  S  F QI      P++ L+SP  +P     ++H    G LFTLFL  P+ AF +IC      VQ ++  +R   RF N     + R   E   L F GD F R L+VRY+FC++ L LH  F      P+C+    ++ ++      + +  +A  +++   F  ++
Sbjct:  235 LIVGNCADQVKFSELSMDMFRMLQTLEREPRDDPNHLHDASPAGRMPFRPGPYPGPENGAPRRDNPHKYLLYRPTYSQVQVFLASGFKELPANGALLLYLSADGCFSTVKHPEEMGYDLGGVSTCSKRDPEHGKRPAGGKEPH----CLYPGDLYPFTRKPLFVVVDSDNSFVFQQIPRYFGQPLMVLMSPQDVPPTLRDLRHG---GSLFTLFLHAPLAAFCLICNVGSLPVQHWERCQRYIERFLNEASQLVTRSRCETSVLQFFGDDFLRLLLVRYVFCDVVLNLHRSFRGRQQRPRCHPPLPDAEVLEHPTLHHLVLDLAACLDARDHFPDSN 564          
BLAST of Protein SCAI vs. TrEMBL
Match: A0A158NNI8 (Uncharacterized protein OS=Atta cephalotes OX=12957 GN=105622287 PE=4 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 3.228e-18
Identity = 88/337 (26.11%), Postives = 145/337 (43.03%), Query Frame = 2
Query:  470 VIVGSCAGQPSYRGFTADMLRMWIALEYKPNPAPDH----------------KLGGDHTIPK--NCRKWTFCYESIFDVSITINDATHNMSKRGIFLLYVSAD------RFHLDQSHNINSTIIMNNRFGLKMKQSPDPKVKHPDEECMLPIDIQSFIVVPTVLIIDSSVSSHFLQIKDQTKXXXXXXXXXXXXXNQF--VKHEMKIGKLFTLFLTCPIIAFVIICGHLDTNVQTFKELERIFTRFANAVESDLWRISDEKLRL-FMGDPFCRSLIVRYLFCNISLRLHCEFPVDGYLPKCNLIEVESTIVNDKRFQNFIYSMATVVNSSGKFASAS 1399
            +IVG+CA Q  +   + DM RM   LE +P   P+H                  G ++  P+  N  K+     +   V + +      +   G  LLY+SAD      +   +  +++      + R     K+    K  H    C+ P D+  F   P  +++DS  S  F QI      P++ L+SP  +P     ++H    G LFTLFL  P+ AF +IC      VQ ++  +R   RF N     + R   E   L F GD F R L+VRY+FC++ L LH  F      P+C+    ++ ++      + +  +A  +++   F  ++
Sbjct:  235 LIVGNCADQVKFSELSMDMFRMLQTLEREPRDDPNHLHDASPAGRMPFRPGPYPGPENGAPRRDNPHKYLLYRPTYSQVQVFLASGFKELPANGALLLYLSADGCFSTVKHPEEMGYDLGGVSTCSKRDPEHGKRPAGGKEPH----CLYPGDLYPFTRKPLFVVVDSDNSFVFQQIPRYFGQPLMVLMSPQDVPPTLRDLRHG---GSLFTLFLHAPLAAFCLICNVGSLPVQHWERCQRYIERFLNEASQLVTRSRCETSVLQFFGDDFLRLLLVRYVFCDVVLNLHRSFRGRQQRPRCHPPLPDAEVLEHPTLHHLVLDLAACLDARDHFPESN 564          
BLAST of Protein SCAI vs. TrEMBL
Match: A0A195F720 (Protein SCAI OS=Trachymyrmex septentrionalis OX=34720 GN=ALC56_09203 PE=4 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 3.228e-18
Identity = 88/337 (26.11%), Postives = 145/337 (43.03%), Query Frame = 2
Query:  470 VIVGSCAGQPSYRGFTADMLRMWIALEYKPNPAPDH----------------KLGGDHTIPK--NCRKWTFCYESIFDVSITINDATHNMSKRGIFLLYVSAD------RFHLDQSHNINSTIIMNNRFGLKMKQSPDPKVKHPDEECMLPIDIQSFIVVPTVLIIDSSVSSHFLQIKDQTKXXXXXXXXXXXXXNQF--VKHEMKIGKLFTLFLTCPIIAFVIICGHLDTNVQTFKELERIFTRFANAVESDLWRISDEKLRL-FMGDPFCRSLIVRYLFCNISLRLHCEFPVDGYLPKCNLIEVESTIVNDKRFQNFIYSMATVVNSSGKFASAS 1399
            +IVG+CA Q  +   + DM RM   LE +P   P+H                  G ++  P+  N  K+     +   V + +      +   G  LLY+SAD      +   +  +++      + R     K+    K  H    C+ P D+  F   P  +++DS  S  F QI      P++ L+SP  +P     ++H    G LFTLFL  P+ AF +IC      VQ ++  +R   RF N     + R   E   L F GD F R L+VRY+FC++ L LH  F      P+C+    ++ ++      + +  +A  +++   F  ++
Sbjct:  235 LIVGNCADQVKFSELSMDMFRMLQTLEREPRDDPNHLHDASPAGRMPFRPGPYPGPENGAPRRDNPHKYLLYRPTYSQVQVFLASGFKELPANGALLLYLSADGCFSTVKHPEEMGYDLGGVSTCSKRDPEHGKRPAGGKEPH----CLYPGDLYPFTRKPLFVVVDSDNSFVFQQIPRYFGQPLMVLMSPQDVPPTLRDLRHG---GSLFTLFLHAPLAAFCLICNVGSLPVQHWERCQRYIERFLNEASQLVTRSRCETSVLQFFGDDFLRLLLVRYVFCDVVLNLHRSFRGRQQRPRCHPPLPDAEVLEHPTLHHLVLDLAACLDARDHFPESN 564          
BLAST of Protein SCAI vs. TrEMBL
Match: A0A4E0S187 (Protein SCAI OS=Fasciola hepatica OX=6192 GN=D915_002863 PE=4 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 6.766e-18
Identity = 95/352 (26.99%), Postives = 141/352 (40.06%), Query Frame = 2
Query:  470 VIVGSCAGQPSYRGFTADMLRMWIALEYKPN-------------------------PAPDHKL------GGDHTIPKNCRKWTFCYESIFDVSITINDATHNMSKRGIFLLYVSADRF-----------HLDQSHNINSTIIMNNRFGLKMKQSPDPKVKHPDEECMLPIDIQSFIVVPTVLIIDSSVSSHFLQIKDQTKXXXXXXXXXXXXXNQFVKHEMKIGKLFTLFLTCPIIAFVIICGHLDTNVQTFKELERIFTRFANAVESDLWRIS--DEKLRLFMGDPFCRSLIVRYLFCNISLRLHCEFPVDGYLPKCNLIEVESTIVNDKRFQNFIYSMATVVNSSGKFAS 1393
            +IVG+C  Q  +   + DM RM   LE  P                          P+  HK       G   T P N  K+     +    +  I  A  ++S  G  LLY+SAD             HL      +  ++ NNR   +    P  K    +  C+ P DI  ++  P  L++DS  S  F    +    P +CLLSP+++P        + G +FTLFL CP+ AF  +CG     ++T+     +   F       L R    D     F+ D F R L++RY FCNI LR H +F    + P C     ES ++N       I  +A++ +    FA+
Sbjct:  250 LIVGNCYEQTRFSELSLDMYRMLQTLERDPLDTLHGSTPSVQNPRVSAMSNLENGLPSSGHKSDEVGSNGCGPTRPHNPHKYLLYKPTFSQFNTVIAAAFKDVSATGAVLLYISADGIRAPTAKYGDEPHLGTVGYDSGGVVTNNRREQEFNVKPK-KTNFKEPHCIHPGDIYPYMRKPLFLVVDSDNSGAFRNFPNLFGQPFVCLLSPEVIPESLESSRHR-GNIFTLFLHCPLTAFCFVCGLGTVQLKTWDAARGVLDAFLTECYRILIRSRSLDYSYVQFLVDDFLRLLVLRYCFCNIVLRFHRDFSGQSFYPSCAPSLPESEMLNSPLLHKLIVELASLFDCRSVFAT 599          
BLAST of Protein SCAI vs. Ensembl Cavefish
Match: scai (suppressor of cancer cell invasion [Source:ZFIN;Acc:ZDB-GENE-060526-57])

HSP 1 Score: 58.9214 bits (141), Expect = 8.091e-9
Identity = 97/450 (21.56%), Postives = 185/450 (41.11%), Query Frame = 2
Query:  131 YGYDVVVNNDYFIRDKCKYYSTKIFVLFFLQHMSSIKCELMNYHNHL--WNNRIKLNDKFDYYYKRMNLIYHSLI-YTEIGVHKSLANIDFRIDYQSLENINEXXXXXXXXXXXXAVIVG--SCAGQPSYRGFTADMLRMWIALEYKPNPAPDHKLGGDHTIP--------KNCRKWTFCYESIFDVSITINDAT-HNMSKRGIFLLYVSAD------RFHLDQSHNINSTIIMNNRFGLKMKQSPDPKVKHPDEECMLPIDIQSFIVVPTVLIIDSSVSSHFLQIKDQTKXXXXXXXXXXXXXNQFVKHEMKIGKLFTLFLTCPIIAFVIICGHLDTNVQTFKELERIFTRFANAVESDLWRISDEKLRLFM---GDPFCRSLIVRYLFCNISLRLHCEFPVDGYLPKCNLIEVESTIVNDKRFQNFIYSMATVVNSSGKFASASHTGY 1411
            Y Y V   +   +  K +YY+  I V   L  M  +K  +      +  +  R    D+ ++     NL+   +  + E      + N D  +  +S        +      L+  ++VG  + A    +   T DM RM  ALE +P            T+         +N  K+   Y+  F    T   A+   +    + L+Y+SA       R   +  +++   +   NR  +   ++   + +   E  + P D+  F   P  +I+DS+ S+ +    +    P++CLLSP + P   ++ + + G LFTLFL  P++ F+ ICG        +++ +    + ++ +   L   S   ++ F+   GD F R L++R++FC+ +LRLH  F     +P       +  +V +   Q  I  +A++++    F+      Y
Sbjct:  119 YYYQVNKEDPELVVKKLRYYARFIVVCLLLNKMDLVKVLVKELSEEIEDYTQRFNTEDQLEW-----NLVLQEVAAFVEQADPVMILNDDNTVVVKS-----NRLQEGGVPQLEPGMVVGQLTLADALIFSELTIDMFRMLQALEREPVNLATQTTTKPGTLEPSEKPAKRENPHKY-LLYKPTFSQLYTFLSASFKELPASSVLLVYLSATGVFPSARLEYE-PYDVGGVLTNTNR-DVVNGETVQKRNQAQKEMHLHPGDLFPFTRKPLFIIVDSTNSTAYKNFSNLFGQPLVCLLSPTVYPKS-MQDQSQRGSLFTLFLYNPLMGFLSICGITSMRQGLWEKAQEFLRKISHDIGQML--TSSRAIQAFLQFYGDEFLRLLMIRFVFCSATLRLHKLFREARSVPDSYPQLPKQEMVENSLLQKHILELASMLDVQNLFSDGMLDNY 552          
BLAST of Protein SCAI vs. Ensembl Nematostella
Match: EDO34366 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPK0])

HSP 1 Score: 79.7221 bits (195), Expect = 8.729e-16
Identity = 73/304 (24.01%), Postives = 116/304 (38.16%), Query Frame = 2
Query:  470 VIVGSCAGQPSYRGFTADMLRMWIALEYKPNPAPDHKLG---GDHTIPK--------------NCRKWTFCYESIFDVSITINDATHNMSKRGIFLLYVSADR----------FHLDQSHNINSTIIMNNRFGLKMKQSPDPKVKHPDEECMLPIDIQSFIVVPTVLIIDSSVSSHFLQIKDQTKXXXXXXXXXXXXXNQFVKHEMKIGKLFTLFLTCPIIAFVIICGHLDTNVQTFKELERIFTRFAN---AVESDLWRISDEKLRLFMGDPFCRSLIVRYLFCNISLRLHCEFPVDGYLPKC 1291
            +I+G+C  Q  +   T DM RM  ALE +P   P   L     +  +P+              N  K+     +   + + ++     +   G+ ++YVS D              +Q   + S     N  G   ++  + K  H    C+ P D+      P ++++D   SSH  +         L  L         V    + G LFT+FL  P++AF  IC   D     +   +R   R       V  D  R  D   + F+ D   + LI+RY+FC  ++ LH  F    Y PKC
Sbjct:  241 IIIGNCEKQVKFSELTLDMFRMLQALEREPEENPPRTLETSMSNEQLPEDRSSTETSINPKRPNPHKYLLYKPTFAQIHVFLSVGFKELPTNGVLMVYVSGDACVGSSRQGDDGPYEQGGVLTSQRKTGNEEGGAKRRPTNTKEAH----CLYPDDLVPLTRKPLLVVVDCP-SSHAFKFFPNLFGQPLLCLMSPSSAPVAVSELNRKGSLFTMFLYSPLVAFSYICSIADLRSDLWDSCQRQIRRILGDILRVFHDWSRAVDLTFQKFLEDDLMKMLILRYVFCFYAMHLHRAFKGSEYYPKC 539          
BLAST of Protein SCAI vs. Ensembl Medaka
Match: scai (suppressor of cancer cell invasion [Source:NCBI gene;Acc:101156422])

HSP 1 Score: 78.9518 bits (193), Expect = 3.654e-15
Identity = 105/442 (23.76%), Postives = 178/442 (40.27%), Query Frame = 2
Query:  176 KCKYYSTKIFVLFFLQHMSSIKCELMNYHNHL--WNNRIKLNDKFDYYYKRMNLIYH---SLIYTEIGV----HKSLANIDFRIDYQSLENINEXXXXXXXXXXXXAVIVGSCAGQPSYRGFTADMLRMWIALEYKP-NPAPD-HKLGGDHTIPKNCRKWT----FCYESIFDVSITINDAT-HNMSKRGIFLLYVSADRF----HLD---QSHNINSTIIMNNRFGLKMKQSPDPKVKHPDE-ECMLPIDIQSFIVVPTVLIIDSSVSSHFLQIKDQTKXXXXXXX--XXXXXXNQFVKHEMKIGKLFTLFLTCPIIAFVIICGHLDTNVQTFKE----LERIFTRFANAVESDLWRISDEKLRLFMGDPFCRSLIVRYLFCNISLRLHCEFPVDGYLPKCNLIEVESTIVNDKRFQNFIYSMATVVNSSGKFASASHTGY 1411
            K +YY+  I V   L  M  +K  +      +  +  R    D+ ++     NL+     + I  +  V    + S+  I  R+  +S   + E        +L  A+I+G+C  Q  +   T DM RM  ALE +P N A    K G      K  ++        Y+  F    T   A+   +    + L+Y+SA       H D     ++    +   NR  +   ++   +++   E  C+ P D+  F   P  +I+DSS S+ +   K+ T L    L+      +  + V+ + + G LFTLFL  P++AF  +CG        ++     L ++F      +     R  D+    F GD F R L++R++FC+  LRLH  F      P+      +   V     Q  I  +A +++    F   S   Y
Sbjct:  137 KLRYYARYIVVCLLLNKMELVKVLVKELSEEIEDYTQRFNTEDQLEW-----NLVLQEVAAFIEADPTVVLNDNNSMVVISHRLQDESAPPL-EQGMVVGQLVLADALIIGNCNNQVKFSELTIDMFRMLQALEREPVNLATQTSKQGTLEPNEKPAKRENPHKYLLYKPTFSQLFTFLSASFKELPANSVLLIYLSATGVFPTGHSDYEVGGYDFGGVLTNTNR-DIVNGETVQKRIQAQKEMHCLHPGDLFPFTRKPLFIIVDSSNSAAY---KNFTNLFGQPLVCLLSPTMYPKTVQDQSQRGSLFTLFLYSPLLAFSSVCGLSSIQRGIWERAQDFLRKVFRDIGQMITRS--RTIDQAFLQFFGDEFLRLLLIRFVFCSAVLRLHKLFREARSFPESYPELPKQDTVESSLLQKQILELAAMLDVQSSFWEDSLEAY 566          
BLAST of Protein SCAI vs. Planmine SMEST
Match: SMESG000039882.1 (SMESG000039882.1)

HSP 1 Score: 866.3 bits (2237), Expect = 0.000e+0
Identity = 447/453 (98.68%), Postives = 447/453 (98.68%), Query Frame = 2
Query:   65 ISGSETCCLYRILEINDSFGSFYGYDVVVNNDYFIRDKCKYYSTKIFVLFFLQHMSSIKCELMNYHNHLWNNRIKLNDKFDYYYKRMNLIYHSLIYTEIGVHKSLANIDFRIDYQSLENINEXXXXXXXXXXXXAVIVGSCAGQPSYRGFTADMLRMWIALEYKPNPAPDHKLGGDHTIPKNCRKWTFCYESIFDVSITINDATHNMSKRGIFLLYVSADRFHLDQSHNINSTIIMNNRFGLKMKQSPDPKVKHPDEECMLPIDIQSFIVVPTVLIIDSSVSSHFLQIKDQTKXXXXXXXXXXXXXNQFVKHEMKIGKLFTLFLTCPIIAFVIICGHLDTNVQTFKELERIFTRFANAVESDLWRISDEKLRLFMGDPFCRSLIVRYLFCNISLRLHCEFPVDGYLPKCNLIEVESTIVNDKRFQNFIYSMATVVNSSGKFASASHTGYSRKV 1423
            ISGSETCCLYRILEINDSFGSFYGYDVVVNNDYFIRDKCKYYSTKIFVLFFLQHMSSIKCELMNYHNHLWNNRIKLNDKFDYYYKRMNLIYHSLIYTEIGVHKSLANIDFRIDYQSLENINELSRSRSSHLLQRAVIVGSCAGQPSYRGFTADMLRMWIALEYKPNPAPDHKLGGDHTIPKNCRKWTFCYESIFDVSITINDATHNMSKRGIFLLYVSADRFHLDQSHNINSTIIMNNRFGLKMKQSPDPKVKHPDEECMLPIDIQSFIVVPTVLIIDSSVSSHFLQIKDQTKLPILCLLSPDLLPNQFVKHEMKIGKLFTLFLTCPIIAFVIICGHLDTNVQTFKELERIFTRFANAVESDLWRISDEKLRLFMGDPFCRSLIVRYLFCNISLRLHCEFPVDGYLPKCNLIEVESTIVNDKRFQNFIYSMATVVNSSGKFASAS    S  V
Sbjct:   71 ISGSETCCLYRILEINDSFGSFYGYDVVVNNDYFIRDKCKYYSTKIFVLFFLQHMSSIKCELMNYHNHLWNNRIKLNDKFDYYYKRMNLIYHSLIYTEIGVHKSLANIDFRIDYQSLENINELSRSRSSHLLQRAVIVGSCAGQPSYRGFTADMLRMWIALEYKPNPAPDHKLGGDHTIPKNCRKWTFCYESIFDVSITINDATHNMSKRGIFLLYVSADRFHLDQSHNINSTIIMNNRFGLKMKQSPDPKVKHPDEECMLPIDIQSFIVVPTVLIIDSSVSSHFLQIKDQTKLPILCLLSPDLLPNQFVKHEMKIGKLFTLFLTCPIIAFVIICGHLDTNVQTFKELERIFTRFANAVESDLWRISDEKLRLFMGDPFCRSLIVRYLFCNISLRLHCEFPVDGYLPKCNLIEVESTIVNDKRFQNFIYSMATVVNSSGKFASASDLNSSINV 523          
BLAST of Protein SCAI vs. Planmine SMEST
Match: SMESG000075966.1 (SMESG000075966.1)

HSP 1 Score: 68.1662 bits (165), Expect = 8.554e-12
Identity = 70/246 (28.46%), Postives = 110/246 (44.72%), Query Frame = 2
Query:  695 GIFLLYVSADRFHLDQSHN------INSTIIMNNRFGLKMKQSPDPKVKHPDEECMLPIDIQSFIVVPTVLIIDSSVSSHFLQIKDQTKXXXXXXXXXXXXXN--QFVKHEMKIGKLFTLFLTCPIIAFVIICGHLDTNVQTFKELERIFTRFANAVESDLWRIS--DEKLRLFMGDPFCRSLIVRYLFCNISLRLHCEFPVDGYLPKCNLIEVESTIVNDKRFQNFIYSMATVVNSSGKFASASH 1402
            G  L+Y+S D      S N      +   I   NR   +       K +  +  C+ P D+  +   P  +I+DS+ S+ F    +    P++CL+SP+ +PN  Q +KH+   G LFTLF+ CPI AF +IC     + + +        +F       L R    D     F  D F R LI+RY FC + L++H +F    + P       E  + N    Q  IY +A +++   +F+S  H
Sbjct:  360 GGILIYLSCDGLKSTPSKNDVEGYELGGVITSGNR---EYSTGKSKKRQVKEMCCIHPGDLYIYTRKPLFIIVDSNNSTAFQNFSNLFDQPLVCLMSPEQVPNYIQKLKHK---GNLFTLFIHCPITAFCVICNVSQLSTKAWDRAHVYLDQFMIESGKILLRCKNLDYSYLQFYSDDFLRILILRYCFCFLVLKMHQDFQGPKFYPVSYPQLPELDLYNHSSLQKKIYEIAALMDCWHQFSSDLH 599          
BLAST of Protein SCAI vs. Planmine SMEST
Match: SMESG000075968.1 (SMESG000075968.1)

HSP 1 Score: 65.855 bits (159), Expect = 3.360e-11
Identity = 93/370 (25.14%), Postives = 155/370 (41.89%), Query Frame = 2
Query:  275 NNRIKLNDKFDYY---YKRMNLIYHSL-IYTEIGVHKSLANIDFRIDYQSLENINEXXXXXXXXXXXXAVIVGSCAGQPSYRGFTADMLRMWIALEYKPNPAPDHKLGGDHTIPKNCRKWTFCYESIFDVSITINDATHNMSKRGIFLLYVSADRFHLDQSHNINSTIIMNNRFGLKMKQSPDPKVKHPDEECMLPIDIQSFIVVPTVLIIDSSVSSHFLQIKDQTKXXXXXXXXXXXXXNQFVKHEMKIGKLFTLFLTCPIIAFVIICGHLDTNVQTFKELERIFTRFANAVESDL-WRISDEKLRLFMGDPFCRSLIVRYLFCNISLRLHCEFPVDGYLPKCNLIEVESTIVNDKRFQNFIYSMATVV 1369
            N  +   DKF  Y     R N  Y+SL ++  +  +    NI+ R     L + N+   S SS  L   +I      Q  + G T D+ R+W   E  P     + +      P+           + ++      +   +     F+ Y+SAD      S+++N   + ++  G  +                 P  +  +   P +LI+DS  S  F  +K     P++CLLSP +LP +  K++ K G LFTLFL+CPI A  IIC       + +   +     F     S +  RI  ++   F+ DPF + +I+ Y FC++ LR H  F    Y P  N   +E+ +  +   +  +YS++ V 
Sbjct:  157 NKSLMQADKFYTYNDCITRTNNFYNSLQLFNVVETNSDFYNIENR-----LVSTNQNIISHSSLTLSEVIICSFTEKQIEFDGRTPDIFRVWQLFECLPKCCLRNPIKRVLNKPR-----------LHELKACFLRSITRLKFNNAFVCYISAD------SYDLNKITVSDDDSGASIN----------------PNLLVCYTRAPLLLIVDSKDSDIFRDLKSPFNKPLICLLSPRILPPE-SKYDTKHGNLFTLFLSCPIAALSIICDKKCIEKKQWNRAQDYLEEFNEMCLSIIKKRIILKEYLSFISDPFMKKIILSYCFCSVVLRSHKYFNKPEYHPLSN-PPIETILSENADLKAIVYSISRVA 486          
The following BLAST results are available for this feature:
BLAST of Protein SCAI vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
SCAI2.216e-1424.06suppressor of cancer cell invasion [Source:HGNC Sy... [more]
SCAI2.575e-1424.06suppressor of cancer cell invasion [Source:HGNC Sy... [more]
back to top
BLAST of Protein SCAI vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein SCAI vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
CG132933.032e-1625.49gene:FBgn0035677 transcript:FBtr0332062[more]
CG132933.555e-1625.49gene:FBgn0035677 transcript:FBtr0332064[more]
CG132933.555e-1625.49gene:FBgn0035677 transcript:FBtr0332061[more]
CG132933.555e-1625.49gene:FBgn0035677 transcript:FBtr0332063[more]
back to top
BLAST of Protein SCAI vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
scai1.875e-1525.15suppressor of cancer cell invasion [Source:ZFIN;Ac... [more]
scai7.718e-1224.09suppressor of cancer cell invasion [Source:ZFIN;Ac... [more]
scai9.089e-1224.09suppressor of cancer cell invasion [Source:ZFIN;Ac... [more]
scai9.518e-1224.09suppressor of cancer cell invasion [Source:ZFIN;Ac... [more]
back to top
BLAST of Protein SCAI vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
SCAI4.493e-1324.47suppressor of cancer cell invasion [Source:NCBI ge... [more]
back to top
BLAST of Protein SCAI vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Scai2.718e-1423.72suppressor of cancer cell invasion [Source:MGI Sym... [more]
back to top
BLAST of Protein SCAI vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|Q8N9R8|SCAI_HUMAN1.237e-1324.06Protein SCAI OS=Homo sapiens OX=9606 GN=SCAI PE=1 ... [more]
sp|Q8C8N2|SCAI_MOUSE1.901e-1323.72Protein SCAI OS=Mus musculus OX=10090 GN=Scai PE=1... [more]
sp|Q54YY1|SCAI_DICDI5.759e-627.27Protein SCAI homolog OS=Dictyostelium discoideum O... [more]
back to top
BLAST of Protein SCAI vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A077ZIP81.646e-1930.64Protein SCAI OS=Trichuris trichiura OX=36087 GN=TT... [more]
E2AJZ72.951e-1826.11Uncharacterized protein C9orf126-like protein OS=C... [more]
A0A158NNI83.228e-1826.11Uncharacterized protein OS=Atta cephalotes OX=1295... [more]
A0A195F7203.228e-1826.11Protein SCAI OS=Trachymyrmex septentrionalis OX=34... [more]
A0A4E0S1876.766e-1826.99Protein SCAI OS=Fasciola hepatica OX=6192 GN=D915_... [more]
back to top
BLAST of Protein SCAI vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
scai8.091e-921.56suppressor of cancer cell invasion [Source:ZFIN;Ac... [more]
back to top
BLAST of Protein SCAI vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein SCAI vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein SCAI vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO343668.729e-1624.01Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein SCAI vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
scai3.654e-1523.76suppressor of cancer cell invasion [Source:NCBI ge... [more]
back to top
BLAST of Protein SCAI vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000039882.10.000e+098.68SMESG000039882.1[more]
SMESG000075966.18.554e-1228.46SMESG000075966.1[more]
SMESG000075968.13.360e-1125.14SMESG000075968.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011974 ID=SMED30011974|Name=Protein SCAI|organism=Schmidtea mediterranea sexual|type=transcript|length=1592bp
TCGGATGCTTATTTGCAATTATAGTAACATAAAATTTAACATTTAAAATA
TTGCTTTGTTTAGTATTAGTGGATCAGAAACTTGCTGCTTATATAGAATT
TTGGAAATAAATGACTCATTCGGATCATTTTATGGCTATGATGTAGTTGT
GAACAACGACTATTTTATCAGAGATAAATGCAAATACTATTCGACTAAAA
TTTTCGTGTTATTTTTTCTTCAACATATGTCAAGTATTAAATGCGAATTG
ATGAATTACCATAACCATTTGTGGAATAACAGGATCAAATTAAATGATAA
GTTTGATTATTATTACAAACGGATGAATTTAATTTACCATTCGCTTATTT
ACACTGAAATCGGAGTTCATAAATCACTGGCTAATATCGACTTTAGGATC
GACTACCAGAGCCTGGAAAATATTAATGAGCTATCTAGAAGCAGGAGTAG
TCATTTATTACAGCGCGCCGTTATAGTTGGCTCATGCGCTGGTCAGCCAT
CATATCGGGGCTTCACTGCTGACATGTTGAGGATGTGGATTGCGCTTGAG
TATAAGCCAAACCCAGCACCAGATCACAAATTAGGAGGAGATCACACAAT
ACCAAAAAACTGTAGGAAATGGACATTTTGCTACGAAAGTATATTTGACG
TTTCCATTACAATCAATGATGCTACACACAACATGTCGAAACGTGGAATA
TTCTTGTTATATGTCAGCGCTGACCGATTTCACCTTGACCAATCACATAA
TATCAATTCGACAATTATCATGAACAATCGGTTTGGGTTGAAAATGAAGC
AATCTCCCGATCCAAAAGTGAAACATCCGGATGAGGAATGCATGCTCCCT
ATAGATATCCAATCATTTATCGTCGTACCGACTGTCCTCATTATCGACAG
CAGCGTCAGCAGTCATTTCCTGCAAATCAAGGATCAAACCAAACTGCCGA
TACTCTGCTTATTATCTCCGGATTTGTTACCGAATCAGTTCGTAAAACAT
GAAATGAAAATCGGAAAGCTTTTCACTTTATTCTTGACTTGTCCAATCAT
AGCATTCGTTATAATTTGCGGCCATTTGGACACAAATGTTCAAACCTTCA
AAGAACTTGAGCGCATTTTCACTCGATTCGCCAATGCAGTTGAAAGTGAT
TTATGGCGAATTAGTGATGAGAAATTGAGATTGTTTATGGGAGATCCTTT
CTGTCGGTCGCTAATCGTCAGATATCTATTCTGCAATATATCTCTCAGGT
TGCATTGTGAGTTTCCAGTTGATGGATATCTGCCAAAATGCAATTTGATA
GAAGTCGAATCGACAATTGTCAATGACAAAAGATTCCAGAATTTCATATA
CTCTATGGCTACGGTTGTAAATTCATCGGGAAAATTTGCTTCCGCAAGTC
ACACTGGCTACAGCAGAAAGGTCATTTTCAAACTTATCTTCGTAATTCAA
TCAGTAATAACGCCTTAGTGATTTAGGCTTGTTGAGCATTGAAGAATAAG
GGGCAAACGTTATGGATATTGACCGATTTACAGAGATAGAGTCGTCGCAA
GGATTTGTCTGAGAATACTCATCCACACTAACAGTACTGTAC
back to top

protein sequence of SMED30011974-orf-1

>SMED30011974-orf-1 ID=SMED30011974-orf-1|Name=SMED30011974-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=414bp
MSSIKCELMNYHNHLWNNRIKLNDKFDYYYKRMNLIYHSLIYTEIGVHKS
LANIDFRIDYQSLENINELSRSRSSHLLQRAVIVGSCAGQPSYRGFTADM
LRMWIALEYKPNPAPDHKLGGDHTIPKNCRKWTFCYESIFDVSITINDAT
HNMSKRGIFLLYVSADRFHLDQSHNINSTIIMNNRFGLKMKQSPDPKVKH
PDEECMLPIDIQSFIVVPTVLIIDSSVSSHFLQIKDQTKLPILCLLSPDL
LPNQFVKHEMKIGKLFTLFLTCPIIAFVIICGHLDTNVQTFKELERIFTR
FANAVESDLWRISDEKLRLFMGDPFCRSLIVRYLFCNISLRLHCEFPVDG
YLPKCNLIEVESTIVNDKRFQNFIYSMATVVNSSGKFASASHTGYSRKVI
FKLIFVIQSVITP*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR022709SCAI
Vocabulary: molecular function
TermDefinition
GO:0003714transcription corepressor activity
Vocabulary: biological process
TermDefinition
GO:0006351transcription, DNA-templated
GO:1903507negative regulation of nucleic acid-templated transcription
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR022709Protein SCAIPFAMPF12070SCAIcoord: 53..346
e-value: 1.9E-37
score: 129.4
NoneNo IPR availablePANTHERPTHR21243:SF15PROTEIN SCAIcoord: 56..393
NoneNo IPR availablePANTHERPTHR21243FAMILY NOT NAMEDcoord: 56..393
NoneNo IPR availableTMHMMTMhelixcoord: 265..284