piggyBac transposable element-derived protein 4-like

Overview
NamepiggyBac transposable element-derived protein 4-like
Smed IDSMED30011971
Length (bp)2802
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of piggyBac transposable element-derived protein 4-like (SMED30011971) t-SNE clustered cells

Violin plots show distribution of expression levels for piggyBac transposable element-derived protein 4-like (SMED30011971) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of piggyBac transposable element-derived protein 4-like (SMED30011971) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for piggyBac transposable element-derived protein 4-like (SMED30011971) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011971

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30011971SMESG000067117.1 SMESG000002107.1 Contig37975uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30011971SMESG000067117.1 SMESG000002107.1 Contig37975newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
oocyteSMED30011971SMESG000067117.1 Contig14201uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30011971SMESG000067117.1 Contig14201uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30011971SMESG000067117.1 Contig14201uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
oocyteSMED30011971SMESG000067117.1 Contig14201newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30011971SMESG000067117.1 Contig14201newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30011971SMESG000067117.1 Contig14201newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
oocyteSMED30011971SMESG000080480.1 Contig12314uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30011971SMESG000080480.1 Contig12314uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
oocyteSMED30011971SMESG000080480.1 Contig12314newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30011971SMESG000080480.1 Contig12314newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of piggyBac transposable element-derived protein 4-like vs. Ensembl Human
Match: PGBD4 (piggyBac transposable element derived 4 [Source:HGNC Symbol;Acc:HGNC:19401])

HSP 1 Score: 206.838 bits (525), Expect = 1.120e-65
Identity = 138/440 (31.36%), Postives = 222/440 (50.45%), Query Frame = 2
Query: 1232 WSKEGNFVPKLHQFQEKPGPKNFRVENEQPIDYFEWFIDSEFMDYVVKETN----LYQQQHPLPSQ-KKMAKWFDVISNELSVFFAIVMLTGLVSKNELKDYWSVDPLLNTQIFPKTFTRNRLLQIMRYLHFANN------EQKTIDKLFKIGNVVNMVKEKFKNAIIPDRNICIDESLMLWKGRLSFKQYIPSKRHRFGIKLFEMVDCTTQCILNFIIYTGKSTKFRFHELLGISGSIVIKLMNMHLDKGHVLYVDNWYSSPPLFEILHYKKTGACGTLRKNRKGLP-KYSGKMKKGELESYNTDKLLFQRWMNKREVFMLSTIHRNGLVESTKTNFQSFEKIMKPKQLKITVYSWVVWIILIXXXXXXXXXXXX------------HIIDMVVHNAYCIYRAKNKSR-IQLADFRLILVRQLIEKYGSQRSERV-GRP 2473
            WS       + + F   PG K    +   P+ YFE F   E +  + +ETN    L   + P P    +M KW D  ++EL VFFA+++L G+V K EL+ +WS  PLL+T    +  T  R L + R LHF NN      + K    L KI  V + +  KF     P+RNI +DESLML+KG L+ KQY+P+KR RFG+KL+ + +  +  + N +++TG     +       S  IV+ L+N  L +G+ +++DN+  SP LF  LH  +T A GT R NRK +P     ++ KG   +    +L+  +W + +EV MLST H + ++E    N ++ +K  +P+   I  Y+  +  +                          H++ + V N+Y +++  N    +   +FRL L+ +++EK+     + + GRP
Sbjct:   75 WSARAMIPRQRYDFTGTPGRKVDVSDITDPLQYFELFFTEELVSKITRETNAQAALLASKPPGPKGFSRMDKWKDTDNDELKVFFAVMLLQGIVQKPELEMFWSTRPLLDTPYLRQIMTGERFLLLFRCLHFVNNSSISAGQSKAQISLQKIKPVFDFLVNKFSTVYTPNRNIAVDESLMLFKGPLAMKQYLPTKRVRFGLKLYVLCESQSGYVWNALVHTGPGMNLKDSADGLKSSRIVLTLVNDLLGQGYCVFLDNFNISPMLFRELHQNRTDAVGTARLNRKQIPNDLKKRIAKGTTVARFCGELMALKWCDGKEVTMLSTFHNDTVIE---VNNRNGKKTKRPRV--IVDYNENMGAVDSADQMLTSYPSERKRHKVWYKKFFHHLLHITVLNSYILFKKDNPEHTMSHINFRLALIERMLEKHHKPGQQHLRGRP 509          

HSP 2 Score: 65.4698 bits (158), Expect = 1.120e-65
Identity = 35/68 (51.47%), Postives = 39/68 (57.35%), Query Frame = 1
Query: 2491 LRLQGRHFPDKIPINSG-DNGKKCCVVCSTSSD------RKRTTIMCQLCDVPLCIVPCFKDYHTKVN 2673
            LRL GRHFP  IP  SG  N    C +C +  D      RK T   C  CDVPLC+VPCF+ YHTK N
Sbjct:  517 LRLSGRHFPKSIPATSGKQNPTGRCKICCSQYDKDGKKIRKETRYFCAECDVPLCVVPCFEIYHTKKN 584          
BLAST of piggyBac transposable element-derived protein 4-like vs. Ensembl Human
Match: PGBD2 (piggyBac transposable element derived 2 [Source:HGNC Symbol;Acc:HGNC:19399])

HSP 1 Score: 85.1149 bits (209), Expect = 2.464e-16
Identity = 82/330 (24.85%), Postives = 142/330 (43.03%), Query Frame = 2
Query: 1223 ERIWSKEGNFVPKLHQF-QEKPGPKNFRVENEQPIDYFEWFIDSEFMDYVVKETNLYQQQHPLPSQKKMAKWFDVISNELSVFFAIVMLTGLVSKNELKDYWSVDPLLNTQIFPKTFTRNRLLQIMRYLHFA-NNEQKTIDKLFKIGNVVNMVKEKFKNAIIPDRNICIDESLMLWKGRLSFKQYIPSKRHRFGIKLFEMVDCTTQCILNFIIYTGKSTKFRF---HELLGISGSIVIKLMNMHLDKGHV---LYVDNWYSSPPLFEILHYKKTGACGTLRKNRKGL-----PKYSGKMKKGELESYNTD---KLLFQRWMNKREVFMLS 2164
            +RIW+K  +  P    +    P  ++ + +   P+  FE F D   ++++V ETN Y  Q  +           + + EL     I++L+G +S    + +W   P  +  +      R+R   I  YLHFA NNE    D+  K+  ++  +   F+     +      ES+  + G    KQ    K  R G K++    C T     ++++   S    F      L + GS+VIK ++   ++G +   ++ D  ++S  L  IL  K   A GT+R+ R        PK   KMK+G  + Y  D   +++  RW +   V + S
Sbjct:  109 QRIWTKR-DIRPDFGSWTASDPHIEDLKSQELSPVGLFELFFDEGTINFIVNETNRYAWQKNVN--------LSLTAQELKCVLGILILSGYISYPRRRMFWETSPDSHHHLVADAIRRDRFELIFSYLHFADNNELDASDRFAKVRPLIIRMNCNFQKHAPLEEFYSFGESMCEYFGHRGSKQLHRGKPVRLGYKIW----CGTTS-RGYLVWFEPSQGTLFTKPDRSLDLGGSMVIKFVDALQERGFLPYHIFFDKVFTSVKLMSILRKKGVKATGTVREYRTERCPLKDPKELKKMKRGSFD-YKVDESEEIIVCRWHDSSVVNICS 423          
BLAST of piggyBac transposable element-derived protein 4-like vs. Ensembl Human
Match: ERCC6 (ERCC excision repair 6, chromatin remodeling factor [Source:HGNC Symbol;Acc:HGNC:3438])

HSP 1 Score: 83.5741 bits (205), Expect = 8.042e-16
Identity = 68/261 (26.05%), Postives = 117/261 (44.83%), Query Frame = 2
Query: 1289 PKNFRVENEQPIDYFEWFIDSEFMDYVVKETNLYQQQHPLPSQKKMAKWFDVISNELSVFFAIVMLTGLVSKNELKDYWSVDPLLNTQIFPKTFTRNRLLQIMRYLHFANNEQ-KTIDKLFKIGNVVNMVKEKFKNAIIPDRNICIDESLMLWKGRLSFKQYIPSKRHRFGIKLFEMVDCTTQC---ILNFIIYTGKSTKFRFHELLGISGSIVIK----LMNMHLDKGHVLYVDNWYSSPPLFEILHYKKTGACGTLRKN 2047
            P +F      P +  E F+D E ++ +VK +NLY     +           + S+E   F  I+ L+G VS    + +W     ++  +      R+R   I   LH A+N     +DK  K+  +++ + E+    +  +     DE ++ + GR   KQ+I  K  RFG K +    C   C   I  F  Y GK+   + HE  G+  S+V++    L   H  + H ++ +N+++S  L + L      A GT+RK+
Sbjct:  132 PNDFFTVMRTPTEILELFLDDEVIELIVKYSNLYACSKGV--------HLGLTSSEFKCFLGIIFLSGYVSVPRRRMFWEQRTDVHNVLVSAAMRRDRFETIFSNLHVADNANLDPVDKFSKLRPLISKLNERCMKFVPNETYFSFDEFMVPYFGRHGCKQFIRGKPIRFGYKFW----CGATCLGYICWFQPYQGKNPNTK-HEEYGVGASLVLQFSEALTEAHPGQYHFVF-NNFFTSIALLDKLSSMGHQATGTVRKD 378          
BLAST of piggyBac transposable element-derived protein 4-like vs. Ensembl Human
Match: ERCC6 (ERCC excision repair 6, chromatin remodeling factor [Source:HGNC Symbol;Acc:HGNC:3438])

HSP 1 Score: 82.4185 bits (202), Expect = 2.503e-15
Identity = 68/261 (26.05%), Postives = 117/261 (44.83%), Query Frame = 2
Query: 1289 PKNFRVENEQPIDYFEWFIDSEFMDYVVKETNLYQQQHPLPSQKKMAKWFDVISNELSVFFAIVMLTGLVSKNELKDYWSVDPLLNTQIFPKTFTRNRLLQIMRYLHFANNEQ-KTIDKLFKIGNVVNMVKEKFKNAIIPDRNICIDESLMLWKGRLSFKQYIPSKRHRFGIKLFEMVDCTTQC---ILNFIIYTGKSTKFRFHELLGISGSIVIK----LMNMHLDKGHVLYVDNWYSSPPLFEILHYKKTGACGTLRKN 2047
            P +F      P +  E F+D E ++ +VK +NLY     +           + S+E   F  I+ L+G VS    + +W     ++  +      R+R   I   LH A+N     +DK  K+  +++ + E+    +  +     DE ++ + GR   KQ+I  K  RFG K +    C   C   I  F  Y GK+   + HE  G+  S+V++    L   H  + H ++ +N+++S  L + L      A GT+RK+
Sbjct:  600 PNDFFTVMRTPTEILELFLDDEVIELIVKYSNLYACSKGV--------HLGLTSSEFKCFLGIIFLSGYVSVPRRRMFWEQRTDVHNVLVSAAMRRDRFETIFSNLHVADNANLDPVDKFSKLRPLISKLNERCMKFVPNETYFSFDEFMVPYFGRHGCKQFIRGKPIRFGYKFW----CGATCLGYICWFQPYQGKNPNTK-HEEYGVGASLVLQFSEALTEAHPGQYHFVF-NNFFTSIALLDKLSSMGHQATGTVRKD 846          
BLAST of piggyBac transposable element-derived protein 4-like vs. Ensembl Human
Match: ERCC6 (ERCC excision repair 6, chromatin remodeling factor [Source:HGNC Symbol;Acc:HGNC:3438])

HSP 1 Score: 82.4185 bits (202), Expect = 2.503e-15
Identity = 68/261 (26.05%), Postives = 117/261 (44.83%), Query Frame = 2
Query: 1289 PKNFRVENEQPIDYFEWFIDSEFMDYVVKETNLYQQQHPLPSQKKMAKWFDVISNELSVFFAIVMLTGLVSKNELKDYWSVDPLLNTQIFPKTFTRNRLLQIMRYLHFANNEQ-KTIDKLFKIGNVVNMVKEKFKNAIIPDRNICIDESLMLWKGRLSFKQYIPSKRHRFGIKLFEMVDCTTQC---ILNFIIYTGKSTKFRFHELLGISGSIVIK----LMNMHLDKGHVLYVDNWYSSPPLFEILHYKKTGACGTLRKN 2047
            P +F      P +  E F+D E ++ +VK +NLY     +           + S+E   F  I+ L+G VS    + +W     ++  +      R+R   I   LH A+N     +DK  K+  +++ + E+    +  +     DE ++ + GR   KQ+I  K  RFG K +    C   C   I  F  Y GK+   + HE  G+  S+V++    L   H  + H ++ +N+++S  L + L      A GT+RK+
Sbjct:  600 PNDFFTVMRTPTEILELFLDDEVIELIVKYSNLYACSKGV--------HLGLTSSEFKCFLGIIFLSGYVSVPRRRMFWEQRTDVHNVLVSAAMRRDRFETIFSNLHVADNANLDPVDKFSKLRPLISKLNERCMKFVPNETYFSFDEFMVPYFGRHGCKQFIRGKPIRFGYKFW----CGATCLGYICWFQPYQGKNPNTK-HEEYGVGASLVLQFSEALTEAHPGQYHFVF-NNFFTSIALLDKLSSMGHQATGTVRKD 846          
BLAST of piggyBac transposable element-derived protein 4-like vs. Ensembl Fly
Match: CG9839 (gene:FBgn0037633 transcript:FBtr0334332)

HSP 1 Score: 56.6102 bits (135), Expect = 1.020e-7
Identity = 52/212 (24.53%), Postives = 91/212 (42.92%), Query Frame = 2
Query: 1442 VISNELSVFFAIVMLTGLVSKNELKDYWSVDPLLNTQIFPKTFTRNRLLQIMRYLHFANNEQKTIDKLFKIGNVVNMVKEKFKNAIIPDRNICIDESLMLWKGRLSFKQYIPSKRHRFGIKLFEMVDCTTQC-----ILNFIIYTGKSTKF--RFHELLGISGSIVIKLMNMHLDKGHVLYVDNWYSSPPLFEILHYKKTGACGTLRKNRKG 2056
              + E+ +F A+ +L   +    L DYWS +       F       R  Q++  L+F   + +      K   +++ + E+ +   I  + + ++E + LWKG L ++  +P+K  R    L  M+  T Q      IL  I+    +  +     +L+     IV+KLM  +   G  +Y   +Y S  L + L  K T   G L +NR G
Sbjct:  175 TTAEEMEIFMALSLLMCDLKLEHLSDYWSTNMFYGLVGFSGKIPLERYQQLLHCLNFDAPQLQAGRAKVKNSLLLDFINERMEEIYICGQQLVLNEPITLWKGALRYQDELPNK-FRTNALLLHML--TEQSGLVVKILPEIVRKEDAPAWVRNSRQLVEHRNKIVLKLMEGY-HGGRTVYTSKFYGSYGLAQELAKKSTYCTGLLDRNRYG 382          
BLAST of piggyBac transposable element-derived protein 4-like vs. Ensembl Fly
Match: CG9839 (gene:FBgn0037633 transcript:FBtr0081934)

HSP 1 Score: 56.6102 bits (135), Expect = 1.020e-7
Identity = 52/212 (24.53%), Postives = 91/212 (42.92%), Query Frame = 2
Query: 1442 VISNELSVFFAIVMLTGLVSKNELKDYWSVDPLLNTQIFPKTFTRNRLLQIMRYLHFANNEQKTIDKLFKIGNVVNMVKEKFKNAIIPDRNICIDESLMLWKGRLSFKQYIPSKRHRFGIKLFEMVDCTTQC-----ILNFIIYTGKSTKF--RFHELLGISGSIVIKLMNMHLDKGHVLYVDNWYSSPPLFEILHYKKTGACGTLRKNRKG 2056
              + E+ +F A+ +L   +    L DYWS +       F       R  Q++  L+F   + +      K   +++ + E+ +   I  + + ++E + LWKG L ++  +P+K  R    L  M+  T Q      IL  I+    +  +     +L+     IV+KLM  +   G  +Y   +Y S  L + L  K T   G L +NR G
Sbjct:  175 TTAEEMEIFMALSLLMCDLKLEHLSDYWSTNMFYGLVGFSGKIPLERYQQLLHCLNFDAPQLQAGRAKVKNSLLLDFINERMEEIYICGQQLVLNEPITLWKGALRYQDELPNK-FRTNALLLHML--TEQSGLVVKILPEIVRKEDAPAWVRNSRQLVEHRNKIVLKLMEGY-HGGRTVYTSKFYGSYGLAQELAKKSTYCTGLLDRNRYG 382          
BLAST of piggyBac transposable element-derived protein 4-like vs. Ensembl Zebrafish
Match: pgbd4 (piggyBac transposable element derived 4 [Source:ZFIN;Acc:ZDB-GENE-091204-417])

HSP 1 Score: 149.443 bits (376), Expect = 5.433e-37
Identity = 126/441 (28.57%), Postives = 208/441 (47.17%), Query Frame = 2
Query: 1283 PGPKNFRVENEQPIDYFEWFIDSEFMDYVVKETNLYQQQHPLPSQKKMAKWFDVISNELSVFFAIVMLTGLVSKNELKDYWSVDPLLNTQIFPKTFTRNRLLQIMRYLHF------ANNEQK----TIDKLFKIGNVVNMVKEKFKNAIIPDRNICIDESLMLWKGRLSFKQYIPSKRHRFGIKLFEMVDCTTQCILNFIIYTGKSTKFRFHELLGISGSIVIKLMNMH-LDKGHVLYVDNWYSSPPLFEILHYKKTGACGTLRKNRKGLPKYSGKMKKGELESYNTDKLLFQRWMNKREVFMLSTIHRNGLVESTKTNFQSFEKIMKPKQLKITVY---------------SWVVWIILIXXXXXXXXXXXXHIIDMVVHNAYCIYRAKNKSRIQLADFRLILVRQLIEKYGSQRSERVGRPPLSKTNFVYKEDTFLIKF 2527
            PGP+     +   + YFE F     M  +V  +N++     +  + +  KW D+   +L  F A+V+  G+V    L+DYW +  + +     K  +R + L I   LH       A N++K      D L KI  +   +++  K +  P +NI IDE ++  K R    QYI S+  ++G KLF + D       +F IY GK    +  +  GIS   V+ L++   L  G+ L+VDN+Y+SP LF  L  KK GACGT+R NR  +     +  +G +  +  D LLF  W +KR+V M ST H+    +  K N +    +   K+  +                  + + +  ++ KT KWY+ FF+H +D+ V NA+ +++   KS+ Q A  + +    L+ +    R+   G PP ++   +   D  L K+
Sbjct:  142 PGPQLISTASFSVLQYFELFFSQPVMQKIVDHSNIFGA---MRHEARKRKWKDITVADLKSFIAMVIYMGIVKCFNLQDYWRMSDVYSLPYPAKIMSRIKFLTISWALHLSDPKVDAENDKKRGTPQYDPLCKIKPLYQDIRDACKASFHPHQNISIDERMVASKARHGLIQYI-SEPTKWGYKLFVLADSLCAYTWDFFIYEGK---VKTEQRKGISYDSVMALIDERVLGTGYKLFVDNFYTSPTLFRDLLSKKIGACGTIRPNR--INHTETEAPRGNIRWFREDGLLFVEWKDKRDVLMCSTFHKAYNGDYIKRNVKGKGSVWGVKEFPVPGAVLDYNKHMGGVDVSDALIGYYTVLHKTKKWYRSFFYHFVDIAVVNAFILHQQMAKSKNQKAMTQKVFRETLVAELAGIRA---GYPP-AREAAIASTDNHLPKY 569          
BLAST of piggyBac transposable element-derived protein 4-like vs. Ensembl Zebrafish
Match: CABZ01069162.1 (pep scaffold:GRCz11:KN149950.1:74:5493:1 gene:ENSDARG00000115161.1 transcript:ENSDART00000191202.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CABZ01069162.1)

HSP 1 Score: 146.747 bits (369), Expect = 6.740e-36
Identity = 118/418 (28.23%), Postives = 196/418 (46.89%), Query Frame = 2
Query: 1280 KPGPKNFRVENEQPIDYFEWFIDSEFMDYVVKETNLYQQQHPLPSQKKMAKWFDVISNELSVFFAIVMLTGLVSKNELKDYWSVDPLLNTQIFPKTFTRNRLLQIMRYLHFAN------NEQK----TIDKLFKIGNVVNMVKEKFKNAIIPDRNICIDESLMLWKGRLSFKQYIPSKRHRFGIKLFEMVDCTTQCILNFIIYTGKSTKFRFHELLGISGSIVIKLMN-MHLDKGHVLYVDNWYSSPPLFEILHYKKTGACGTLRKNRKGLPKYSG-----KMKKGELESYNTDKLLFQRWMNKREVFMLSTIHR---NGLVE-STKTNFQSFEKIMKPKQLKITVY-----------SWVVWIILIXXXXXXXXXXXXHIIDMVVHNAYCIY----RAKNKSRIQLADFRLILVRQL 2428
            +PGP+    +   P+  F+ F     +  +++ +N Y  +     Q     W ++   +L  + A+V+  GL+    L DYW    + +  +  +  +  + L I   LH ++      NE +      D+L KI  + + +++  +    P +NI IDE ++  K R   KQY+ +K  ++G KLF + D        F +Y GK    R     G+S   V+ L++  +L  G+ LYVDN+Y+SP LF  L  K+  ACGT+R NR G PK +         +G +     D LLF  W + REV M ST H+     +VE  +K N   +  +  P    +  Y           + + +  ++ KT KWY+ FF+H +D+ V NA+ ++    RAK +  +    FR  LV +L
Sbjct:  208 EPGPQLVTTDRYSPLQLFQLFFTPSVLQTIMQHSNAYATKQ---RQGTDKSWKNISVEDLKSYLALVIFMGLLKVCALTDYWRRSDVYSVPLPTRIMSCRKFLNIANALHLSDPVDDEANEGRKGTAAYDRLGKIKPLYDNIRDACRAFYHPGQNISIDERMVASKARSGLKQYMKNKPTKWGYKLFVLADSQCGYTSEFFVYEGK----RMSSPNGLSYESVMALIDEKYLGTGYKLYVDNFYTSPKLFRDLLSKRIYACGTIRPNRIGFPKMATNKLPQDAPRGSMRWIREDDLLFVEWKDTREVLMCSTFHKAYGGDIVERKSKDNDGQWSTVHVPIPGAVLDYNRFMGGVDLSDALICYYKVLHKTRKWYRTFFYHFVDIAVVNAFILHQKLARAKKERPLTQKAFRETLVMEL 618          
BLAST of piggyBac transposable element-derived protein 4-like vs. Ensembl Zebrafish
Match: pgbd4 (piggyBac transposable element derived 4 [Source:ZFIN;Acc:ZDB-GENE-091204-417])

HSP 1 Score: 145.976 bits (367), Expect = 8.073e-36
Identity = 120/412 (29.13%), Postives = 196/412 (47.57%), Query Frame = 2
Query: 1283 PGPKNFRVENEQPIDYFEWFIDSEFMDYVVKETNLYQQQHPLPSQKKMAKWFDVISNELSVFFAIVMLTGLVSKNELKDYWSVDPLLNTQIFPKTFTRNRLLQIMRYLHF------ANNEQK----TIDKLFKIGNVVNMVKEKFKNAIIPDRNICIDESLMLWKGRLSFKQYIPSKRHRFGIKLFEMVDCTTQCILNFIIYTGKSTKFRFHELLGISGSIVIKLMNMH-LDKGHVLYVDNWYSSPPLFEILHYKKTGACGTLRKNRKGLPKYSGKMKKGELESYNTDKLLFQRWMNKREVFMLSTIHRNGLVESTKTNFQSFEKIMKPKQLKI---------------TVYSWVVWIILIXXXXXXXXXXXXHIIDMVVHNAYCIYRAKNKSRIQLA----DFRLILVRQL 2428
            PGP+     +   + YFE F     M  +V  +N++     +  + +  KW D+   +L  F A+V+  G+V    L+DYW +  + +     K  +R + L I   LH       A N++K      D L KI  +   +++  K +  P +NI IDE ++  K R    QYI S+  ++G KLF + D       +F IY GK    +  +  GIS   V+ L++   L  G+ L+VDN+Y+SP LF  L  KK GACGT+R NR  +     +  +G +  +  D LLF  W +KR+V M ST H+    +  K N +    +   K+  +                  + + +  +  +T KWY+ FF+H +D+ + NA+ +++   KS+ Q A     FR  L+ +L
Sbjct:  142 PGPQLISTASFSVLQYFELFFSQPVMQKIVDHSNIFGA---MRHEARKRKWKDITVADLKSFIAMVIYMGIVKCFNLQDYWRMSDVYSLPYPAKIMSRIKFLTISWALHLSDPKVDAENDKKRGTPQYDPLCKIKPLYQDIRDACKASFHPHQNISIDERMVASKARHGLIQYI-SEPTKWGYKLFVLADSLCAYTWDFFIYEGK---VKTEQRKGISYDSVMALIDERVLGTGYKLFVDNFYTSPTLFRDLLSKKIGACGTIRPNR--INHTETEAPRGNIRWFREDGLLFVEWKDKRDVLMCSTFHKAYNGDYIKRNVKGKGSVWGVKEFPVPGAVLDYNKYKGGEDVSNALIGYYTVFRQTKKWYRSFFYHFVDIAIVNAFILHQQMAKSKNQKAMTQKAFRETLITEL 544          
BLAST of piggyBac transposable element-derived protein 4-like vs. Ensembl Zebrafish
Match: si:dkey-19f4.2 (si:dkey-19f4.2 [Source:ZFIN;Acc:ZDB-GENE-121214-262])

HSP 1 Score: 137.502 bits (345), Expect = 2.537e-33
Identity = 95/325 (29.23%), Postives = 161/325 (49.54%), Query Frame = 2
Query: 1250 FVPKLHQFQEKPGPKNFRVENEQPIDYFEWFIDSEFMDYVVKETNLYQQQHPLPSQKKMAKWFDVISNELSVFFAIVMLTGLVSKNELKDYWSVDPLLNTQIFPKTFTRNRLLQIMRYLHFAN------NEQK----TIDKLFKIGNVVNMVKEKFKNAIIPDRNICIDESLMLWKGRLSFKQYIPSKRHRFGIKLFEMVDCTTQCILNFIIYTGKSTKFRFHELLGISGSIVIKLMNMH-LDKGHVLYVDNWYSSPPLFEILHYKKTGACGTLRKNRKGLPK-----YSGKMKKGELESYNTDKLLFQRWMNKREVFMLSTIHR 2176
            F PK       PG + F          F  F     +  +   TN+  ++  L   KK+A W  + S+    +  +++   L+    ++DYW  D  L+        TR+R + I R +H +N      N++K      D L+++  +   +K+  K+   P + I IDE ++  K +++ KQY+ +K  ++G+KLF + D +     +F IYTGKS   RF    G+   +V  L++   L +G+ LYVDN+Y+SP LF  L+     ACGT + +RK + +      + +  +G +     +KLLF +WM+ REV + STIH+
Sbjct:  109 FCPK-----RAPGLQGFVGVTYSLAQIFRQFFSVTTVRVICCNTNINAEKE-LSKGKKLA-WEKLTSDTFLKYIGLLIYMALLKLPRVRDYWRRDSHLSVHFPVSVMTRDRFMAISRTVHLSNPDDDIENDRKKGTPDYDPLYRLKPLYITIKDTCKSMWQPRKQIAIDERMVATKAKIALKQYMKAKPIKWGVKLFVLADSSNGYTSDFTIYTGKS---RFTSSQGLPYDVVSNLIDPSFLGRGYHLYVDNFYTSPKLFRDLYASGFVACGTFKDSRKNVRETKQNALTSRSPRGSIRWIRQNKLLFVKWMDTREVSVCSTIHK 423          
BLAST of piggyBac transposable element-derived protein 4-like vs. Ensembl Zebrafish
Match: CR847936.1 (piggyBac transposable element-derived protein 4-like [Source:NCBI gene;Acc:100330143])

HSP 1 Score: 127.872 bits (320), Expect = 4.902e-31
Identity = 93/332 (28.01%), Postives = 151/332 (45.48%), Query Frame = 2
Query: 1235 SKEGNFVPKLHQF--QEKPGPKNFRVENEQPIDYFEWFIDSEFMDYVVKETNLYQQQHPLPSQKKMAKWFDVISNELSVFFAIVMLTGLVSKNELKDYWSVDPLLNTQIFPKTFTRNRLLQIMRYLHFANN--EQKTI--------DKLFKIGNVVNMVKEKFKNAIIPDRNICIDESLMLWKGRLSFKQYIPSKRHRFGIKLFEMVDCTTQCILNFIIYTGKSTKFRFHELLGISGSIVIKLMNMH-LDKGHVLYVDNWYSSPPLFEILHYKKTGACGTLRKNRKGLPKYS-----GKMKKGELESYNTDKLLFQRWMNKREVFMLSTIHR 2176
            S E +  P L  F   + PGP+         + +F+          +   TN Y  ++    ++K   W  +  +++  + A+V+  G+   + L DYWS     +     K  +  + L I   LH + +  ++K I        ++L KI  +  +++E  K+   P +NI I E ++  +     KQ + S+    G KLF + DCT     +F +Y GKS   R     G+S   V+ L++ + L  G+ L+VD +Y+SP LF  L  KK  ACG +  NR G PK           +G +     DKLLF  W + REV M S+ H+
Sbjct:   64 SDEADVEPPLLVFTPNQNPGPQILPNRCSSALQFFQLLFPKSMFQTIAGYTNSYAAKY---EERKGKLWNFISQSDMKSYVALVIYMGMFRCSSLSDYWSESQHFSLSFPAKIMSYRKFLSISIVLHLSESREDEKNILKKGTAGYERLGKIQPLYQVIRESCKSYFHPFQNITIVERMVKPQAGTGLKQSLKSRSPNMGFKLFALTDCTCGYTWDFFVYEGKSCASRSE---GLSYETVMALVDENMLGSGYKLFVDKFYTSPTLFTDLLDKKVLACGPVWPNRTGYPKSVKNKLLSNAPRGTMRWIRQDKLLFVEWKDSREVQMCSSFHK 389          
BLAST of piggyBac transposable element-derived protein 4-like vs. Ensembl Xenopus
Match: ENSXETT00000026678.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:4:88624292:88625603:1 gene:ENSXETG00000013495.1 transcript:ENSXETT00000026678.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 234.958 bits (598), Expect = 2.575e-68
Identity = 121/338 (35.80%), Postives = 196/338 (57.99%), Query Frame = 2
Query: 1220 GERIWSKEGNFVPKLHQFQEKPGPKNFRVENEQPIDYFEWFIDSEFMDYVVKETNLYQQQH----PLPSQKKMAKWFDVISNELSVFFAIVMLTGLVSKNELKDYWSVDPLLNTQIFPKTFTRNRLLQIMRYLHFANN------EQKTIDKLFKIGNVVNMVKEKFKNAIIPDRNICIDESLMLWKGRLSFKQYIPSKRHRFGIKLFEMVDCTTQCILNFIIYTGKSTKFRFHEL---LGISGSIVIKLMNMHLDKGHVLYVDNWYSSPPLFEILHYKKTGACGTLRKNRKGLPK--YSGKMKKGELESYNTDKLLFQRWMNKREVFMLSTIHRNGLV 2188
            GE  W    N+VP++  F   PG  +    N + ID+F  +I    +  +V+ TNLY +Q+    PLP   +   W+    NE+  F A+ +  GLV +N L  YW  + +L+  +F     RNR   ++R+LHF +N       +   D+L+K+  +++ + ++F     P +N+C+DESL+L+KGRL F+QYIPSKR R+G+K +++ + +T     F++Y GK T          L  SG IV +L+   L +G+ LYVDN+Y+S PLF  L+   T ACGT+ +NRKGLP+     K+K+GE+ +  +++LL  ++ + + VFML+TIH   ++
Sbjct:   15 GEPAWGPPCNYVPEIPPFTAVPG-LSVDTTNFEIIDFFNLYITEAILQDMVRYTNLYAEQYLASNPLPGFSRAQAWYPTNINEIKRFLALTLAMGLVERNSLASYWDTNTVLSIPLFSAVMPRNRYQILLRFLHFNDNTTAVAPNEPGYDRLYKLRPLIDSLSQRFAEVYTPSQNVCVDESLLLFKGRLKFRQYIPSKRSRYGMKFYKLCESSTGYTSYFMLYEGKDTNLDPPGCPTDLTTSGKIVWELITPLLGRGYHLYVDNFYTSIPLFRALNSLDTPACGTVNRNRKGLPRELLDKKLKRGEVHALRSNELLAIKYSDTKVVFMLTTIHDETMI 351          
BLAST of piggyBac transposable element-derived protein 4-like vs. Ensembl Xenopus
Match: ENSXETT00000040662.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:2:103014086:103015508:-1 gene:ENSXETG00000019536.1 transcript:ENSXETT00000040662.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 234.958 bits (598), Expect = 9.291e-68
Identity = 121/338 (35.80%), Postives = 196/338 (57.99%), Query Frame = 2
Query: 1220 GERIWSKEGNFVPKLHQFQEKPGPKNFRVENEQPIDYFEWFIDSEFMDYVVKETNLYQQQH----PLPSQKKMAKWFDVISNELSVFFAIVMLTGLVSKNELKDYWSVDPLLNTQIFPKTFTRNRLLQIMRYLHFANN------EQKTIDKLFKIGNVVNMVKEKFKNAIIPDRNICIDESLMLWKGRLSFKQYIPSKRHRFGIKLFEMVDCTTQCILNFIIYTGKSTKFRFHEL---LGISGSIVIKLMNMHLDKGHVLYVDNWYSSPPLFEILHYKKTGACGTLRKNRKGLPK--YSGKMKKGELESYNTDKLLFQRWMNKREVFMLSTIHRNGLV 2188
            GE  W    N+VP++  F   PG  +    N + ID+F  +I    +  +V+ TNLY +Q+    PLP   +   W+    NE+  F A+ +  GLV +N L  YW  + +L+  +F     RNR   ++R+LHF +N       +   D+L+K+  +++ + ++F     P +N+C+DESL+L+KGRL F+QYIPSKR R+G+K +++ + +T     F++Y GK T          L  SG IV +L+   L +G+ LYVDN+Y+S PLF  L+   T ACGT+ +NRKGLP+     K+K+GE+ +  +++LL  ++ + + VFML+TIH   ++
Sbjct:   88 GEPAWGPPCNYVPEIPPFTAVPG-LSVDTTNFEIIDFFNLYITEAILQDMVRYTNLYAEQYLASNPLPGFSRAQAWYPTNINEIKRFLALTLAMGLVERNSLASYWDTNTVLSIPLFSAVMPRNRYQILLRFLHFNDNTTAVAPNEPGYDRLYKLRPLIDSLSQRFAEVYTPSQNVCVDESLLLFKGRLKFRQYIPSKRSRYGMKFYKLCESSTGYTSYFMLYEGKDTNLDPPGCPTDLTTSGKIVWELITPLLGRGYHLYVDNFYTSIPLFRALNSLDTPACGTVNRNRKGLPRELLDKKLKRGEVHALRSNELLAIKYSDTKVVFMLTTIHDETMI 424          
BLAST of piggyBac transposable element-derived protein 4-like vs. Ensembl Xenopus
Match: ENSXETT00000029105.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:3:71954519:71956550:-1 gene:ENSXETG00000004868.1 transcript:ENSXETT00000029105.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 234.958 bits (598), Expect = 1.073e-67
Identity = 121/338 (35.80%), Postives = 196/338 (57.99%), Query Frame = 2
Query: 1220 GERIWSKEGNFVPKLHQFQEKPGPKNFRVENEQPIDYFEWFIDSEFMDYVVKETNLYQQQH----PLPSQKKMAKWFDVISNELSVFFAIVMLTGLVSKNELKDYWSVDPLLNTQIFPKTFTRNRLLQIMRYLHFANN------EQKTIDKLFKIGNVVNMVKEKFKNAIIPDRNICIDESLMLWKGRLSFKQYIPSKRHRFGIKLFEMVDCTTQCILNFIIYTGKSTKFRFHEL---LGISGSIVIKLMNMHLDKGHVLYVDNWYSSPPLFEILHYKKTGACGTLRKNRKGLPK--YSGKMKKGELESYNTDKLLFQRWMNKREVFMLSTIHRNGLV 2188
            GE  W    N+VP++  F   PG  +    N + ID+F  +I    +  +V+ TNLY +Q+    PLP   +   W+    NE+  F A+ +  GLV +N L  YW  + +L+  +F     RNR   ++R+LHF +N       +   D+L+K+  +++ + ++F     P +N+C+DESL+L+KGRL F+QYIPSKR R+G+K +++ + +T     F++Y GK T          L  SG IV +L+   L +G+ LYVDN+Y+S PLF  L+   T ACGT+ +NRKGLP+     K+K+GE+ +  +++LL  ++ + + VFML+TIH   ++
Sbjct:   88 GEPAWGPPCNYVPEIPPFTAVPG-LSVDTTNFEIIDFFNLYITEAILQDMVRYTNLYAEQYLASNPLPGFSRAQAWYPTNINEIKRFLALTLAMGLVERNSLASYWDTNTVLSIPLFSAVMPRNRYQILLRFLHFNDNTTAVAPNEPGYDRLYKLRPLIDSLSQRFAEVYTPSQNVCVDESLLLFKGRLKFRQYIPSKRSRYGMKFYKLCESSTGYTSYFMLYEGKDTNLDPPGCPTDLTTSGKIVWELITPLLGRGYHLYVDNFYTSIPLFRALNSLDTPACGTVNRNRKGLPRELLDKKLKRGEVHALRSNELLAIKYSDTKVVFMLTTIHDETMI 424          
BLAST of piggyBac transposable element-derived protein 4-like vs. Ensembl Xenopus
Match: ENSXETT00000042747.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:7:94706384:94707791:-1 gene:ENSXETG00000002351.1 transcript:ENSXETT00000042747.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 234.572 bits (597), Expect = 1.575e-67
Identity = 121/338 (35.80%), Postives = 196/338 (57.99%), Query Frame = 2
Query: 1220 GERIWSKEGNFVPKLHQFQEKPGPKNFRVENEQPIDYFEWFIDSEFMDYVVKETNLYQQQH----PLPSQKKMAKWFDVISNELSVFFAIVMLTGLVSKNELKDYWSVDPLLNTQIFPKTFTRNRLLQIMRYLHFANN------EQKTIDKLFKIGNVVNMVKEKFKNAIIPDRNICIDESLMLWKGRLSFKQYIPSKRHRFGIKLFEMVDCTTQCILNFIIYTGKSTKFRFHEL---LGISGSIVIKLMNMHLDKGHVLYVDNWYSSPPLFEILHYKKTGACGTLRKNRKGLPK--YSGKMKKGELESYNTDKLLFQRWMNKREVFMLSTIHRNGLV 2188
            GE  W    N+VP++  F   PG  +    N + ID+F  +I    +  +V+ TNLY +Q+    PLP   +   W+    NE+  F A+ +  GLV +N L  YW  + +L+  +F     RNR   ++R+LHF +N       +   D+L+K+  +++ + ++F     P +N+C+DESL+L+KGRL F+QYIPSKR R+G+K +++ + +T     F++Y GK T          L  SG IV +L+   L +G+ LYVDN+Y+S PLF  L+   T ACGT+ +NRKGLP+     K+K+GE+ +  +++LL  ++ + + VFML+TIH   ++
Sbjct:   73 GEPAWGPPCNYVPEIPPFTAVPG-ISVDTTNFEIIDFFNLYITEAILQDMVRYTNLYAEQYLASNPLPGFSRAQAWYPTNINEIKRFLALTLAMGLVERNSLASYWDTNTVLSIPLFSAVMPRNRYQILLRFLHFNDNTTAVAPNEPGYDRLYKLRPLIDSLSQRFAEVYTPSQNVCVDESLLLFKGRLKFRQYIPSKRSRYGMKFYKLCESSTGYTSYFMLYEGKDTNLDPPGCPTDLTTSGKIVWELITPLLGRGYHLYVDNFYTSIPLFRALNSLDTPACGTVNRNRKGLPRELLDKKLKRGEVHALRSNELLAIKYSDTKVVFMLTTIHDETMI 409          
BLAST of piggyBac transposable element-derived protein 4-like vs. Ensembl Xenopus
Match: wdtc1 (WD and tetratricopeptide repeats 1 [Source:Xenbase;Acc:XB-GENE-977179])

HSP 1 Score: 234.572 bits (597), Expect = 1.748e-67
Identity = 121/338 (35.80%), Postives = 196/338 (57.99%), Query Frame = 2
Query: 1220 GERIWSKEGNFVPKLHQFQEKPGPKNFRVENEQPIDYFEWFIDSEFMDYVVKETNLYQQQH----PLPSQKKMAKWFDVISNELSVFFAIVMLTGLVSKNELKDYWSVDPLLNTQIFPKTFTRNRLLQIMRYLHFANN------EQKTIDKLFKIGNVVNMVKEKFKNAIIPDRNICIDESLMLWKGRLSFKQYIPSKRHRFGIKLFEMVDCTTQCILNFIIYTGKSTKFRFHEL---LGISGSIVIKLMNMHLDKGHVLYVDNWYSSPPLFEILHYKKTGACGTLRKNRKGLPK--YSGKMKKGELESYNTDKLLFQRWMNKREVFMLSTIHRNGLV 2188
            GE  W    N+VP++  F   PG  +    N + ID+F  +I    +  +V+ TNLY +Q+    PLP   +   W+    NE+  F A+ +  GLV +N L  YW  + +L+  +F     RNR   ++R+LHF +N       +   D+L+K+  +++ + ++F     P +N+C+DESL+L+KGRL F+QYIPSKR R+G+K +++ + +T     F++Y GK T          L  SG IV +L+   L +G+ LYVDN+Y+S PLF  L+   T ACGT+ +NRKGLP+     K+K+GE+ +  +++LL  ++ + + VFML+TIH   ++
Sbjct:   88 GEPAWGPPCNYVPEIPPFTAVPG-LSVDTTNFEIIDFFNLYITEAILQDMVRYTNLYAEQYLASNPLPGFSRAQAWYPTNINEIKRFLALTLAMGLVERNSLASYWDTNTVLSIPLFSAVMPRNRYQILLRFLHFNDNTTAVAPNEPGYDRLYKLRPLIDSLSQRFAEVYTPSQNVCVDESLLLFKGRLKFRQYIPSKRSRYGMKFYKLCESSTGYTSYFMLYEGKDTNLDPPGCPTDLTTSGKIVWELITPLLGRGYHLYVDNFYTSIPLFRALNSLDTPACGTVNRNRKGLPRELLDKKLKRGEVHALRSNELLAIKYSDTKVVFMLTTIHDETMI 424          
BLAST of piggyBac transposable element-derived protein 4-like vs. Ensembl Mouse
Match: Pgbd1 (piggyBac transposable element derived 1 [Source:MGI Symbol;Acc:MGI:2441675])

HSP 1 Score: 59.6918 bits (143), Expect = 7.914e-9
Identity = 42/149 (28.19%), Postives = 69/149 (46.31%), Query Frame = 2
Query: 1295 NFRVENEQPIDYFEWFIDSEFMDYVVKETNLYQQQHPLPSQKKMAKWFDVISNELSVFFAIVMLTGLVSKNELKDYWSVDPLLNTQIFPKTFTRNRLLQIMRYLHFANNEQKTIDKLFKIGNVVNMVKE--KFKNAIIPDRNICIDESL 1735
            N + E   P++ FE F D E  + +V ETN Y       SQK ++   +V   E+   F +++ +G V    +  YW +     T +      R+R   I   LHFA+N  K +D+  K  N+  ++K+   F     P+   C D+S+
Sbjct:  206 NLKSEKLNPVELFELFFDGETFNLIVNETNNYA------SQKNVS--LEVTVQEMRCVFGVLLCSGFVRHPRMGMYWEISDSDQT-LVRNEIRRDRFELIFSCLHFADN--KHLDQKDKFSNLRPLIKQMKNFPLVCPPEEYYCFDKSM 343          
BLAST of piggyBac transposable element-derived protein 4-like vs. Ensembl Mouse
Match: Pgbd1 (piggyBac transposable element derived 1 [Source:MGI Symbol;Acc:MGI:2441675])

HSP 1 Score: 59.6918 bits (143), Expect = 1.053e-8
Identity = 42/149 (28.19%), Postives = 69/149 (46.31%), Query Frame = 2
Query: 1295 NFRVENEQPIDYFEWFIDSEFMDYVVKETNLYQQQHPLPSQKKMAKWFDVISNELSVFFAIVMLTGLVSKNELKDYWSVDPLLNTQIFPKTFTRNRLLQIMRYLHFANNEQKTIDKLFKIGNVVNMVKE--KFKNAIIPDRNICIDESL 1735
            N + E   P++ FE F D E  + +V ETN Y       SQK ++   +V   E+   F +++ +G V    +  YW +     T +      R+R   I   LHFA+N  K +D+  K  N+  ++K+   F     P+   C D+S+
Sbjct:  243 NLKSEKLNPVELFELFFDGETFNLIVNETNNYA------SQKNVS--LEVTVQEMRCVFGVLLCSGFVRHPRMGMYWEISDSDQT-LVRNEIRRDRFELIFSCLHFADN--KHLDQKDKFSNLRPLIKQMKNFPLVCPPEEYYCFDKSM 380          
BLAST of piggyBac transposable element-derived protein 4-like vs. Ensembl Mouse
Match: Pgbd1 (piggyBac transposable element derived 1 [Source:MGI Symbol;Acc:MGI:2441675])

HSP 1 Score: 59.6918 bits (143), Expect = 1.053e-8
Identity = 42/149 (28.19%), Postives = 69/149 (46.31%), Query Frame = 2
Query: 1295 NFRVENEQPIDYFEWFIDSEFMDYVVKETNLYQQQHPLPSQKKMAKWFDVISNELSVFFAIVMLTGLVSKNELKDYWSVDPLLNTQIFPKTFTRNRLLQIMRYLHFANNEQKTIDKLFKIGNVVNMVKE--KFKNAIIPDRNICIDESL 1735
            N + E   P++ FE F D E  + +V ETN Y       SQK ++   +V   E+   F +++ +G V    +  YW +     T +      R+R   I   LHFA+N  K +D+  K  N+  ++K+   F     P+   C D+S+
Sbjct:  243 NLKSEKLNPVELFELFFDGETFNLIVNETNNYA------SQKNVS--LEVTVQEMRCVFGVLLCSGFVRHPRMGMYWEISDSDQT-LVRNEIRRDRFELIFSCLHFADN--KHLDQKDKFSNLRPLIKQMKNFPLVCPPEEYYCFDKSM 380          
BLAST of piggyBac transposable element-derived protein 4-like vs. UniProt/SwissProt
Match: sp|Q96DM1|PGBD4_HUMAN (PiggyBac transposable element-derived protein 4 OS=Homo sapiens OX=9606 GN=PGBD4 PE=2 SV=3)

HSP 1 Score: 206.838 bits (525), Expect = 4.971e-65
Identity = 138/440 (31.36%), Postives = 222/440 (50.45%), Query Frame = 2
Query: 1232 WSKEGNFVPKLHQFQEKPGPKNFRVENEQPIDYFEWFIDSEFMDYVVKETN----LYQQQHPLPSQ-KKMAKWFDVISNELSVFFAIVMLTGLVSKNELKDYWSVDPLLNTQIFPKTFTRNRLLQIMRYLHFANN------EQKTIDKLFKIGNVVNMVKEKFKNAIIPDRNICIDESLMLWKGRLSFKQYIPSKRHRFGIKLFEMVDCTTQCILNFIIYTGKSTKFRFHELLGISGSIVIKLMNMHLDKGHVLYVDNWYSSPPLFEILHYKKTGACGTLRKNRKGLP-KYSGKMKKGELESYNTDKLLFQRWMNKREVFMLSTIHRNGLVESTKTNFQSFEKIMKPKQLKITVYSWVVWIILIXXXXXXXXXXXX------------HIIDMVVHNAYCIYRAKNKSR-IQLADFRLILVRQLIEKYGSQRSERV-GRP 2473
            WS       + + F   PG K    +   P+ YFE F   E +  + +ETN    L   + P P    +M KW D  ++EL VFFA+++L G+V K EL+ +WS  PLL+T    +  T  R L + R LHF NN      + K    L KI  V + +  KF     P+RNI +DESLML+KG L+ KQY+P+KR RFG+KL+ + +  +  + N +++TG     +       S  IV+ L+N  L +G+ +++DN+  SP LF  LH  +T A GT R NRK +P     ++ KG   +    +L+  +W + +EV MLST H + ++E    N ++ +K  +P+   I  Y+  +  +                          H++ + V N+Y +++  N    +   +FRL L+ +++EK+     + + GRP
Sbjct:   75 WSARAMIPRQRYDFTGTPGRKVDVSDITDPLQYFELFFTEELVSKITRETNAQAALLASKPPGPKGFSRMDKWKDTDNDELKVFFAVMLLQGIVQKPELEMFWSTRPLLDTPYLRQIMTGERFLLLFRCLHFVNNSSISAGQSKAQISLQKIKPVFDFLVNKFSTVYTPNRNIAVDESLMLFKGPLAMKQYLPTKRVRFGLKLYVLCESQSGYVWNALVHTGPGMNLKDSADGLKSSRIVLTLVNDLLGQGYCVFLDNFNISPMLFRELHQNRTDAVGTARLNRKQIPNDLKKRIAKGTTVARFCGELMALKWCDGKEVTMLSTFHNDTVIE---VNNRNGKKTKRPRV--IVDYNENMGAVDSADQMLTSYPSERKRHKVWYKKFFHHLLHITVLNSYILFKKDNPEHTMSHINFRLALIERMLEKHHKPGQQHLRGRP 509          

HSP 2 Score: 65.4698 bits (158), Expect = 4.971e-65
Identity = 35/68 (51.47%), Postives = 39/68 (57.35%), Query Frame = 1
Query: 2491 LRLQGRHFPDKIPINSG-DNGKKCCVVCSTSSD------RKRTTIMCQLCDVPLCIVPCFKDYHTKVN 2673
            LRL GRHFP  IP  SG  N    C +C +  D      RK T   C  CDVPLC+VPCF+ YHTK N
Sbjct:  517 LRLSGRHFPKSIPATSGKQNPTGRCKICCSQYDKDGKKIRKETRYFCAECDVPLCVVPCFEIYHTKKN 584          
BLAST of piggyBac transposable element-derived protein 4-like vs. UniProt/SwissProt
Match: sp|Q6P3X8|PGBD2_HUMAN (PiggyBac transposable element-derived protein 2 OS=Homo sapiens OX=9606 GN=PGBD2 PE=2 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 1.184e-15
Identity = 82/330 (24.85%), Postives = 142/330 (43.03%), Query Frame = 2
Query: 1223 ERIWSKEGNFVPKLHQF-QEKPGPKNFRVENEQPIDYFEWFIDSEFMDYVVKETNLYQQQHPLPSQKKMAKWFDVISNELSVFFAIVMLTGLVSKNELKDYWSVDPLLNTQIFPKTFTRNRLLQIMRYLHFA-NNEQKTIDKLFKIGNVVNMVKEKFKNAIIPDRNICIDESLMLWKGRLSFKQYIPSKRHRFGIKLFEMVDCTTQCILNFIIYTGKSTKFRF---HELLGISGSIVIKLMNMHLDKGHV---LYVDNWYSSPPLFEILHYKKTGACGTLRKNRKGL-----PKYSGKMKKGELESYNTD---KLLFQRWMNKREVFMLS 2164
            +RIW+K  +  P    +    P  ++ + +   P+  FE F D   ++++V ETN Y  Q  +           + + EL     I++L+G +S    + +W   P  +  +      R+R   I  YLHFA NNE    D+  K+  ++  +   F+     +      ES+  + G    KQ    K  R G K++    C T     ++++   S    F      L + GS+VIK ++   ++G +   ++ D  ++S  L  IL  K   A GT+R+ R        PK   KMK+G  + Y  D   +++  RW +   V + S
Sbjct:  109 QRIWTKR-DIRPDFGSWTASDPHIEDLKSQELSPVGLFELFFDEGTINFIVNETNRYAWQKNVN--------LSLTAQELKCVLGILILSGYISYPRRRMFWETSPDSHHHLVADAIRRDRFELIFSYLHFADNNELDASDRFAKVRPLIIRMNCNFQKHAPLEEFYSFGESMCEYFGHRGSKQLHRGKPVRLGYKIW----CGTTS-RGYLVWFEPSQGTLFTKPDRSLDLGGSMVIKFVDALQERGFLPYHIFFDKVFTSVKLMSILRKKGVKATGTVREYRTERCPLKDPKELKKMKRGSFD-YKVDESEEIIVCRWHDSSVVNICS 423          
BLAST of piggyBac transposable element-derived protein 4-like vs. UniProt/SwissProt
Match: sp|Q8N328|PGBD3_HUMAN (PiggyBac transposable element-derived protein 3 OS=Homo sapiens OX=9606 GN=PGBD3 PE=1 SV=3)

HSP 1 Score: 83.5741 bits (205), Expect = 3.862e-15
Identity = 68/261 (26.05%), Postives = 117/261 (44.83%), Query Frame = 2
Query: 1289 PKNFRVENEQPIDYFEWFIDSEFMDYVVKETNLYQQQHPLPSQKKMAKWFDVISNELSVFFAIVMLTGLVSKNELKDYWSVDPLLNTQIFPKTFTRNRLLQIMRYLHFANNEQ-KTIDKLFKIGNVVNMVKEKFKNAIIPDRNICIDESLMLWKGRLSFKQYIPSKRHRFGIKLFEMVDCTTQC---ILNFIIYTGKSTKFRFHELLGISGSIVIK----LMNMHLDKGHVLYVDNWYSSPPLFEILHYKKTGACGTLRKN 2047
            P +F      P +  E F+D E ++ +VK +NLY     +           + S+E   F  I+ L+G VS    + +W     ++  +      R+R   I   LH A+N     +DK  K+  +++ + E+    +  +     DE ++ + GR   KQ+I  K  RFG K +    C   C   I  F  Y GK+   + HE  G+  S+V++    L   H  + H ++ +N+++S  L + L      A GT+RK+
Sbjct:  132 PNDFFTVMRTPTEILELFLDDEVIELIVKYSNLYACSKGV--------HLGLTSSEFKCFLGIIFLSGYVSVPRRRMFWEQRTDVHNVLVSAAMRRDRFETIFSNLHVADNANLDPVDKFSKLRPLISKLNERCMKFVPNETYFSFDEFMVPYFGRHGCKQFIRGKPIRFGYKFW----CGATCLGYICWFQPYQGKNPNTK-HEEYGVGASLVLQFSEALTEAHPGQYHFVF-NNFFTSIALLDKLSSMGHQATGTVRKD 378          
BLAST of piggyBac transposable element-derived protein 4-like vs. UniProt/SwissProt
Match: sp|P0DP91|ERPG3_HUMAN (Chimeric ERCC6-PGBD3 protein OS=Homo sapiens OX=9606 GN=ERCC6 PE=1 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 1.202e-14
Identity = 68/261 (26.05%), Postives = 117/261 (44.83%), Query Frame = 2
Query: 1289 PKNFRVENEQPIDYFEWFIDSEFMDYVVKETNLYQQQHPLPSQKKMAKWFDVISNELSVFFAIVMLTGLVSKNELKDYWSVDPLLNTQIFPKTFTRNRLLQIMRYLHFANNEQ-KTIDKLFKIGNVVNMVKEKFKNAIIPDRNICIDESLMLWKGRLSFKQYIPSKRHRFGIKLFEMVDCTTQC---ILNFIIYTGKSTKFRFHELLGISGSIVIK----LMNMHLDKGHVLYVDNWYSSPPLFEILHYKKTGACGTLRKN 2047
            P +F      P +  E F+D E ++ +VK +NLY     +           + S+E   F  I+ L+G VS    + +W     ++  +      R+R   I   LH A+N     +DK  K+  +++ + E+    +  +     DE ++ + GR   KQ+I  K  RFG K +    C   C   I  F  Y GK+   + HE  G+  S+V++    L   H  + H ++ +N+++S  L + L      A GT+RK+
Sbjct:  600 PNDFFTVMRTPTEILELFLDDEVIELIVKYSNLYACSKGV--------HLGLTSSEFKCFLGIIFLSGYVSVPRRRMFWEQRTDVHNVLVSAAMRRDRFETIFSNLHVADNANLDPVDKFSKLRPLISKLNERCMKFVPNETYFSFDEFMVPYFGRHGCKQFIRGKPIRFGYKFW----CGATCLGYICWFQPYQGKNPNTK-HEEYGVGASLVLQFSEALTEAHPGQYHFVF-NNFFTSIALLDKLSSMGHQATGTVRKD 846          
BLAST of piggyBac transposable element-derived protein 4-like vs. UniProt/SwissProt
Match: sp|Q96JS3|PGBD1_HUMAN (PiggyBac transposable element-derived protein 1 OS=Homo sapiens OX=9606 GN=PGBD1 PE=1 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 2.117e-14
Identity = 98/399 (24.56%), Postives = 175/399 (43.86%), Query Frame = 2
Query: 1295 NFRVENEQPIDYFEWFIDSEFMDYVVKETNLYQQQHPLPSQKKMAKWFDVISNELSVFFAIVMLTGLVSKNELKDYWSVDPLLNTQIFPKTFTRNRLLQIMRYLHFANN---EQKTIDKLFKIGNVVNMVKEKFKNAIIPDRNICIDESLMLWKGRLSFKQYIPSKRHRFGIKLFEMVDCTTQCILN-FIIYTGKST-KFRFHELLGISGSIVIKLMNMHLDKGHVLY---VDNWYSSPPLFEILHYKKTGACGTLRKNR-KGLP----KYSGKMKKG--ELESYNTDKLLFQRWMNKREVFMLST---IHRNGLVESTKTNFQSFEKIMKPKQLKI--TVYSWVVWIILIXXXXXXXXXXX-------XHIIDMVVHNAYCIYRAKNK-SRIQLADFR 2407
            N + E   P++ FE F D E  + +V ETN Y       SQK ++   +V   E+   F +++L+G +     + YW V    +  +      R+R   I   LHFA+N   +QK  DK  K+  ++  + + F      +   C D+S+          Q++  K  R G K++     TTQ  L  F  Y  +ST K      LG+ G++V+   ++ L++G   Y    D++++S  L   L  K   A GT+R+NR +  P    ++  KMK+G  +      ++++  RW     + + S    I     V     + +   +I +P  +K+       V  +  I    +   +          ++ID+ ++NA+ ++RA N  + +   DFR
Sbjct:  411 NLKSEKLNPVELFELFFDDETFNLIVNETNNYA------SQKNVS--LEVTVQEMRCVFGVLLLSGFMRHPRREMYWEVSD-TDQNLVRDAIRRDRFELIFSNLHFADNGHLDQK--DKFTKLRPLIKQMNKNFLLYAPLEEYYCFDKSMCEC---FDSDQFLNGKPIRIGYKIW--CGTTTQGYLVWFEPYQEESTMKVDEDPDLGLGGNLVMNFADVLLERGQYPYHLCFDSFFTSVKLLSALKKKGVRATGTIRENRTEKCPLMNVEHMKKMKRGYFDFRIEENNEIILCRWYGDGIISLCSNAVGIEPVNEVSCCDADNEEIPQISQPSIVKVYDECKEGVAKMDQIISKYRVRIRSKKWYSILVSYMIDVAMNNAWQLHRACNPGASLDPLDFR 793          
BLAST of piggyBac transposable element-derived protein 4-like vs. TrEMBL
Match: A0A090X8N5 (Putative piggybac (Fragment) OS=Ixodes ricinus OX=34613 PE=2 SV=1)

HSP 1 Score: 315.849 bits (808), Expect = 3.054e-93
Identity = 176/437 (40.27%), Postives = 270/437 (61.78%), Query Frame = 2
Query: 1214 RAGERIWSKEGNFVPKLHQFQE----KPGPKNFRVENEQPIDYFEWFIDSEFMDYVVKETNLYQQQ---HP-LPSQKKMAKWFDVISNELSVFFAIVMLTGLVSKNELKDYWSVDPLLNTQIFPKTFTRNRLLQIMRYLHFANNEQKTIDKLFKIGNVVNMVKEKFKNAIIPDRNICIDESLMLWKGRLSFKQYIPSKRHRFGIKLFEMVDCTTQCILNFIIYTGKSTKFRFHELLGISGSIVIKLMNMHLDKGHVLYVDNWYSSPPLFEILHYKKTGACGTLRKNRKGLPKYSGKMKKGELESYNTDKLLFQRWMNKREVFMLSTIHRNGLVESTKTNFQSFEKIMKPK---------QLKITVYSWVVWIILIXXXXXXXXXXXXHIIDMVVHNAYCIYRAKNKSRIQLADFRLILVRQLIEKYGSQRSERVGRP 2473
            R  E  W K  +F P +  F      +P     + + ++  DYF+ + D      +  ETN Y  Q    P L  + ++  W DV  +E+  F A V+L GLV KN ++DYW+ DP+  T    K F+ NR   ++R LHF+ +     D+L KI  ++  ++ KF + ++P +++CI+ES+M W+GRLSF+QY+PSKRHRFG+K+F + D  T  IL FI+YTG ST     + LG SGS+V++L+N +L KGH L+VDNWY+SP LF+ L  K+T ACGT+R+NRKGLPK+  KM+KGE+E+++TD LL  +W +K+EV ML+++H   L ++ K + ++     KP           L   V   + +   I KT KWYKKFFFH++DM + NA+ ++R K+ S+I  A+FR  ++ Q++E++ ++R  + GRP
Sbjct:   50 RQNETDWKKGEDFSPSIFPFDASHSGQPAGTLLQPDAKE-ADYFKLYFDEGVASLIADETNDYAHQLIAQPDLARKSRLKAWVDVGLSEIYCFLAAVLLMGLVRKNAVRDYWTTDPMTETPFLSKLFSVNRFCLLLRVLHFSASTD-AADRLRKIRPLMETLQAKFASLLVPYQDLCINESMMPWRGRLSFRQYLPSKRHRFGVKMFVLCDVMTGYILRFIVYTGASTTMTMMKELGFSGSVVLELLNHYLGKGHSLFVDNWYTSPALFQYLQGKQTNACGTVRQNRKGLPKFKKKMRKGEVETFHTDTLLALKWCDKKEVHMLTSMHGASLEDTGKVDRRTGTPQKKPACVLEYNQRMGLVDKVDMPLSFTESIRKTLKWYKKFFFHLLDMSLLNAFLLHREKSASKITFAEFRRRVIYQIVEEHHTER-RKGGRP 483          
BLAST of piggyBac transposable element-derived protein 4-like vs. TrEMBL
Match: A0A1Y1NAK0 (Uncharacterized protein OS=Photinus pyralis OX=7054 PE=4 SV=1)

HSP 1 Score: 299.286 bits (765), Expect = 2.698e-88
Identity = 173/438 (39.50%), Postives = 267/438 (60.96%), Query Frame = 2
Query: 1229 IWSKEGNFVPKLHQFQE-KPGPKN-FRVENEQPIDYFEWFIDSEFMDYVVKETNLYQQQHPLPSQKKMAKWFDVISNELSVFFAIVMLTGLVSKNELKDYWSVDPLLNTQIFPKTFTRNRLLQIMRYLHFANNEQKTIDKLFKIGNVVNMVKEKFKNAIIPDRNICIDESLMLWKGRLSFKQYIPSKRHRFGIKLFEMVDCTTQCILNFIIYTGKSTKFRFHEL--LGISGSIVIKLMNMHLDKGHVLYVDNWYSSPPLFEILHYKKTGACGTLRKNRKGLPKYSGKMKKGELESYNTDKLLFQRWMNKREVFMLSTIHRNGLVESTKTNFQSFEKIMKPKQLKITVYSWVVWII-----------LIXXXXXXXXXXXXHIIDMVVHNAYCIYRAKNKSRIQLADFRLILVRQLIEKYGSQRSERVGRPPLSKTNFV 2497
            +W  +  F+PK H F     G KN F  EN + +D+F   +  + + ++V+ETN Y       SQ     W D+  N++ VF A+ ML     K  +K+YWS++PLL++ IF KT +R+R L I+  LHFANNE ++  +L+K+ NV+N++KE+ ++   P   + +DES++L+KGRLSFKQYI +KRHRFG+KL+ + DC T  +L+FI+Y GK T     EL  +G SGSIV  L+  +LD GH LY DN+YSSP L   L  +KT +CGT+R  RK +PK S  + +G++   +++K+L  RW ++R+V M+ST+H N +V   K +  + E + KP  L I  Y+  +  I            + K+ KWYKK FFH ID+++ N++ ++  K   ++  A F+L +++QL+++Y S+R   VGR  L     V
Sbjct:  127 LWG-DDEFIPKKHPFDNTSSGLKNEFLTENSEEVDFFLNLLPEDIVSHIVQETNRYA------SQNHTQNWKDIDLNDMYVFLALTMLMARNKKLAIKEYWSLNPLLSSPIFRKTMSRDRYLGILSSLHFANNEDQSTTRLYKVENVLNLMKERVRSQFYPFEWLAVDESMVLFKGRLSFKQYIKTKRHRFGVKLYVLCDCETGIVLDFIVYIGKDTNAYVEELKGMGSSGSIVGTLLKSYLDYGHSLYTDNYYSSPILSNYLFDRKTNSCGTVRLTRKHMPKLSKNINRGDVSWKSSEKMLVIRWKDRRDVTMISTMHENKMVSLEKKDRTTGEPVKKP--LCIVNYNERMGAIDRADMMLSSLECMRKSLKWYKKIFFHTIDLLLLNSHAMFLLKRSDKVPFAKFQLAVIQQLLDRYNSKRPGNVGRQSLGDKRLV 555          

HSP 2 Score: 58.5362 bits (140), Expect = 2.698e-88
Identity = 29/62 (46.77%), Postives = 36/62 (58.06%), Query Frame = 1
Query: 2494 RLQGRHFPDKIPINSGDNGK-KCCVVCSTSSDRKRTTIMCQLCDVPLCIVPCFKDYHTKVNL 2676
            RL  RHFP  +P +       + CVVCS    R  +  MC+ CDV LC+VPCF+ YHTK  L
Sbjct:  553 RLVERHFPSIVPASEKKKSAVRRCVVCSRQKKRSESRYMCEPCDVGLCVVPCFQLYHTKKTL 614          
BLAST of piggyBac transposable element-derived protein 4-like vs. TrEMBL
Match: A0A4W5LLZ4 (Uncharacterized protein OS=Hucho hucho OX=62062 PE=4 SV=1)

HSP 1 Score: 297.36 bits (760), Expect = 2.721e-88
Identity = 173/443 (39.05%), Postives = 255/443 (57.56%), Query Frame = 2
Query: 1229 IWSKEGNFVPKLHQFQEKPGPKNFRVENE----QPIDY------FEWFIDSEFMDYVVKETNLY----QQQHPLPSQKKMAKWFDVISNELSVFFAIVMLTGLVSKNELKDYWSVDPLLNTQIFPKTFTRNRLLQIMRYLHFANNEQKTI-DKLFKIGNVVNMVKEKFKNAIIPDRNICIDESLMLWKGRLSFKQYIPSKRHRFGIKLFEMVDCTTQCILNFIIYTGKSTKFRFHELLGISGSIVIKLMNMHLDKGHVLYVDNWYSSPPLFEILHYKKTGACGTLRKNRKGLPKYSG-KMKKGELESYNTDKLLFQRWMNKREVFMLSTIHRNGLVESTKTNFQSFEKIMKPK-----QLKITVYSWV----VWIILIXXXXXXXXXXXXHIIDMVVHNAYCIYRAKNKSRIQLADFRLILVRQLIEKYGSQRSERVGRPPLS 2482
            IW    +F+P        PGP     E++    +P+ +      F+ F+  E +  +V+ETN Y    Q++     + K+AKW     NE+  F   V+L G+V KN L++YWS DP+  T  F   F+++R L ++R LHF NN    + D L KI NV+  +   F    +P +++CIDESLMLWKGRL+F+QYIPSKRHRFG+K F M D  T  + + I+YTG +T  + +E LG+SGS+V+ ++  HL KGH LYVDNWYSSP LF+ L    TGACGT+R NRKG+P +   KM++GE+E     + L  +W +KR+V +LST+H   +  + K +  + E+ +KP       LK+           ++    KTTKWYKK FFH+ID  V N+  ++R      I    +R  L+R+L+E++ + R    G  P +
Sbjct:   86 IWKAASHFIP--------PGPAVCFDESQSGVQRPLPFPTEAECFKLFLTEELVGNIVEETNRYALELQEKREPGVRGKLAKWVTTTINEMYTFLVTVLLMGIVKKNPLREYWSTDPMFATPFFATLFSQDRFLALLRCLHFVNNATAILSDPLHKIRNVIISLTSAFGRVFVPYKDLCIDESLMLWKGRLAFRQYIPSKRHRFGVKFFVMCDVKTGFVQDIIVYTGSTTDIKHYEGLGVSGSVVMTMLAPHLGKGHTLYVDNWYSSPTLFQHLLSNSTGACGTVRSNRKGMPAFGCRKMQRGEVEFKENGQQLALKWHDKRDVHVLSTVHTATVSATGKVDHLTGERKIKPDCVLDYNLKMGAVDKADMINSFVECARKTTKWYKKIFFHLIDTAVLNSSIVHRQLTGKVITYQKYRENLMRELLEEHHTPRRPSTGGRPAA 520          

HSP 2 Score: 60.4622 bits (145), Expect = 2.721e-88
Identity = 31/66 (46.97%), Postives = 40/66 (60.61%), Query Frame = 1
Query: 2485 NQLRLQGRHFPDKIPINS--GDNGKKCCVVCST----SSDRKRTTIMCQLCDVPLCIVPCFKDYHT 2664
            N LRL  RHFP K+P  +  G + ++ C VC +    S  RK T  MC  CD PLC+ PCF++YHT
Sbjct:  522 NPLRLTARHFPCKVPQTAAQGSHTRRHCKVCLSGTRRSKQRKLTKYMCLACDTPLCVSPCFEEYHT 587          
BLAST of piggyBac transposable element-derived protein 4-like vs. TrEMBL
Match: A0A3N0XE89 (PiggyBac transposable element-derived protein 4 OS=Anabarilius grahami OX=495550 GN=DPX16_20178 PE=4 SV=1)

HSP 1 Score: 301.212 bits (770), Expect = 3.272e-87
Identity = 168/402 (41.79%), Postives = 238/402 (59.20%), Query Frame = 2
Query: 1310 NEQPIDYFEWFIDSEFMDYVVKETN--LYQQQHPLPSQKKMAKWFDVISNELSVFFAIVMLTGLVSKNELKDYWSVDPLLNTQIFPKTFTRNRLLQIMRYLHFANNEQKTI-DKLFKIGNVVNMVKEKFKNAIIPDRNICIDESLMLWKGRLSFKQYIPSKRHRFGIKLFEMVDCTTQCILNFIIYTGKSTKFRFHELLGISGSIVIKLMNMHLDKGHVLYVDNWYSSPPLFEILHYKKTGACGTLRKNRKGLPKYSGKMKKGELESYNTDKLLFQRWMNKREVFMLSTIHRNGLVESTKTNFQSFEKIMKPKQL-----KITVYSWV----VWIILIXXXXXXXXXXXXHIIDMVVHNAYCIYRAKNKSRIQLADFRLILVRQLIEKYGSQRSERV-GRPP 2476
            N    D F+ F +   ++ VV++TN   YQ +       K+AKW +   NE+  F A V++ GLV K  L+DYW+ DP++ T  FP  F+ +R   ++R LHFA+N    + D L KI +V   +   F    +P R++CIDESL+LWKGRL F+QYIPSKR RFGIKLF + D  T  I+N  +YTG ST       LG+SGS+V+ L+  +L +GH LYVDNWY+SP LF  L   KTGACGT+R NRKG+P +  KM  GE E  +   +L  +W ++R+V ML+T+H   +  S K +  +  + +KP+ +     K+     V     ++    KT KWYKK FFH +D+ V NA+ +Y+ K  S +    FR  LVRQL+E++ + R     GRPP
Sbjct:   94 NPSEADCFKLFRNEPIVEQVVQKTNKYAYQLKESATVPGKLAKWAETTVNEICTFLAAVIVMGLVRKGSLRDYWTTDPVMQTPFFPTLFSLDRFQVLLRALHFADNTTANLRDPLNKIRSVFTSLMATFGQLFVPHRDLCIDESLLLWKGRLGFRQYIPSKRKRFGIKLFMLCDVLTGYIINVKVYTGSSTDITHTPGLGVSGSVVLTLLEPYLGRGHTLYVDNWYTSPTLFHHLLRAKTGACGTVRSNRKGMPCFRDKMCSGEAEFKSCKDMLAVKWHDRRDVHMLTTVHSANMSTSGKIDHATGTEKIKPQCVLNYNKKMGAVDKVDMMDSFVGCTRKTLKWYKKLFFHFVDLAVQNAFIVYKVKQDSSLTYQKFRQNLVRQLVEEHHNPRKPSTGGRPP 495          
BLAST of piggyBac transposable element-derived protein 4-like vs. TrEMBL
Match: J9K5H3 (DDE_Tnp_1_7 domain-containing protein OS=Acyrthosiphon pisum OX=7029 PE=4 SV=2)

HSP 1 Score: 299.671 bits (766), Expect = 6.553e-87
Identity = 188/433 (43.42%), Postives = 262/433 (60.51%), Query Frame = 2
Query: 1232 WSKEGNFVPKLHQF-QEKPG-PKNFRV-ENEQPIDYFEWFIDSEFMDYVVKETNLYQQQHPLPS--QKKMAKWFDVISNELSVFFAIVMLTGLVSKNELKDYWSVDPLLNTQIFPKTFTRNRLLQIMRYLHFANNE-QKTIDKLFKIGNVVNMVKEKFKNAIIPDRNICIDESLMLWKGRLSFKQYIPSKRHRFGIKLFEMVDCTTQCILNFIIYTGKSTKFRF-HELLGISGSIVIKLMNMHLDKGHVLYVDNWYSSPPLFEILHYKKTGACGTLRKNRKGLPKYSG-KMKKGELESYNTDKLLFQRWMNKREVFMLSTIHRNGLVESTKTNFQSFEKI-MKPKQLK---------ITVYSWVVWIILIXXXXXXXXXXXXHIIDMVVHNAYCIYRAKNKSRIQLADFRLILVRQLIEKYGSQRSERVGRPP 2476
            W     F PK+HQF   K G  K F +  N   +D+FE  +    +  V  ETN Y +Q+        + A W+D  S EL +F ++ ML     K ++ +YWS DPLL + IF K  +RNR   ++RY+HF NN  Q T D+LFKI  V+  +K  F++A++P +N+ IDESL+LWKGRLSFKQ+I +KRHRFGIK F + D  T  IL+FIIYTGK+T+    +  LG SG++V  LM  +L+KGH LY DNWY+SP L   LH KKT  CGT+R NR+G+P +   K + G+ ES +T K+L  +WM++REV ML+TIH +  +       Q   KI MKPK +K               +  +  + KT KWYKK FFH+ID+ + NAY +Y+    + I +A F++ L+RQ+IEKY + R  +  RPP
Sbjct:  112 WKSGTPFQPKVHQFCPSKSGIQKEFELNSNSTILDFFEALVTPFLLGKVAYETNEYYRQNTESHIMSCRNASWYDTTSEELYLFISVQMLMARNKKLDISEYWSTDPLLYSPIFGKIMSRNRFQLLLRYIHFCNNNNQVTNDRLFKIDMVLQDIKNNFRSAMVPFQNLVIDESLVLWKGRLSFKQFIRTKRHRFGIKFFILCDVETDYILDFIIYTGKTTRLVLCNPNLGQSGAVVKTLMKKYLNKGHTLYTDNWYTSPILSMYLHKKKTNTCGTVRCNRRGMPPFKKIKFQPGQTESKHTGKMLTIKWMDRREVHMLTTIHGDEQLP-----IQKHGKITMKPKCVKEYNENMGSVDKTDMLLSSVECVRKTIKWYKKIFFHLIDLSLLNAYSLYKTVTGNHIPIAQFQMELIRQIIEKYQTDRLPK-SRPP 538          
BLAST of piggyBac transposable element-derived protein 4-like vs. Ensembl Cavefish
Match: ENSAMXT00000025849.2 (pep primary_assembly:Astyanax_mexicanus-2.0:6:20558813:20568326:-1 gene:ENSAMXG00000025123.2 transcript:ENSAMXT00000025849.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 154.066 bits (388), Expect = 5.548e-39
Identity = 123/457 (26.91%), Postives = 215/457 (47.05%), Query Frame = 2
Query: 1241 EGNFVPKLHQFQ--EKPGPKNFRVENEQPIDYFEWFIDSEFMDYVVKETNLYQQQHPLPSQKKMAKWFDVISNELSVFFAIVMLTGLVSKNELKDYWSVDPLLNTQIFPKTFTRNRLLQIMRYLHFA-------NNEQKTI---DKLFKIGNVVNMVKEKFKNAIIPDRNICIDESLMLWKGRLSFKQYIPSKRHRFGIKLFEMVDCTTQCILNFIIYTGKSTKFRFHELLGISGSIVIKLMNM-HLDKGHVLYVDNWYSSPPLFEILHYKKTGACGTLRKNRKGLPK-----YSGKMKKGELESYNTDKLLFQRWMNKREVFMLSTIH--RNGLVEST--KTNFQSFEKIMKPKQLKITVYSWVVWIILIXXXXXXXXXXXX-----------HIIDMVVHNAYCIYRAKNKSRIQLADFRLILV-RQLIEKYGSQRSERVGRPPLSKTNFVYKED 2509
            + +  P + +FQ   KPGP+        P++ F+ F   E +  + + TN  +Q     S  K  KW D+   +   +  +V+   LV  + + DYW  D L +  +  +  +R+R   I   LH +       NN +K     DKLF++  +++ +K   K+   P +N+ +DE ++  K +    QY+ +K  ++G KLF + D      ++F +YTGKS     H   G+S  +V+ L+   +L  G+ +Y+DN+YSSP LF  LH  K  ACGT R NRKG P+      + + ++G +       +++ +WM+ REV + STIH   +G +  +  K +  S+ K+  P    +  Y+  +  + +      Y                H +D+   N++ +++      + LA  +  L  R  +EK     SE  GRP L+K++     D
Sbjct:   50 DPDIAPSVSRFQPARKPGPQLISSSTYTPLELFKLFFPFETVQTMCQNTN--KQAAKNQSMGKKYKWTDLDVEDFYKYCGLVLYMSLVKVDSISDYWRQDHLFSLSLPAQIMSRDRYRTISWNLHLSDPDEVVKNNRKKGTAEHDKLFQLKPLMDTIKNACKSFYHPHKNLAVDERMVASKAKNVMTQYMKAKPIKWGFKLFVLADSRNGYTVDFSVYTGKSDIPSGH---GLSYDVVMSLVQPGYLGTGYHIYMDNFYSSPKLFRALHECKFSACGTYRDNRKGCPQTDVNALTKRSERGSIRWIRDGPIVYVKWMDTREVSVCSTIHPAHSGEIAQSRMKQDDGSWAKVSIPCPTPVKQYNQHMGGVDLSDQLIQYYSAQHKTMRWYRKMFYHFLDIATTNSFILHK-----ELCLAQEKQPLTQRAFLEKL---TSELCGRPLLTKSSAKSPAD 493          
BLAST of piggyBac transposable element-derived protein 4-like vs. Ensembl Cavefish
Match: ENSAMXT00000030524.1 (pep primary_assembly:Astyanax_mexicanus-2.0:8:5821371:5823572:-1 gene:ENSAMXG00000031777.1 transcript:ENSAMXT00000030524.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 152.91 bits (385), Expect = 3.382e-38
Identity = 96/329 (29.18%), Postives = 167/329 (50.76%), Query Frame = 2
Query: 1241 EGNFVPKLHQFQEK--PGPKNFRVENEQPIDYFEWFIDSEFMDYVVKETNLYQQQHPLPSQKKMAKWFDVISNELSVFFAIVMLTGLVSKNELKDYWSVDPLLNTQIFPKTFTRNRLLQIMRYLHFAN------NEQK----TIDKLFKIGNVVNMVKEKFKNAIIPDRNICIDESLMLWKGRLSFKQYIPSKRHRFGIKLFEMVDCTTQCILNFIIYTGKSTKFRFHELLGISGSIVIKLMNM-HLDKGHVLYVDNWYSSPPLFEILHYKKTGACGTLRKNRKGLPKY-----SGKMKKGELESYNTDKLLFQRWMNKREVFMLSTIH 2173
            + +  P + +FQ    PGP+     +  P+D F+ F   + +  + + TN  +Q     S+ K  KW D+ + E   +  +V+   L+  + + DYW  D L +  +  +  +R+R   +   +H ++      N+QK      DKLF++  ++  +K   K    P + + +DE ++  K +    QY+ SK  ++G KLF + D      ++F +YTGKS     H   G+S  +V+ L+   +L  G+ +Y+DN+YSSP LF  LH  K  ACGT R+NRKG P+      + + ++G +       +++ +WM+ R V M STIH
Sbjct:  158 DPDTAPSVSRFQPARTPGPQLISASSYTPLDLFKLFFPVQTVQTLCQNTN--KQAAKNLSEGKKYKWTDLDAEEFYKYCGLVLYMALIKVDSVSDYWRQDHLFSLSLPSQIMSRDRYRTVSWNIHLSDPDEDVHNDQKKGTAQHDKLFRLKPLMETIKNACKAFYHPHKELAVDERMVASKAKTGMTQYMKSKPTKWGFKLFVLADSRNGYTVDFSVYTGKSDIPSGH---GLSYDVVMSLVQPGYLGTGYHIYMDNFYSSPKLFRALHECKFSACGTYRENRKGCPQTDVNALTKRSERGSIRWIRDGPIVYVKWMDTRAVSMCSTIH 481          
BLAST of piggyBac transposable element-derived protein 4-like vs. Ensembl Cavefish
Match: ENSAMXT00000043919.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02002039.1:240413:244210:1 gene:ENSAMXG00000040755.1 transcript:ENSAMXT00000043919.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 149.443 bits (376), Expect = 5.061e-37
Identity = 105/342 (30.70%), Postives = 161/342 (47.08%), Query Frame = 2
Query: 1256 PKLHQFQEK--PGPKNFRVENEQPIDYFEWFIDSEFMDYVVKETNLYQQQHPLPSQKKMAKWFDVISNELSVFFAIVMLTGLVSKNELKDYWSVDPLLNTQIFPKTFTRNRLLQIMRYLHFANNEQKT----------IDKLFKIGNVVNMVKEKFKNAIIPDRNICIDESLMLWKGRLSFKQYIPSKRHRFGIKLFEMVDCTTQCILNFIIYTGKSTKFRFHELLGISGSIVIKLMNMH-LDKGHVLYVDNWYSSPPLFEILHYKKTGACGTLRKNRKG--LPK---YSGKMKKGELESYNTDKLLFQRWMNKREVFMLSTIHRNGLVESTKTNFQSFEKI 2227
            P L +F  K  PGP+    +   P+  F+ F  S  +  +V  TN + +      +K   KW  V   E   F  +V+  GLV    + D WS   L   Q      +  R   I   LH ++ E+             D+LFKI  +   +     +   P R + IDE ++  K R   KQY+ +K  ++G KLF + D  +    NF +Y GKS    F    G+S   V  L++   L  G+++Y+DN+Y+SP L   L  + T ACGTLR N+ G  LPK      + ++G++  Y   KLL+ +WM+ REV M ST+H+    ++ K   +S E +
Sbjct:  153 PSLFRFHPKRPPGPQLLPGKTYSPLQLFQLFFSSSVVQTLVDNTNKFGKISAAGGKK--LKWTPVTVKEFYAFIGLVVYMGLVKVKSIMDLWSKKQLYQFQFPSMVMSSKRFTAISSNLHLSDPEEDAENMKKKGTPDYDRLFKIKPLYTDILSACHSFFQPRRELSIDERMVASKARTGLKQYMKAKPTKWGFKLFILADSASGYTWNFFVYEGKSP---FASGKGLSYDTVKTLLDYSLLGHGYMVYMDNFYTSPTLLSDLLQENTLACGTLRTNQLGLSLPKNNELPKRAERGDIRWYRQGKLLYVKWMDTREVTMCSTMHKAYKGDTVKRKVKSKEGV 489          
BLAST of piggyBac transposable element-derived protein 4-like vs. Ensembl Cavefish
Match: ENSAMXT00000029839.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000180.1:82354:86597:-1 gene:ENSAMXG00000035772.1 transcript:ENSAMXT00000029839.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 141.739 bits (356), Expect = 8.163e-35
Identity = 117/437 (26.77%), Postives = 192/437 (43.94%), Query Frame = 2
Query: 1286 GPKNFRVENEQPIDYFEWFIDSEFMDYVVKETNLYQQQHPLPSQKKMAKWFDVISNELSVFFAIVMLTGLVSKNELKDYWSVDPLLNTQIFPKTFTRNRLLQIMRYLHFANN---EQKTIDKLFKIGNVVNMVKEKFKNAIIPDRNICIDESLMLWKGRLSFKQYIPSKRHRFGIKLFEMVDCTTQCILNFIIYTGKSTKFRFHELLGISGSIVIKLMNMHLDKGHVLYVDNWYSSPPLFEILHYKKTGACGTLRKNR-KGLPKYSGKMKKGELES-------YNTDKLLFQRWMNKREVFMLSTIHRNGLVESTKTNFQSFEK-----IMKPKQLKITVYSWVVWIILIXXXXXXXXXXXX-----------HIIDMVVHNAYCIYRAKNKSRIQLADFRLILVRQLIEKYGSQRSERVGR----PPLSKTNFVYK 2503
            G     VE   PID+F      + ++ +V  TNLY  Q     + K+A    + S E   F  I M+   V     + YWS +  L  ++       NR  QI+RY+HF +N   + K  D+  KI  V++ +KE F++A+ PD    +DE ++ +KGRLS KQY+P K   +GIK++     ++  + NF  Y G +        LG++G +V++L     DK H ++ DN++ + PL + L ++     GT R NR  G  +   K K+ + E         N   +   RW++   + M S+    GL  +      S ++     I +P    + +Y+  +  + +                       H +D+   NA+ +YR        L  F+  + R LI   GS +    GR    PP +K   V K
Sbjct:   85 GESKMNVEGADPIDFFMHLFTQDMINDIVHNTNLYAVQK---GKDKLA----LTSEEFKTFLGINMVMSYVRYPRSRMYWSSETGLRLELIADAMPVNRFEQILRYMHFVDNYSLDPKNADRFVKIRPVLDALKETFQSALDPDEFQSVDEMMIPYKGRLSIKQYVPKKPKPWGIKVWVRAG-SSGYMYNFEPYQGPAGGRGEISQLGMAGDVVMRLCQDIQDKNHKVFFDNFFCTIPLLQALEHQGIYGTGTCRSNRLHGAQEKLKKEKQMKQEGRGSVSVVTNAQNITITRWLDSSVIHMASSC--TGLSPTDVAQRWSKKEKRMLNIQRP--FSVKLYNQHMGGVDLMDQCVAMYPHRHRNKRWYIRVFFHFLDVTTVNAWLLYRMSGNEAKDLLHFKASIARALINA-GSVKIHTRGRPSATPPPAKRRAVSK 508          
BLAST of piggyBac transposable element-derived protein 4-like vs. Ensembl Cavefish
Match: ENSAMXT00000014953.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001957.1:155693:158756:-1 gene:ENSAMXG00000014528.2 transcript:ENSAMXT00000014953.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 139.043 bits (349), Expect = 5.188e-34
Identity = 124/462 (26.84%), Postives = 202/462 (43.72%), Query Frame = 2
Query: 1277 EKPGPKNFRVENEQPI-----------DYFEWFIDSEFMDYVVKETNLYQQQHPLPSQKKMAKWFDVISNELSVFFAIVMLTGLVSKNELKDYWSVDPLLNTQIFPKTFTRN-RLLQIMRYLHFANNE----------QKTIDKLFKIGNVVNMVKEKFKNAIIPDRNICIDESLMLWKGRLSFKQYIPSKRHRFGIKLFEMVDCTTQCILNFIIYTGKSTKFRFHELLGISGSIVIKLMNM-HLDKGHVLYVDNWYSSPPLFEILHYKKTGACGTLRKNRKGLPKYSG-----KMKKGELESYNTDKLLFQRWMNKREVFMLSTIHRNGLVES------TKTNFQSFEKIMKPKQLK---------------ITVYS-------WVVWIILIXXXXXXXXXXXXHIIDMVVHNAYCIYRAKNKSRIQLA----DFRLILVRQLIEKYGSQRSERVGRPPLS 2482
            E+P P  FR      +           D F+ F   E +  +   TN Y  +  +   K+  +W DV ++E+  F +I +  GL+  +  +D W  D  L++  FP +     R   I  YLH ++ +          Q   D LF++           K    P +N+ IDE ++  K R+  KQY+  K  ++G KLF + D  +    +F +Y GK+ K   +   G+S   V+ L+++  L  G+ +YVDN+Y+S  LF  LH    GACGT+R+ R G PK +      K  +GE+       LLF +W   R+V M ST+H+    +S      +K    S ++I  P+ +K               I  YS       W V + L             H +D+ V N++ I++ +  +R Q +     FR +L  +L +         VG+P +S
Sbjct:   77 EQPRPLQFRPRRTPGVQLDFQTDYSASDIFQLFFSKEVIRTLCSNTNKYAARRSVQGIKR--QWTDVNADEMLKFLSITIYMGLMKPSATRDLWRKD-RLHSHPFPASVMAGYRYEAISAYLHMSDPDADVKNDQLRGQPEYDGLFRL-----------KAYYQPHQNLSIDERMVATKARIRMKQYMKDKPTKWGYKLFILADSCSGYTCDFSVYEGKARKPTGN---GLSFDAVVSLLHVPSLGTGYTVYVDNFYTSSMLFRHLHRIGFGACGTIRETRIGFPKTTANALPKKADRGEMRWIRDGPLLFVKWRVTRDVTMCSTVHKAYSGQSVQRRVRSKNGTWSTQQISVPEPVKAYNKFMGGVDLSDALIKYYSVTQKTRRWYVKLFL-------------HFVDIAVVNSFIIHKERALARQQKSLSQKSFREVLCMELAD---------VGQPQVS 499          
BLAST of piggyBac transposable element-derived protein 4-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007705.1 (pep scaffold:Pmarinus_7.0:GL484572:34:4229:-1 gene:ENSPMAG00000006959.1 transcript:ENSPMAT00000007705.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 145.591 bits (366), Expect = 1.935e-38
Identity = 84/258 (32.56%), Postives = 134/258 (51.94%), Query Frame = 2
Query: 1433 WFDVISNELSVFFAIVMLTGLVSKNELKDYWSVDPLLNTQIFPKTFTRNRLLQIMRYLHFANN------EQKTIDKLFKIGNVVNMVKEKFKNAIIPDRNICIDESLMLWKGRLSFKQYIPSKRHRFGIKLFEMVDCTTQCILNFIIYTGKSTKFRFHELLGISGS-IVIKLMNMHLDKGHVLYVDNWYSSPPLFEILHYK-KTGACGTLRKNRKGLPKYSGKMK-----KGELESYNTDKLLFQRWMNKREVFMLST 2167
            W    S E+  FFA+ ++ G+     +  YWS +P L  +    T T  R  ++ +YLH  NN       Q+  D ++K+ NVV  V+  F     P R + +DE ++ +KGRL FKQ++P+K  ++G+K++E+ +  T   LNF IYTG+S            G  +V+ L   +  + H LY D ++SSP L E L  +  T ACGT+  +R+GLP  + ++      +G+   +    L+   W +KR V  LST
Sbjct:    1 WSPTTSREMKAFFAVAIMMGIKDLPRVWCYWSGNPALRCEWVSGTMTHTRYSKVSQYLHARNNVGTPARGQRGYDPIYKVRNVVEEVRANFSRHYSPRRELSVDEGMIPFKGRLFFKQHMPAKPTKWGVKVWELCEAQTGYCLNFDIYTGRSAYGAATTAAAALGYRVVMSLTRSYWHRNHHLYFDRYFSSPALLEDLRSRCGTYACGTVSLSRRGLPPPAREVASLLRHRGDFAFFQKGGLVLSVWRDKRVVATLST 258          
BLAST of piggyBac transposable element-derived protein 4-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002004.1 (pep scaffold:Pmarinus_7.0:GL490362:1254:2954:1 gene:ENSPMAG00000001819.1 transcript:ENSPMAT00000002004.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 141.739 bits (356), Expect = 5.017e-36
Identity = 110/417 (26.38%), Postives = 183/417 (43.88%), Query Frame = 2
Query: 1319 PIDYFEWFIDSEFMDYVVKETNLYQQQH-PLPSQKKMAKWFDVISNELSVFFAIVMLTGLVSKNELKDYWSVDPLLNTQIFPKTFTRNRLLQIMRYLHFANN---EQKTIDKLFKIGNVVNMVKEKFKNAIIPDRNICIDESLMLWKGRLSFKQYIPSKRHRFGIKLFEMVDCTTQCILNFIIYTGKSTKFRFHELLGISGSIVIKLMNMHLDKGHVLYVDNWYSSPPLFEILHYKKTGACGTLRKNRKGLPKYSGKMKKGELESYNTDKLLFQR--------WMNKREVFMLSTIH---------------RNGLVESTKTNFQ----------------SFEKIMKPKQLKITVYSWVVWIILIXXXXXXXXXXXXHIIDMVVHNAYCIYR--AKNKSRIQLADFRLILVRQLIE 2434
            P+ + + FI  E + +   ETN Y        S ++ A W  V   +++ +  + M  G+ S  E+  YWS     +   F +T +  R   I R+ +  N+    +   D+L ++  V+   + KFK    P+R + +DE+ + WKGRL FK Y P K  ++GIK + + +  T  + NF IY G     R         +IV  LM   LDKG+ LY+DN+Y+S  L E L+      CGTLR +R G PK    + K ++     D + F+R        WMN R V +++ IH               R+G    ++   Q                 F+++++        + W   I+L             + + M +HNAY +Y+  + ++ ++ L  F  +L   LI 
Sbjct:   16 PLGFIQLFITRELLMFFTNETNSYANCALANKSAEERAGWEGVNLMDIANYLGLTMAMGVASLPEIPMYWSTGKPYSMPAFRETMSCKRFKSIGRFFNCHNSCAVPRDNTDRLLQVRTVMEYFQSKFKALYAPNRELSLDEATLEWKGRLPFKVYNPQKPEKYGIKFYILAEAQTGYVFNFDIYVGIEKSIR---------NIVFGLMGPLLDKGYQLYMDNYYNSVKLTEELYEHGVHTCGTLRLSR-GAPKDLQALAKMKIPR---DSIHFRRKGNTFVICWMNTRLVTLITNIHNADTHNFVRQQKTRKRDGTALLSRIELQRPNAIADYMDHMRGVVHFDQMIQYYHFTRKTHKWTKKIVL-------------YFLQMALHNAYVLYKKYSTDEKKLTLLAFHEVLFNALIH 406          
BLAST of piggyBac transposable element-derived protein 4-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001816.1 (pep scaffold:Pmarinus_7.0:GL492440:267714:269431:-1 gene:ENSPMAG00000001650.1 transcript:ENSPMAT00000001816.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 112.079 bits (279), Expect = 5.316e-26
Identity = 111/451 (24.61%), Postives = 200/451 (44.35%), Query Frame = 2
Query: 1259 KLHQFQEKPGPKNFRVENEQPIDYFEWFIDSEFMDYVVKETNLYQQQ--------HPLPSQKKMAKWFDVISNELSVFFAIVMLTGLVSKNELKDYWSVDPLLNTQIFPKTFTRNRLLQIMRYLHFANNEQKT------IDKLFKIGNVVNMVKEKFKNAIIPDRNICIDESLMLWKGRLSFKQYIPSKRHRFGIKLFEMVDCTTQCILNFIIYTGKSTKFRFHEL---------LGISGSIVI--KLMNMHLDKGHVLYVDNWYSSPPLFEILHYKKTGACGTLRKNRKGLPK--YSGKMKKGELESYNTDKLLFQRWMNKREVFMLSTIHRNGLVESTKTN--FQSF--EKIMKPKQL--------KITVYSWV-VWIILIXXXXXXXXXXXXHIIDMVVHNAYCIYRAKNKSRIQLA----DFRLILVRQLIEKYGSQRS---ERVGR 2470
            +L +FQ  PGP +      QP+DYF+ F+  E +D +V ETN +  +         P P      +   V  + LS F  +V++ G+     L  +W+ D  L  Q   ++ +  R   + RYLH +++E+         D L KI  +++ +   F    +P R++ +DE L  +K R      +P+   R G+K+F     +T  + + +++ G         L         LG   ++ +  +L  +H    H +Y    + S  L      + T  CG +R N +G PK     +++ G+ +   + +L+    ++K     ++ I  N   ES +    F ++  E   KP  L        K+ + S +  W  L  +  KW+K  FF +++  V N+Y +YR  N  + + A    +FRL+L +QL+ +   ++     RVGR
Sbjct:    1 QLEEFQGSPGPVHALPAGSQPLDYFKLFLTDEMLDRIVTETNRHAARCGANMHLTGPGPGSVS-GEGRPVTRSSLSTFLGVVLIMGINMLPALPYHWADDDSLGNQFIRRSISHKRFSFLQRYLHISDDEKAPSRGRIGYDPLHKIRPLLDHLLGAFSRHFVPFRDMRLDEVLSKFKDRHDALPCVPANPIRCGVKVFICSCASTGYVHSLLVHAGGHDIVVAGGLWRRRNKSFPLGYRAAMRLTERLHGVH----HHVYFGKLFGSARLLSDFLQRGTYGCGLVRPNSRGFPKELRDSRLQPGDTKFRQSGQLVA--CIHKANTENMAIIASNSRPESERMQRRFHNYDVEGSQKPHPLLNYNMCMGKVDIASQLQTWFELGREGRKWWKYMFFFLLNTAVVNSYILYRLSNMPQPRNAMSQLEFRLLLAKQLVGRVDVRKGPGLRRVGR 444          
BLAST of piggyBac transposable element-derived protein 4-like vs. Ensembl Medaka
Match: ENSORLT00000021107.2 (piggyBac transposable element-derived protein 4 [Source:NCBI gene;Acc:101163734])

HSP 1 Score: 127.102 bits (318), Expect = 5.755e-30
Identity = 84/329 (25.53%), Postives = 162/329 (49.24%), Query Frame = 2
Query: 1283 PGPKNF------------RVENEQPIDYFEWFIDSEFMDYVVKETNLYQQQHPLPSQKKMAK---WFDVISNELSVFFAIVMLTGLVSKNELKDYWSVDPLLNTQIFPKTFTRNRLLQIMRYLHFAN------NEQK----TIDKLFKIGNVVNMVKEKFKNAIIPDRNICIDESLMLWKGRLSFKQYIPS-KRHRFGIKLFEMVDCTTQCILNFIIYTGKSTKFRFHELLGISGSIVIKLMNM-HLDKGHVLYVDNWYSSPPLFEILHYKKTGACGTLRKNRKGLP-----KYSGKMKKGELESYNTDKLLFQRWMNKREVFMLSTIH 2173
            PGP  F                + P   F  F D+E +  + + TN + Q+     +K+  K   W D+   EL+ +  +++   + +   + DYW  + + +        +R+R L I  +LHF++      NEQK      D L ++  ++ M+  + K A  P ++I + E ++  KGRL  K+++ + K  ++G+  F + D     I ++++++G+  +       G++  +V +L+N  +L  G+++Y D++Y+SP LF  L  +  GACG  ++ R G+P       + K K+G +       LL+ RWM+ RE+ + +T+H
Sbjct:  105 PGPPTFLPKRTPGVQPPLTTGKQTPGAIFSQFFDAEVLKILCENTNSFAQK-----KKETGKPFPWKDLTPQELTKYLGLLLYMSVCNFPRITDYWRKNSIFHVSYPAAVMSRDRFLTISSHLHFSDPDVDAVNEQKMGTEEYDPLQRVRCLLEMISSRCKAAYHPRQHISVGERMVATKGRLQIKEHVDADKPTKWGLNFFVLADVNGYTI-DYMLHSGEKQRASGK---GLAFDVVAELVNREYLGSGYIVYCDSFYTSPVLFRHLIQQGFGACGMYKQGRTGVPTTKLNALNRKSKRGSIRWIRDSDLLYVRWMDTREMSLCTTVH 424          
BLAST of piggyBac transposable element-derived protein 4-like vs. Ensembl Medaka
Match: si:ch211-130m23.5 (piggyBac transposable element-derived protein 4-like [Source:NCBI gene;Acc:105354747])

HSP 1 Score: 102.449 bits (254), Expect = 7.152e-22
Identity = 83/339 (24.48%), Postives = 150/339 (44.25%), Query Frame = 2
Query: 1217 AGERIWSKEGNFVPKLHQFQEKPGPKNFRVENEQPIDYFEWFIDSEFMDYVVKETNLYQQQHPLPSQKKMAKWFDVISNELSVFFAIVMLTGLVSKNELKD---YWSVDPLLNTQIFPKTFTRNRLLQIMRYLHFANNE------QKTIDKLFKIGNVVNMVKEKFKNAIIPDRNICIDESLMLWKGRLSFKQYIPSKRHRFGIKLFEMVDCTTQCILNFIIYTGKSTKFRFHELLGISGSIVIKLMNMHLDKG-HVLYVDNWYSSPPLFEILHYKKTGACGTLRKNRKGL-----PKYSGKMKKGELESYNTDKLLFQRWMNKREVFMLSTIHRNGLV 2188
            A    W  E + V  +  F    GP++   ++    DYF         +++V++TN Y       S K    W      E+  +  + +L G+   N+L D   YW+ D  +    F KT T  R  ++ +YL   + E      ++  D L+KI  ++++V+    +   P+R + ID+  +  KGR S  QY+ SK  + G+ ++ + D  +       I+ G+ ++    E     G  V+  +   L++  H L++D++++S PL + L      ACG  +  R+G      P+  GK+ +GE        L+     + + V  LST    G+V
Sbjct:  164 ASPDFWG-EPDQVISIEPFSAASGPQHSLGDDADTRDYFRLLFPDSLFEHMVEQTNNYALYRQRRSGKSDPHWHPTDVREMKAYVGLNILMGI---NQLPDTGMYWASDIFIGNAGFKKTMTARRFEKLTQYLQLCDREAEPVRGERCYDGLYKIRPLLDVVENTMWDTYTPNRCLTIDKCSIATKGRFSPTQYMSSKPVKKGLTVWMLCDSRSGYCHRTKIHVGRPSE---DEGAASLGHRVVTFLVRGLERQYHHLFMDSFFTSVPLLQRLLRDGLYACGPTQPGRRGYPEVLRPRNVGKLCQGEFYQCQHGNLVATVTRDVKMVNCLSTNSAPGIV 495          
BLAST of piggyBac transposable element-derived protein 4-like vs. Ensembl Medaka
Match: ENSORLT00000036570.1 (pep primary_assembly:ASM223467v1:15:4424179:4426102:1 gene:ENSORLG00000027498.1 transcript:ENSORLT00000036570.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 100.138 bits (248), Expect = 2.072e-21
Identity = 80/299 (26.76%), Postives = 141/299 (47.16%), Query Frame = 2
Query: 1313 EQPIDYFEWFIDSEFMDYVVKETNLYQQQHPLPSQKKMAKWFDVISNELSVFFAIVMLTGLVSKNELKDYWSVDPLLNTQIFPKTFTRNRLLQIMRYLHFANN---EQKTIDKLFKIGNVVNMVKEKFKNAIIPDRNICIDESLMLWKGRLSFKQYIPSKRHRFGIKLFEMVDCTTQCILNFIIYTGKSTKFRFHELLGISGSIVIKLMN-MHLDKGHVLYVDNWYSSPPLFEILHYKKTGACGTLRKNRKGLPKYS----GKMKKGELESYNTDKLLFQ-------RWMNKREVFMLS 2164
            + P +YF+ F   + ++ VV+++NLY        Q    K  ++ + EL  F    +   L      + +W+   L++      T   NR   I R LHF NN   + + +D L KI  +V  +  K +   + ++ + +DE ++ +KGR   KQY+P+K  ++G K+  +   +     NF IYTG+  +      +G SG++V+ L   +   + H L+ DNW++S PL   L  +     GT+R NR  LP  S     ++K+    S++    +         +W + R V +LS
Sbjct:  100 KSPYEYFKMFFSEDILEVVVEQSNLYA------IQCNTNKPLNLTTKELEQFMGTAVYMSLFGLPGTRMFWNKATLVSQ--VADTMALNRWEFIKRCLHFNNNKVRQGENVDPLHKIRPLVTHLTSKLQTIPMGEK-LAVDEQMVTFKGRNRLKQYLPAKPKKWGYKILVLAG-SDGVPHNFEIYTGRVVQPPELPDVGASGNVVLHLAQPIPKHQKHKLFFDNWFTSVPLILTLAQQGIHCAGTVRSNR--LPGVSMMCDAELKRTGRGSFDQKTAMVGETTLHAVKWYDNRSVSLLS 386          
BLAST of piggyBac transposable element-derived protein 4-like vs. Ensembl Medaka
Match: ENSORLT00000047092.1 (piggyBac transposable element-derived protein 2-like [Source:NCBI gene;Acc:111948922])

HSP 1 Score: 100.138 bits (248), Expect = 2.541e-21
Identity = 80/299 (26.76%), Postives = 140/299 (46.82%), Query Frame = 2
Query: 1313 EQPIDYFEWFIDSEFMDYVVKETNLYQQQHPLPSQKKMAKWFDVISNELSVFFAIVMLTGLVSKNELKDYWSVDPLLNTQIFPKTFTRNRLLQIMRYLHFANNE---QKTIDKLFKIGNVVNMVKEKFKNAIIPDRNICIDESLMLWKGRLSFKQYIPSKRHRFGIKLFEMVDCTTQCILNFIIYTGKSTKFRFHELLGISGSIVIKLMN-MHLDKGHVLYVDNWYSSPPLFEILHYKKTGACGTLRKNRKGLPKYS----GKMKKGELESYNTDKLLFQ-------RWMNKREVFMLS 2164
            + P +YF+ F   + ++ VV+++NLY        Q    K  ++ + EL  F    +   L      + +W  +          T + NR   I + LHF NNE    + +D L KI  +V  +  K +   + ++ + +DE ++ +KGR   KQY+P+K  ++G K+  +   +     NF IYTG+  +      +G SG++V++L   +   + H L+ DNWY+S PL   L  +     GT+R NR  LP  S     ++K+    S++    +         +W + R V +LS
Sbjct:  100 KSPYEYFKLFFSEDILEVVVEQSNLYA------IQCNTNKPLNLTTKELEQFMGTAVYMSLFGLPGTRMFW--NKATRVSQVADTMSLNRWEFIKKCLHFNNNEVRQGENVDPLHKIRPLVTHLTSKLQTIPMGEK-LAVDEQMVPFKGRNRLKQYLPAKPKKWGYKILVLAG-SDGVQHNFEIYTGRVVQPPELPDVGASGNVVLRLAQPIPKHQKHKLFFDNWYTSVPLILTLAQQGIHCAGTVRSNR--LPGVSMMCDAELKRTGRGSFDQKTAMVGETTLHAVKWYDNRPVSLLS 386          
BLAST of piggyBac transposable element-derived protein 4-like vs. Ensembl Medaka
Match: ENSORLT00000038522.1 (pep primary_assembly:ASM223467v1:10:9345195:9347118:-1 gene:ENSORLG00000027882.1 transcript:ENSORLT00000038522.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 98.5969 bits (244), Expect = 6.340e-21
Identity = 79/299 (26.42%), Postives = 140/299 (46.82%), Query Frame = 2
Query: 1313 EQPIDYFEWFIDSEFMDYVVKETNLYQQQHPLPSQKKMAKWFDVISNELSVFFAIVMLTGLVSKNELKDYWSVDPLLNTQIFPKTFTRNRLLQIMRYLHFANNEQK---TIDKLFKIGNVVNMVKEKFKNAIIPDRNICIDESLMLWKGRLSFKQYIPSKRHRFGIKLFEMVDCTTQCILNFIIYTGKSTKFRFHELLGISGSIVIKLMN-MHLDKGHVLYVDNWYSSPPLFEILHYKKTGACGTLRKNRKGLPKYS----GKMKKGELESYNTDKLLFQ-------RWMNKREVFMLS 2164
            + P +YF+ F   + ++ VV+++NLY        Q    K  ++ + EL  F    +   L      + +W  +          T + NR   I + LHF NNE +    +D L KI  +V  +  K +   + ++ + +DE ++ +KGR   KQY+P+K  ++G K+  +   +     NF IYTG+  +      +G SG++V++L   +   + H L+ DNW++S PL   L  +     GT+R NR  LP  S     ++K+    S++    +         +W + R V +LS
Sbjct:  100 KSPYEYFKMFFSEDILEVVVEQSNLYA------IQCNTNKPLNLTTKELEQFMGTAVYMSLFGLPGTRMFW--NKATRVSQVADTMSLNRWEFIKKCLHFNNNEVRQGENVDHLHKIRPLVTHLTSKLQTIPMGEK-LAVDEQMVPFKGRNRLKQYLPAKPKKWGYKILVLAG-SDGVPHNFEIYTGRVVQPPELPDVGASGNVVLRLAQPIPKHQKHKLFFDNWFTSVPLILTLAQQGIHCAGTVRSNR--LPGVSMMCDAELKRTGRGSFDQKTAMVGETTLHAVKWYDNRPVSLLS 386          
BLAST of piggyBac transposable element-derived protein 4-like vs. Planmine SMEST
Match: SMESG000067117.1 (SMESG000067117.1)

HSP 1 Score: 603.208 bits (1554), Expect = 0.000e+0
Identity = 310/333 (93.09%), Postives = 316/333 (94.89%), Query Frame = 2
Query: 1118 MSNEIADYELLAXXXXXXXXXXXXXXXXXXXXRAGERIWSKEGNFVPKLHQFQEKPGPKNFRVENEQPIDYFEWFIDSEFMDYVVKETNLYQQQHPLPSQKKMAKWFDVISNELSVFFAIVMLTGLVSKNELKDYWSVDPLLNTQIFPKTFTRNRLLQIMRYLHFANNEQKTIDKLFKIGNVVNMVKEKFKNAIIPDRNICIDESLMLWKGRLSFKQYIPSKRHRFGIKLFEMVDCTTQCILNFIIYTGKSTKFRFHELLGISGSIVIKLMNMHLDKGHVLYVDNWYSSPPLFEILHYKKTGACGTLRKNRKGLPKYSGKMKKGELESYNTDK 2116
            MSNEIADYELLAD GSDI SDDEIEDF IIND AGERIWSKEGNFVPKLHQFQEKPGPKNFRVENEQPIDYFEWFIDSEFMDYVVKETNLYQQQHPLPSQKKMAKWFDV SNELSVFFAIVMLTGLVSKNELKDYWSVDPLLNT IFPKTFTRNR LQIMR+LHFANNEQKT DKLFKIGNVVNMVKEKFKN IIPDR ICIDESLMLWKGRLSFKQYIP KRHRFGIKLFEMVDCTTQCILNFIIYTGKSTKFRFHELLGISGSIV++LMNMHLDKGHVLYV+NWYSSPPLFEILHYKKTGACGTLRKNRKGLPKYSGKMKK +L     +K
Sbjct:    1 MSNEIADYELLADGGSDIGSDDEIEDFYIINDGAGERIWSKEGNFVPKLHQFQEKPGPKNFRVENEQPIDYFEWFIDSEFMDYVVKETNLYQQQHPLPSQKKMAKWFDVTSNELSVFFAIVMLTGLVSKNELKDYWSVDPLLNTPIFPKTFTRNRFLQIMRFLHFANNEQKTNDKLFKIGNVVNMVKEKFKNVIIPDRLICIDESLMLWKGRLSFKQYIPLKRHRFGIKLFEMVDCTTQCILNFIIYTGKSTKFRFHELLGISGSIVMELMNMHLDKGHVLYVENWYSSPPLFEILHYKKTGACGTLRKNRKGLPKYSGKMKKDKLNDNTQEK 333          
BLAST of piggyBac transposable element-derived protein 4-like vs. Planmine SMEST
Match: SMESG000047155.1 (SMESG000047155.1)

HSP 1 Score: 164.851 bits (416), Expect = 1.224e-42
Identity = 121/393 (30.79%), Postives = 205/393 (52.16%), Query Frame = 2
Query: 1307 ENEQPIDYFEWFIDSEFMDYVVKETNLY-----QQQHPLPSQKKMAKWFDVISNELSVFFAIVMLTGLVSKNELKDYWSVDPLLNTQIFPKTFTRNRLLQIMRYLHFANNEQKTIDKLFKIGNVVNMVKEKFKNAIIPDRNICIDESLMLWKGRLSFKQYIPSKRHRFGIKLFEMVDCTTQC-ILNFIIYTGKSTKFRFHELLGISGSIVIKLMNMHLDKGHVLYVDNWYSSPPLFEILHYKKTGACGTLRKNRKGLPK--YSGKMKKGELESYNTDKLLFQRWMNKREVFMLSTIHRNGLVESTKTNFQSFEKIMKPKQLKITVYS-----------WVVWIILIXXXXXXXXXXXXHIIDMVVHNAYCIYRAKNKSRIQLADFRLILVRQL 2428
            EN  PI  FE   D + M+ ++K TN Y      Q  P     + A + +    E+  F  + +L   +  + ++  +S+D L     FP   +  R  QI+R   F   E+ + D L KI   ++++ +KF NA  P+  + +DESL+L++GRL F+ Y+  K+ ++GIK +E+  C+ Q  +LN  +Y G        E +    S+V++LM  +L+KGH L++DN+Y+S PL   L  KKT   GTLR NRKGLP+     K++KGE      ++    +W +KR+V  L+T +   ++ +     Q      K K ++I  Y+            + +     KT +WYKK  FH++D+ V N++ I++ K  S+++  ++R  ++R L
Sbjct:   89 ENVSPIQVFEKIWDDQVMEMIIKSTNDYGIKLCNQARPHTRHSRKANFKNTDMIEMRKFLGLCLLQSQLKFSSIRKLFSIDALHYHPAFPSQMSGRRFEQILRC--FCVEEENSNDPLRKIKIFLDLLIQKFANAYAPNEALSLDESLLLFRGRLYFRTYMKGKKAKYGIKFYEL--CSAQGYVLNIEVYKGHREN---DENMTTIESLVMRLMQSYLNKGHHLFMDNYYNSLPLSNKLLSKKTHVTGTLRVNRKGLPQEITRRKLRKGEHVWRRQNQTYVSKWKDKRDVLCLTTAYHPSMINTANRRQQE-----KRKPIEIVNYNQNMSGVDRADQMMSYYSCPRKTIRWYKKVIFHLLDVAVWNSFYIFKEKTGSQMKYIEYREAIIRSL 469          
BLAST of piggyBac transposable element-derived protein 4-like vs. Planmine SMEST
Match: SMESG000071608.1 (SMESG000071608.1)

HSP 1 Score: 145.206 bits (365), Expect = 3.999e-36
Identity = 115/402 (28.61%), Postives = 188/402 (46.77%), Query Frame = 2
Query: 1289 PKNFRVENEQPIDYFEWFIDSEFMDYVVKETNLYQQQH----PLPSQKKMAKWFDVISNELSVFFAIVMLTGLVSKNELKDYWSVDPLLNTQIFPKTFTRNRLLQIMRYLHFANNEQKTI-DKLFKIGNVVNMVKEKFKNAIIPDRNICIDESLMLWKGRLSFKQYIPSKRHRFGIKLFEMVDCTTQCIL-NFIIYTGKSTKFRFHELLGISGSIVIKLMNMHLDKGHVLYVDNWYSSPPLFEILHYKKTGACGTLRKNRKGLPK--YSGKMKKGELESYN-TDKLLFQRWMNKREVFMLSTIHRNGLVESTKTNFQSFEKIMKPKQLKITVYSWVVWIILIXXXXXXXXXXX------------XHIIDMVVHNAYCIYRAKNKSRIQLADFRLILVRQLI 2431
            PKN         D F  F D E ++ +V ETN+Y +Q           ++ KW    S E+  FF + M  GLV   ++  YWS   +          +R+R   ++R LHF+NNE     D+L KI  ++++++ K+K   +P  N  IDE+L+ W+GRL F+QYIP+K H++GIKLF++  CT++       +Y+GKS  +                     + G    V N+Y+S PL      +KT    T+R N+K +PK   +  +KKGE+ +    + ++   W++ R V +L T H   +V     +  +  +  K K L +  Y+     I I      Y                 +++ + V NAY I +  NKS I +  F+  LV +++
Sbjct:  108 PKNI-----SAFDTFMLFFDEEVINLIVIETNIYAEQTIERTRTSRHNRLNKWHPANSEEIRKFFGLFMWMGLVRMGKITSYWSNKDIYKNSTALSIMSRSRFEILLRLLHFSNNENAIPGDRLAKIKPLLDLLEAKYKKVFVPGENHVIDETLVPWRGRLVFRQYIPNKAHKYGIKLFKL--CTSEGYTWASKMYSGKSEIY-------------------DKNSGLAAKVYNFYTSYPLALDFLRQKTHVVSTVRANKKFMPKEVMNANLKKGEMIAREYKNGIVVLNWLDTRYVRVLKTKHAPEIVNINVNSPSTSRQKNKQKPLTVCEYNKGKAGIDISDQMGSYATTLRKGIKWYRKLAIEYVLGISVVNAYIINKINNKSNIGIRQFQENLVTEML 483          
BLAST of piggyBac transposable element-derived protein 4-like vs. Planmine SMEST
Match: SMESG000020543.1 (SMESG000020543.1)

HSP 1 Score: 129.798 bits (325), Expect = 2.703e-32
Identity = 90/242 (37.19%), Postives = 129/242 (53.31%), Query Frame = 2
Query: 1490 GLVSKNELKDYWSVDPLLNTQIFPKTFTRNRLLQIMRYLHFANNEQKTI-DKLFKIGNVVNMVKEKFKNAIIPDRNICIDESLMLWKGRLSFKQYIPSKRHRFGIKLFEMVDCTTQCILNFIIYTGKSTKFRFHELLG-ISGSIVIKLMNMHLDKGHVLYVDNWYSSPPLFEILHYKKTGACGTLRKNRKGLPKYSGKMKKGELESYNTDKLLFQRWMNKREVFMLSTIHRNGLVESTKTNF 2209
            GLV   ++K YWS     N  +      RNR   ++R++HF+NNE+    +KL K+  ++N +   FK    PD  +C+DESLM ++GR+ F+QYI  KRHR+ IK+F++         +F IYT K      +E+ G  S  IV+ L    L KGH +  DNWY+S  L E L  K+T   GTLRK R+G PK                +++ Q+  +KR+V MLST H   +    K NF
Sbjct:    2 GLVRLPKIKLYWSKYEGYNLTLPRTIMPRNRFELLLRFVHFSNNEENDPKNKLSKVDPIINHLNNNFKIYYKPDEVLCVDESLMPFRGRIVFRQYIKQKRHRYVIKVFKLY-IGPGYTYSFRIYTCKDEN--TNEISGNKSTEIVMALCQDILGKGHTICTDNWYTSVDLAERLIDKRTQLLGTLRKYRRGNPK----------------EVVAQKLKHKRDVLMLSTKHSTEMTIIQKINF 224          
BLAST of piggyBac transposable element-derived protein 4-like vs. Planmine SMEST
Match: SMESG000081807.1 (SMESG000081807.1)

HSP 1 Score: 85.1149 bits (209), Expect = 5.755e-17
Identity = 78/293 (26.62%), Postives = 133/293 (45.39%), Query Frame = 2
Query: 1355 FMDYVVKETNLYQQQHPLPSQKKMAKWFDVIS-NELSVFFAIVMLTGLVS--KNELKDYW---SVDPLLNTQIFPKTFTRNRLLQIMRYLHFAN----NEQKTIDKLFKIGNVVNMVKEKFKNAIIPDRNICIDESLMLWKGRLSFKQYIPSKRHRFGIKLFEMVDCTTQCILNFIIYTGKSTKFRFHELLGISGSIVIKLMNMHL-DKGHVLYVDNWYSSPPLFEILHYKKTGACGTLRKNRKGLPKYSGKMKKGELES---YNTDKLLFQRWMNK-REVFMLSTIHRNGLV 2188
            F D ++K TN    +    + +K  K+ D  +  E+     I++L G++   K  L   W      PLL T     T   NR    +    F +    N+++  DK   I  + +   +  +    P   +C+DE+ + ++G   F+ YIPSK  R+GIK++ + D  T  + N  +Y GK  +   H+     G+ V+K + + L + G  +  DN+++S  L + L  +     GT+RK+R  +P       + E ES   +  D  L      K R V +LST+H   +V
Sbjct:    2 FFDKLLKHTNEELGRRGQSTAEKDPKYLDDFTIVEMKAAVGIMILVGVMCSKKESLNQLWFEVYGRPLLRT-----TIPLNRFRIFLSSARFDDKTTRNDRQKTDKFAAIRELFDHFVDNRQELYTPSPYLCVDETQVEFRGGCPFRVYIPSKPDRYGIKVWSLCDNGTHYVTNLQVYLGKKGQSPKHQ----QGTRVVKQLMLPLYNSGRNVTTDNFFTSYDLGQFLLSQNITLLGTMRKSRTEIPPEFLSKSREEFESKFAFTKDTALVSYAPPKNRTVVLLSTMHNRPVV 285          
The following BLAST results are available for this feature:
BLAST of piggyBac transposable element-derived protein 4-like vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PGBD41.120e-6531.36piggyBac transposable element derived 4 [Source:HG... [more]
PGBD22.464e-1624.85piggyBac transposable element derived 2 [Source:HG... [more]
ERCC68.042e-1626.05ERCC excision repair 6, chromatin remodeling facto... [more]
ERCC62.503e-1526.05ERCC excision repair 6, chromatin remodeling facto... [more]
ERCC62.503e-1526.05ERCC excision repair 6, chromatin remodeling facto... [more]
back to top
BLAST of piggyBac transposable element-derived protein 4-like vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of piggyBac transposable element-derived protein 4-like vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG98391.020e-724.53gene:FBgn0037633 transcript:FBtr0334332[more]
CG98391.020e-724.53gene:FBgn0037633 transcript:FBtr0081934[more]
back to top
BLAST of piggyBac transposable element-derived protein 4-like vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pgbd45.433e-3728.57piggyBac transposable element derived 4 [Source:ZF... [more]
CABZ01069162.16.740e-3628.23pep scaffold:GRCz11:KN149950.1:74:5493:1 gene:ENSD... [more]
pgbd48.073e-3629.13piggyBac transposable element derived 4 [Source:ZF... [more]
si:dkey-19f4.22.537e-3329.23si:dkey-19f4.2 [Source:ZFIN;Acc:ZDB-GENE-121214-26... [more]
CR847936.14.902e-3128.01piggyBac transposable element-derived protein 4-li... [more]
back to top
BLAST of piggyBac transposable element-derived protein 4-like vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000026678.12.575e-6835.80pep primary_assembly:Xenopus_tropicalis_v9.1:4:886... [more]
ENSXETT00000040662.19.291e-6835.80pep primary_assembly:Xenopus_tropicalis_v9.1:2:103... [more]
ENSXETT00000029105.11.073e-6735.80pep primary_assembly:Xenopus_tropicalis_v9.1:3:719... [more]
ENSXETT00000042747.11.575e-6735.80pep primary_assembly:Xenopus_tropicalis_v9.1:7:947... [more]
wdtc11.748e-6735.80WD and tetratricopeptide repeats 1 [Source:Xenbase... [more]
back to top
BLAST of piggyBac transposable element-derived protein 4-like vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Pgbd17.914e-928.19piggyBac transposable element derived 1 [Source:MG... [more]
Pgbd11.053e-828.19piggyBac transposable element derived 1 [Source:MG... [more]
Pgbd11.053e-828.19piggyBac transposable element derived 1 [Source:MG... [more]
back to top
BLAST of piggyBac transposable element-derived protein 4-like vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q96DM1|PGBD4_HUMAN4.971e-6531.36PiggyBac transposable element-derived protein 4 OS... [more]
sp|Q6P3X8|PGBD2_HUMAN1.184e-1524.85PiggyBac transposable element-derived protein 2 OS... [more]
sp|Q8N328|PGBD3_HUMAN3.862e-1526.05PiggyBac transposable element-derived protein 3 OS... [more]
sp|P0DP91|ERPG3_HUMAN1.202e-1426.05Chimeric ERCC6-PGBD3 protein OS=Homo sapiens OX=96... [more]
sp|Q96JS3|PGBD1_HUMAN2.117e-1424.56PiggyBac transposable element-derived protein 1 OS... [more]
back to top
BLAST of piggyBac transposable element-derived protein 4-like vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A090X8N53.054e-9340.27Putative piggybac (Fragment) OS=Ixodes ricinus OX=... [more]
A0A1Y1NAK02.698e-8839.50Uncharacterized protein OS=Photinus pyralis OX=705... [more]
A0A4W5LLZ42.721e-8839.05Uncharacterized protein OS=Hucho hucho OX=62062 PE... [more]
A0A3N0XE893.272e-8741.79PiggyBac transposable element-derived protein 4 OS... [more]
J9K5H36.553e-8743.42DDE_Tnp_1_7 domain-containing protein OS=Acyrthosi... [more]
back to top
BLAST of piggyBac transposable element-derived protein 4-like vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000025849.25.548e-3926.91pep primary_assembly:Astyanax_mexicanus-2.0:6:2055... [more]
ENSAMXT00000030524.13.382e-3829.18pep primary_assembly:Astyanax_mexicanus-2.0:8:5821... [more]
ENSAMXT00000043919.15.061e-3730.70pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000029839.18.163e-3526.77pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000014953.25.188e-3426.84pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of piggyBac transposable element-derived protein 4-like vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000007705.11.935e-3832.56pep scaffold:Pmarinus_7.0:GL484572:34:4229:-1 gene... [more]
ENSPMAT00000002004.15.017e-3626.38pep scaffold:Pmarinus_7.0:GL490362:1254:2954:1 gen... [more]
ENSPMAT00000001816.15.316e-2624.61pep scaffold:Pmarinus_7.0:GL492440:267714:269431:-... [more]
back to top
BLAST of piggyBac transposable element-derived protein 4-like vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of piggyBac transposable element-derived protein 4-like vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of piggyBac transposable element-derived protein 4-like vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000021107.25.755e-3025.53piggyBac transposable element-derived protein 4 [S... [more]
si:ch211-130m23.57.152e-2224.48piggyBac transposable element-derived protein 4-li... [more]
ENSORLT00000036570.12.072e-2126.76pep primary_assembly:ASM223467v1:15:4424179:442610... [more]
ENSORLT00000047092.12.541e-2126.76piggyBac transposable element-derived protein 2-li... [more]
ENSORLT00000038522.16.340e-2126.42pep primary_assembly:ASM223467v1:10:9345195:934711... [more]
back to top
BLAST of piggyBac transposable element-derived protein 4-like vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000067117.10.000e+093.09SMESG000067117.1[more]
SMESG000047155.11.224e-4230.79SMESG000047155.1[more]
SMESG000071608.13.999e-3628.61SMESG000071608.1[more]
SMESG000020543.12.703e-3237.19SMESG000020543.1[more]
SMESG000081807.15.755e-1726.62SMESG000081807.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011971 ID=SMED30011971|Name=piggyBac transposable element-derived protein 4-like|organism=Schmidtea mediterranea sexual|type=transcript|length=2802bp
AATTTTTAATATAAAATTTATTTACATGAATATAAATATTTTATAATATA
TTTTTTATAAAATATTGTTCAATATTCACATAGGTTTATTTCATTCATTC
ATTCATTCAAACAAATGTCTGATCCGAGGCGAGTAGGAAGACCACGCAAA
AGAATTCCACCTTCAAGGGCTGGTTTTACTTTGGTGTGTACTGATAAAGG
TTGCTATCACCCTCCTACAAGAGAAGTGTATCCTCCTTATTTGGAAAATG
CCCCATCTTCATGCAAATCAAAGGAAGAGAAAGCGATGTGGGTAAGTATG
GCCCGACATTTGCCATCTTTCAGAGATTGCAAAGATGAAAAAAGTAGAAA
ATATATATGCGCAAAGGATACCCCATGCTTGCCATATATATTTCAGGAGG
TAAAAAATCATTACGATTTTAGTTACCTAAATCCTGAAGAATGGACAAAT
TCAATAAAACCTGATTTTATGTCTGAGGATGATTGGAATCATTTTATTGA
ATCATCATCGAGAAAAGGAAGAGATTCTCAAACCGGGCCAGCTGGCAAAG
GTTTAAAAAAAGGTCTTGACCAACAAGAAACAAAGAAGAAACGAAATAAG
CAAATATAAATCCTTTTAGATATGAAAGGTAGGTCAAACCAGCCTCAAAA
TGGTAATCCTTTCAGATATGCGAGGTAGGTCTAACCAGCCTAGAATTGGT
ACCATTCTTCTGGAAAGGCCTTGTCGTGGCAGAATGGCTTTTCACTAACT
TACCAAATCATTTTTTGTTAAAAATTTAATTCAACGTTTTTTGAATTATC
TCACAACTGAGAATTTTATGACAAAAACTATTATGATTTTCAGAACCAGC
ATAAAAAACTCTATAAAATAGGTATTTTGTTTTTTCTAATTTTCCAAATT
TTTCATATATCTTTTTTATATTCAACAAAAGTCGCATACGGATCACGTCC
GATTTTTTTCCGATTATCTTCTAAACTACGCTATTTAGAGGTGAGTTGAT
ATTTTTTATGAATATAATATACGAAAATAAAGATTTTGACATCAAAAAAA
TTGAATTACGTAAAGGATTAGAAAAGTTAGCAAATTTATTTTATTTTTTA
TACGTTTTTATAGAGAAATGTCAAACGAAATCGCTGATTATGAATTATTA
GCAGATGAAGGATCAGATATTGAAAGTGATGATGAAATTGAAGATTTCGA
CATCATAAACGATCGAGCTGGTGAAAGAATTTGGTCAAAAGAAGGAAACT
TTGTGCCAAAACTTCATCAATTTCAAGAAAAACCTGGTCCAAAAAACTTC
CGTGTCGAAAATGAACAACCAATTGACTATTTTGAATGGTTTATTGATTC
CGAATTCATGGATTATGTAGTAAAAGAAACAAATCTCTATCAACAACAAC
ATCCTTTACCATCACAAAAGAAAATGGCGAAGTGGTTTGATGTAATATCA
AACGAATTATCAGTATTTTTTGCGATTGTGATGCTTACAGGTTTGGTTAG
CAAAAATGAGTTGAAAGACTATTGGAGCGTTGATCCTCTACTGAACACTC
AAATATTTCCAAAGACATTCACAAGAAACAGATTACTTCAGATTATGAGA
TACCTTCACTTTGCAAATAATGAACAAAAAACCATTGACAAGCTTTTCAA
AATTGGAAACGTTGTAAATATGGTCAAAGAAAAATTCAAAAATGCCATCA
TACCCGATAGAAACATTTGTATAGATGAAAGCCTAATGCTGTGGAAAGGA
AGATTGAGCTTCAAACAATATATTCCATCAAAACGCCATCGATTTGGAAT
AAAACTATTTGAGATGGTGGACTGTACCACACAATGCATTCTCAATTTTA
TCATTTATACTGGTAAATCTACAAAGTTTAGATTTCATGAATTACTTGGT
ATAAGTGGATCGATCGTAATAAAACTTATGAATATGCATCTGGATAAGGG
ACACGTTTTATATGTTGACAATTGGTATTCAAGCCCACCATTGTTCGAAA
TACTTCATTACAAGAAAACTGGAGCTTGTGGAACATTACGAAAAAATCGC
AAAGGTCTTCCGAAATATTCTGGAAAAATGAAAAAAGGTGAACTTGAAAG
CTACAATACTGATAAATTATTGTTTCAAAGATGGATGAATAAACGCGAAG
TATTCATGTTGTCCACAATTCATAGAAATGGACTAGTTGAATCAACAAAG
ACCAATTTCCAATCATTCGAAAAAATAATGAAGCCAAAACAGTTAAAGAT
TACAGTTTATTCTTGGGTGGTGTGGATTATTCTGATATGAAAGACTACCA
AATGGTACAAAAAGTTCTTTTTTCACATCATTGATATGGTAGTACATAAC
GCTTATTGTATATACAGAGCGAAGAACAAGTCAAGAATCCAATTAGCTGA
TTTTAGACTGATATTGGTTAGACAATTGATAGAAAAATATGGATCTCAAA
GAAGCGAACGAGTTGGAAGACCACCACTAAGCAAAACCAACTTCGTTTAC
AAGGAAGACACTTTCCTGATAAAATTCCAATAAATTCTGGTGATAATGGA
AAGAAATGCTGTGTTGTTTGTTCAACTTCAAGTGATCGAAAAAGAACCAC
AATAATGTGTCAACTATGTGATGTTCCATTATGCATTGTACCATGTTTCA
AAGATTATCACACAAAAGTAAATTTATAATAACCATATTTATTGATAAAA
ATAAAATAGTTTATTTTTCGATTGAATTTTTTGTCTTTTCTTATTTTTAC
ATATTGATTCGTAGTTTTTAGAAAAAAAATTTCTTGAAAAAAATCATTCG
TT
back to top

protein sequence of SMED30011971-orf-1

>SMED30011971-orf-1 ID=SMED30011971-orf-1|Name=SMED30011971-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=391bp
MSNEIADYELLADEGSDIESDDEIEDFDIINDRAGERIWSKEGNFVPKLH
QFQEKPGPKNFRVENEQPIDYFEWFIDSEFMDYVVKETNLYQQQHPLPSQ
KKMAKWFDVISNELSVFFAIVMLTGLVSKNELKDYWSVDPLLNTQIFPKT
FTRNRLLQIMRYLHFANNEQKTIDKLFKIGNVVNMVKEKFKNAIIPDRNI
CIDESLMLWKGRLSFKQYIPSKRHRFGIKLFEMVDCTTQCILNFIIYTGK
STKFRFHELLGISGSIVIKLMNMHLDKGHVLYVDNWYSSPPLFEILHYKK
TGACGTLRKNRKGLPKYSGKMKKGELESYNTDKLLFQRWMNKREVFMLST
IHRNGLVESTKTNFQSFEKIMKPKQLKITVYSWVVWIILI*
back to top

protein sequence of SMED30011971-orf-2

>SMED30011971-orf-2 ID=SMED30011971-orf-2|Name=SMED30011971-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=165bp
MSDPRRVGRPRKRIPPSRAGFTLVCTDKGCYHPPTREVYPPYLENAPSSC
KSKEEKAMWVSMARHLPSFRDCKDEKSRKYICAKDTPCLPYIFQEVKNHY
DFSYLNPEEWTNSIKPDFMSEDDWNHFIESSSRKGRDSQTGPAGKGLKKG
LDQQETKKKRNKQI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0005044scavenger receptor activity
GO:0005515protein binding
GO:0042802identical protein binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000231vitelline gland
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR032718PGBD4_C_Znf-ribbon
IPR029526PGBD
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
GO:0006898receptor-mediated endocytosis
Vocabulary: cellular component
TermDefinition
GO:0016020membrane