ATP-binding cassette sub-family A member 1

Overview
NameATP-binding cassette sub-family A member 1
Smed IDSMED30011962
Length (bp)6465
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ATP-binding cassette sub-family A member 1 (SMED30011962) t-SNE clustered cells

Violin plots show distribution of expression levels for ATP-binding cassette sub-family A member 1 (SMED30011962) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ATP-binding cassette sub-family A member 1 (SMED30011962) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ATP-binding cassette sub-family A member 1 (SMED30011962) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011962

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neuronSMED30011962SMESG000056983.1 dd_Smed_v4_10304_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30011962SMESG000056983.1 dd_Smed_v4_10304_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermal cellSMED30011962SMESG000056983.1 dd_Smed_v4_10304_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30011962SMESG000056983.1 dd_Smed_v4_10304_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30011962SMESG000056983.1 dd_Smed_v4_10304_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Human
Match: ABCA1 (ATP binding cassette subfamily A member 1 [Source:HGNC Symbol;Acc:HGNC:29])

HSP 1 Score: 1114.37 bits (2881), Expect = 0.000e+0
Identity = 695/1950 (35.64%), Postives = 1066/1950 (54.67%), Query Frame = 1
Query:  661 KYLSVDYFHRQLLEMTAPIIFGKIYFTPDSEFTRQIIKKANITFEILDNLR-LSAVEWRLNFRDWL----SNQVNNSSTLDNMSNNAKVCME-------TSQNYYTVCQLIYKSSDRNRIQNSIEIASRIFD-------LIERGLNCTELNKFQPMKSKVDIDNLAQNKL--INIFAGVVFNESFQYLTLNNATVLNYQIRMPTNRIDSTKNFKVLDTFWNPIPRRDTIYDLKYYTSGFLFLQEAFDQAFIELVTGNVTINIGTSMQIMPYPCFVDDRFIKFLSMIMPFILIIAWTPSVTIIIKSIVYEKENRLKEFMLLMGLTNFVHWCSWFISTIVVLIFPVIFMTLILKYNEIIQFSSPGIIFILILSYVISFICQSFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENIAIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGL-SKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFL-EKSFE---------------IQSETCHNNKASESG--------------TKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQITSEMLDTLTDGGNLPRPVSVLSFRKKTI--------NTANINDPKVSFEFENNLVL----------LSGLSLIFQQISGLFIKRFHHTKRNIKGXXXXXXXXXXXXXXXXXXXXXXXXMDNQPSMTISPWLMMPKTRLVNLNTFYRKENTSDQISFKLNENYRSDIGQSGVRCM------NTSLYQLENFKCLYP--------YNTNKWSEKSPIEISLVTPECDCSTTGNQ----ICSSPLSGGPESSNRIMASSDRLYDLSSYNISDYLMKNFKTFIMK-----------QYGGLQFILPSFFGQSCQVIGESQIWFD----FRQSINSSRDNNSNPEQVKFLNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFSYLRYNIS---GGDENYNAFEWDITGNKICSLGILFVGWCLIIVFMESKHKKTLCIKLKDVKLKPYEIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFDSSV-KLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKNDS 6189
            K L      R + +   P++ GKI +TPD+  TRQ++ + N TF+ L     L  +   L+ + W     S +++    L +  +N     +       T+Q+   V  L     D      S+      F+        I R + C  LNK +P+ ++V + N +   L     +AG+VF       ++     + Y+IRM  + ++ T   K+ D +W+P PR D   D++Y   GF +LQ+  +QA I ++TG      G  MQ MPYPC+VDD F++ +S  MP  + +AW  SV +IIK IVYEKE RLKE M +MGL N + W SWFIS+++ L+     + +ILK   ++ +S P ++F+ +  + +  I Q F+IS  F  +N+AA  GGI+YF  YLP+++ + +QD +   +     LL+ V+F     +    E+   G Q+ NLF S + +  F +   + M+  D+  Y ++ WY+EAVFPG+YG+P+PWYF  T+ YW  F + +D      + ++R   I +   E+EP  L++G+ I+NLVK +      A+D L L FY+ QIT FLGHNGAGKTTT+SILTG+  PTSGTA+IL  DIR +M  IR  +G+CPQHN+LF  LTVE+HI+FY  LKG+++  +K ++  +  +VGL S KLK  +  LSGGM+RKLS+A+AFVG S+++ LDEPTAGVDP+SRRGIW+L++KYR   RTIIL+THHMDEAD L DRIAIIS GKL C GSSLFLK   G GYYL L +K  E               ++ E   +  +S++G              + +   I+K +  ++L+++   + T VL + +     F  LF ++D  L  L I+SYG+S+T+LEE+FLKVA++                 +D  T  G LP   +  +F  K          + A+ ND  +  E     +L          + G  L  QQ   L  KR    +R+ KG F++++LP + + +      I       PS+ + PW+   +       TF   +   D  + +L      D G  G RCM      +T     E      P        +    W+ ++P      +P C CS+   +    +C    +GG     R   ++D L DL+  NISDYL+K +   I K           +YGG      S    + Q +  SQ   D     ++ +  ++D++++    +FLN    F      K N+ ++W N+KG+ ++ ++ N+ +N +LR+ +   +   +YGI   N+PL  T+  L         ++V ++I VIF +SF+PASFV+FLI+ERV+ +K  Q++SGV P +YW+SNF WD   Y +   +VI+ F+ F  +SY+ S N+    +LL LY  ++ P MYP SF     STA+VV+++ NL +G   ++ TF L+L+   D  L + ND LK +FLIFP + LGRG+ID+  +    +     G +   +   WD+ G  + ++ +  V + LI V ++  ++  +  +  + KL P   + DED DV +ER+RI L+    ND+L++  LTKIY                      KRK AV+ I  G+  GECFGLLGVNGAGK++TFKML G+  +T G+A +N  SI+ +  + H+NMG+CPQFDA+  LLT  E + F+  +RG+   ++    + +++ L L  +  K     SGGNKRK+ TA+ALIG P +VFLDEPT GMD  ARRFLW    ++  E + +V+LTSH+MEECE LC R+AIMV+G  + +GSVQHLK++FG  Y + +R+  +   L    +   +     +  + +KE++  +++Y+  SS+  L+ IF +    +    +++YSVSQ +LD+VF+NFAK+ S
Sbjct:  360 KNLESSPLSRIIWKALKPLLVGKILYTPDTPATRQVMAEVNKTFQELAVFHDLEGMWEELSPKIWTFMENSQEMDLVRMLLDSRDNDHFWEQQLDGLDWTAQD--IVAFLAKHPEDVQSSNGSVYTWREAFNETNQAIRTISRFMECVNLNKLEPIATEVWLINKSMELLDERKFWAGIVFT-GITPGSIELPHHVKYKIRMDIDNVERTN--KIKDGYWDPGPRADPFEDMRYVWGGFAYLQDVVEQAIIRVLTGTEK-KTGVYMQQMPYPCYVDDIFLRVMSRSMPLFMTLAWIYSVAVIIKGIVYEKEARLKETMRIMGLDNSILWFSWFISSLIPLLVSAGLLVVILKLGNLLPYSDPSVVFVFLSVFAVVTILQCFLISTLFSRANLAAACGGIIYFTLYLPYVLCVAWQDYVGFTLKIFASLLSPVAFGFGCEYFALFEEQGIGVQWDNLFESPVEEDGFNLTTSVSMMLFDTFLYGVMTWYIEAVFPGQYGIPRPWYFPCTKSYW--FGEESDEKSHPGSNQKRISEICM---EEEPTHLKLGVSIQNLVKVYRDGMKVAVDGLALNFYEGQITSFLGHNGAGKTTTMSILTGLFPPTSGTAYILGKDIRSEMSTIRQNLGVCPQHNVLFDMLTVEEHIWFYARLKGLSEKHVKAEMEQMALDVGLPSSKLKSKTSQLSGGMQRKLSVALAFVGGSKVVILDEPTAGVDPYSRRGIWELLLKYRQ-GRTIILSTHHMDEADVLGDRIAIISHGKLCCVGSSLFLKNQLGTGYYLTLVKKDVESSLSSCRNSSSTVSYLKKEDSVSQSSSDAGLGSDHESDTLTIDVSAISNLIRKHVSEARLVEDIGHELTYVLPYEAAKEGAFVELFHEIDDRLSDLGISSYGISETTLEEIFLKVAEESG---------------VDAETSDGTLPARRNRRAFGDKQSCLRPFTEDDAADPNDSDIDPESRETDLLSGMDGKGSYQVKGWKLTQQQFVALLWKRLLIARRSRKGFFAQIVLPAVFVCIALVFSLIVPPFGKYPSLELQPWMYNEQY------TFVSNDAPEDTGTLELLNALTKDPG-FGTRCMEGNPIPDTPCQAGEEEWTTAPVPQTIMDLFQNGNWTMQNP------SPACQCSSDKIKKMLPVCPP-GAGGLPPPQRKQNTADILQDLTGRNISDYLVKTYVQIIAKSLKNKIWVNEFRYGGF-----SLGVSNTQALPPSQEVNDAIKQMKKHLKLAKDSSAD----RFLNSLGRFMTGLDTKNNV-KVWFNNKGWHAISSFLNVINNAILRANLQKGENPSHYGITAFNHPLNLTKQQLSEVALMTTSVDVLVSICVIFAMSFVPASFVVFLIQERVSKAKHLQFISGVKPVIYWLSNFVWDMCNYVVPATLVIIIFICFQQKSYVSSTNLPVLALLLLLYGWSITPLMYPASFVFKIPSTAYVVLTSVNLFIGINGSVATFVLELFT--DNKLNNINDILKSVFLIFPHFCLGRGLIDMVKNQAMADALERFGENRFVSPLSWDLVGRNLFAMAVEGVVFFLITVLIQ--YRFFIRPRPVNAKLSP---LNDEDEDVRRERQRI-LDGGGQNDILEIKELTKIY--------------------RRKRKPAVDRICVGIPPGECFGLLGVNGAGKSSTFKMLTGDTTVTRGDAFLNKNSILSNIHEVHQNMGYCPQFDAITELLTGREHVEFFALLRGVPEKEVGKVGEWAIRKLGLVKYGEKYAGNYSGGNKRKLSTAMALIGGPPVVFLDEPTTGMDPKARRFLWNCALSVVKEGR-SVVLTSHSMEECEALCTRMAIMVNGRFRCLGSVQHLKNRFGDGYTIVVRIAGSNPDLKPVQDFFGL----AFPGSVLKEKHRNMLQYQLPSSLSSLARIFSILSQSKKRLHIEDYSVSQTTLDQVFVNFAKDQS 2225          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Human
Match: ABCA4 (ATP binding cassette subfamily A member 4 [Source:HGNC Symbol;Acc:HGNC:34])

HSP 1 Score: 1066.99 bits (2758), Expect = 0.000e+0
Identity = 672/1934 (34.75%), Postives = 1054/1934 (54.50%), Query Frame = 1
Query:  712 PIIFGKIYFTPDSEFTRQIIKKANITFEILDNLRLSAVEWR-LNFRDW--LSNQVNNSSTLDNMSNNA------KVCMETSQNYYTVCQLIYKSSDRNRI--------QNSIEIASRIFDLIERGLNCTELNKFQPMKSKVDIDNLAQNKLI-NIF-AGVVFNESFQYLTLNNATVLNYQIRMPTNRIDSTKNFKVLDTFWNPIPRRDTIYDLKYYTSGFLFLQEAFDQAFIELVTGNVTINIGTSMQIMPYPCFVDDRFIKFLSMIMPFILIIAWTPSVTIIIKSIVYEKENRLKEFMLLMGLTNFVHWCSWFISTIVVLIFPVIFMTLILKYNEIIQFSSPGIIFILILSYVISFICQSFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIP----FSKNNDNIEISDNFRQREEN------IAIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFE-IQSE------TCHNNKASESGT-------------------KLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADD-------PSQISHKRQEKQITSEMLDTLTDGGNLPRPVSVLSFRKKTINTANINDPKVSFEFENNLVLLSGLSLIFQQISGLFIKRFHHTKRNIKGXXXXXXXXXXXXXXXXXXXXXXXXMDNQPSMTISPWLMMPKTRLVNLNTFYRKENTSDQISFKLNENYRSDIGQSGVRCMNTSLYQLENFKC--LYPYNT-------------NKWSEKSPIEISLVTPECDCSTTG--NQICSSPL-SGGPESSNRIMASSDRLYDLSSYNISDYLMKNFKTFIM-----------KQYGGLQFILPSFFGQ--SCQVIGESQIWF--DFRQSINSSRDNNSNPEQVKFLNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFS------YLRYNISGGDENYNAFEWDITGNKICSLGILFVGWCLIIVFMESKHKKTLCIKLKDVKLKPY-EIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLH-PNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFDSSVKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKNDSVTRNI 6204
            P++ GKI +TPDS   R+I+K AN TFE L+++R     W  +  + W    N    +   D + N        +   E       +   +YK    ++         ++   I  R   L+ + L C  L+KF+    +  +   A + L  N+F AGVVF + + + T +    + Y+IRM  + ++ T   K+ D +W+  PR D + D +Y   GF +LQ+  +Q  I          +G  +Q MPYPCFVDD F+  L+   P  +++AW  SV++ +KSIV EKE RLKE +   G++N V WC+WF+ +  ++   +  +T+ + +  I+ +S P I+F+ +L++  + I   F++S FF  +++AA   G++YF  YLP ++   +QD ++ E+   V LL+ V+F     ++   E+   G Q+SN+ NS      F     + M+ +D+  Y L+AWY++ VFPG YG P PWYFL    YW+      ++    +E ++   +  E+      I    FE+E      G+ ++NLVK F     PA+D LN+ FY++QIT FLGHNGAGKTTT+SILTG+L PTSGT  +   DI   ++ +R  +G+CPQHNILF +LTV +H+ FY  LKG ++ E + ++  ++++ GL  K    +++LSGGM+RKLS+A+AFVG+++++ LDEPT+GVDP+SRR IWDL++KYRS  RTII++THHMDEAD L DRIAII+QG+L C G+ LFLK  FG G YL L +  + IQS+      TC  +    S T                   +L++ +   +P +KL++    +   +L + +     + SLF +L+ +L  L ++S+G+SDT LEE+FLKV +D             KR+        L      G  P+  +V S        A+               L +G  L+ Q +  L +KRF HT R+ K   ++++LP   + L   L  +       P++T+ PW+   +    +++     E  S+Q  F +  +   +    G RC+      L  + C    P+ T              KW++ +P      +P C CST      +   P  +GG     R   S++ L DL+  NISD+L+K +   I            ++YGG+     S  G+     + GE+ + F  D  + +N S    +     +  ++ +       IK     +W N+KG+ ++ ++ N+  N +LR+++   ++ + YGI V + PL  T+  L         ++  +AI VIF +SF+PASFV++LI+ERV  SK  Q++SGV+P  YW++NF WD + YS+S  +V+  F+ F  ++Y   +N+ A + LL LY  AVIP MYP SF     STA+V +S  NL +G  ++  TF L+L++ ++ +L   N  L+K+ ++FP + LGRG+IDL+ S      Y R+   G + + N F WD+ G  + ++ +  V + L+ + ++ +H       L     +P  E I DED DV +ER+RI +      D+L+++ LTKIY                  SS      AV+ +  GV+ GECFGLLGVNGAGKTTTFKML G+  +T G+A + G SI+ +  + H+NMG+CPQFDA+  LLT  E LY Y R+RG+   +I    + S+K+L LT + +      SGGNKRK+ TAIALIG P +V LDEPT GMD  ARR LW +I ++  E + AV+LTSH+MEECE LC RLAIMV G  + +G++QHLKSKFG  Y V +++  P  + L D N +E         S + +E +  +++++  SS  L+ IF++    + + +++EYSV+Q +LD+VF+NFAK  + + ++
Sbjct:  392 PLLMGKILYTPDSPAARRILKNANSTFEELEHVRKLVKAWEEVGPQIWYFFDNSTQMNMIRDTLGNPTVKDFLNRQLGEEGITAEAILNFLYKGPRESQADDMANFDWRDIFNITDRTLRLVNQYLECLVLDKFESYNDETQLTQRALSLLEENMFWAGVVFPDMYPW-TSSLPPHVKYKIRMDIDVVEKTN--KIKDRYWDSGPRADPVEDFRYIWGGFAYLQDMVEQG-ITRSQVQAEAPVGIYLQQMPYPCFVDDSFMIILNRCFPIFMVLAWIYSVSMTVKSIVLEKELRLKETLKNQGVSNAVIWCTWFLDSFSIMSMSIFLLTIFIMHGRILHYSDPFILFLFLLAFSTATIMLCFLLSTFFSKASLAAACSGVIYFTLYLPHILCFAWQDRMTAELKKAVSLLSPVAFGFGTEYLVRFEEQGLGLQWSNIGNSPTEGDEFSFLLSMQMMLLDAAVYGLLAWYLDQVFPGDYGTPLPWYFLLQESYWLGGEGCSTREERALEKTEPLTEETEDPEHPEGIHDSFFEREHPGWVPGVCVKNLVKIFEPCGRPAVDRLNITFYENQITAFLGHNGAGKTTTLSILTGLLPPTSGTVLVGGRDIETSLDAVRQSLGMCPQHNILFHHLTVAEHMLFYAQLKGKSQEEAQLEMEAMLEDTGLHHKRNEEAQDLSGGMQRKLSVAIAFVGDAKVVILDEPTSGVDPYSRRSIWDLLLKYRS-GRTIIMSTHHMDEADLLGDRIAIIAQGRLYCSGTPLFLKNCFGTGLYLTLVRKMKNIQSQRKGSEGTCSCSSKGFSTTCPAHVDDLTPEQVLDGDVNELMDVVLHHVPEAKLVECIGQELIFLLPNKNFKHRAYASLFRELEETLADLGLSSFGISDTPLEEIFLKVTEDSDSGPLFAGGAQQKRENVNPRHPCLGPREKAGQTPQDSNVCS---PGAPAAHPEGQPPPEPECPGPQLNTGTQLVLQHVQALLVKRFQHTIRSHKDFLAQIVLPATFVFLALMLSIVIPPFGEYPALTLHPWIYGQQYTFFSMD-----EPGSEQ--FTVLADVLLNKPGFGNRCLKEGW--LPEYPCGNSTPWKTPSVSPNITQLFQKQKWTQVNP------SPSCRCSTREKLTMLPECPEGAGGLPPPQRTQRSTEILQDLTDRNISDFLVKTYPALIRSSLKSKFWVNEQRYGGI-----SIGGKLPVVPITGEALVGFLSDLGRIMNVSGGPITREASKEIPDFLKHLETEDNIK-----VWFNNKGWHALVSFLNVAHNAILRASLPKDRSPEEYGITVISQPLNLTKEQLSEITVLTTSVDAVVAICVIFSMSFVPASFVLYLIQERVNKSKHLQFISGVSPTTYWVTNFLWDIMNYSVSAGLVVGIFIGFQKKAYTSPENLPALVALLLLYGWAVIPMMYPASFLFDVPSTAYVALSCANLFIGINSSAITFILELFE-NNRTLLRFNAVLRKLLIVFPHFCLGRGLIDLALSQAVTDVYARF---GEEHSANPFHWDLIGKNLFAMVVEGVVYFLLTLLVQ-RH-----FFLSQWIAEPTKEPIVDEDDDVAEERQRI-ITGGNKTDILRLHELTKIYP---------------GTSSP-----AVDRLCVGVRPGECFGLLGVNGAGKTTTFKMLTGDTTVTSGDATVAGKSILTNISEVHQNMGYCPQFDAIDELLTGREHLYLYARLRGVPAEEIEKVANWSIKSLGLTVYADCLAGTYSGGNKRKLSTAIALIGCPPLVLLDEPTTGMDPQARRMLWNVIVSIIREGR-AVVLTSHSMEECEALCTRLAIMVKGAFRCMGTIQHLKSKFGDGYIVTMKIKSPKDDLLPDLNPVEQFFQGNFPGSVQ-RERHYNMLQFQVSSS-SLARIFQLLLSHKDSLLIEEYSVTQTTLDQVFVNFAKQQTESHDL 2258          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Human
Match: ABCA7 (ATP binding cassette subfamily A member 7 [Source:HGNC Symbol;Acc:HGNC:37])

HSP 1 Score: 1032.71 bits (2669), Expect = 0.000e+0
Identity = 633/1926 (32.87%), Postives = 1021/1926 (53.01%), Query Frame = 1
Query:  640 TCQEVYEKYLSVDYFHRQLLEMTAPIIFGKIYFTPDSEFTRQIIKKANITFEILDNLRLSAVEWRL------NFRDWLSNQVNNSSTLDNMSNNAKVCMETSQNYYTVCQ-LIYKSSDRNRIQNSIEIASRIFDLIERGLNCTELNKFQPMKSKVDIDNLAQNKLIN--IFAGVVF------NESFQYLTLN-NATVLNYQIRMPTNRIDSTKNFKVLDTFWNPIPRRDTIYDLKYYTSGFLFLQEAFDQAFIELVTGNVTINIGTSMQIMPYPCFVDDRFIKFLSMIMPFILIIAWTPSVTIIIKSIVYEKENRLKEFMLLMGLTNFVHWCSWFISTIVVLIFPVIFMTLILKYNEIIQFSSPGIIFILILSYVISFICQSFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENIAIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFL-----------------EKSFEIQSETCHNNKASESGT-KLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQITSEMLDTLTDGGNLPRPVSVLSFRKKTINTANINDPKVSFEFENN-------LVLLSGLSLIFQQISGLFIKRFHHTKRNIKGXXXXXXXXXXXXXXXXXXXXXXXXMDNQPSMTISPWLMMPKTRLVNLNTFYRKENTSDQISFKLNENYRSDIG------QSGVRCMNTSLYQLENFKCLYPYNTNKWSEKSPIEISLVTPECDCSTTGNQI----CSSPLSGGPESSNRIMASSDRLYDLSSYNISDYLMKNFKTFIMK-----------QYGGLQFILPSFFGQSCQVIGES--QIWFDFRQSINSSRDNNSNPEQVKFLNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDL--------SFSYLRYNISGGDENYNA-FEWDITGNKICSLGILFVGWCLIIVFMESKHKKTLCIKLKDVKLKPYEIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFDSSVKLSDIFRVFEDLRTN---EMVKEYSVSQMSLDEVFINFAKNDS 6189
             C E+    L      R L     P+I GK+ F PD+ FTR+++ + N TFE L  LR     W +       F +  SN       L       +      +++    +  +   S     Q++      +   + R   C  L+K +   S+  + + A   L     +AGVVF      ++  ++ T +     +  +IRM  + +  T+  K+ D FW+P P  D + DL+Y   GF++LQ+  ++A + +++G      G  +Q MPYPC+VDD F++ LS  +P  L +AW  SVT+ +K++V EKE RL++ M  MGL+  V W  WF+S +   +     + L+LK  +I+ +S PG++F+ + ++ ++ + QSF++S FF  +N+AA  GG+ YF  YLP+++ + ++D L         LL+ V+F      +  LE+  +GAQ+ N+      D+ F +     ++ +D+  Y L  WY+EAV PG+YG+P+PW F F R YW                   +  + +   E+ P  L  G+ + +L K+FP S  PAL  L+L FYQ  IT FLGHNGAGKTTT+SIL+G+  P+ G+AFIL +D+R  M  IR  +G+CPQ+N+LF  LTV++H++FYG LKG++ + +  +   ++++VGL  K    +++LSGGM+RKLS+A+AFVG S+++ LDEPTAGVDP SRRGIW+L++KYR   RT+IL+THH+DEA+ L DR+A+++ G+L CCGS LFL+++ G GYYL L                 E S + + E  + ++ S  GT +LL  ++  +P ++L++E   +  +VL +   +   F +LF +LD+ L  L++  YG+SDTSLEE+FLKV ++ +  +    E     + L T   G ++      L  +     TA  N        E +       +  + G +L  QQ+  L +KRF   +R+ +GLF++++LP L + L      I     + P++ +SP +   +       +F+ ++   D    +L E    + G      Q      +      E  K L    +  W+ +SP      +P C CS  G +     C +   G       +  S + + +L+  N+SD+L+K +   + +           +YGG           S Q +G S  ++W         + D        + L     + +S   + +L +IW N+KG+ SM A+ N  SN +LR+ +    A   + I   N+PL  T+  L         ++V ++I V+F +SF+PASF + LIEERVT +K  Q + G++P +YW+ NF WD   Y +   IV+L FLAF  ++Y+   N+ A ++LL LY  ++ P MYP SFF S  STA+VV++  NL +G   ++ TF L+L  + D  L+  +  LK++FLIFP + LGRG+ID+        +F  L      GD  + +   W++ G  +  L ++  G   ++  +  +H+  L   L   +++   ++ +ED DV +ERER+ +      DVL +  LTK+Y                      +R  AV+ +  G+  GECFGLLGVNGAGKT+TF+M+ G+   + G A++ G+S+  +   AH +MG+CPQ DA+  LLT  E L    R+RG+  + +       L  L L+ + ++P    SGGNKRK+ TA+AL+G P +VFLDEPT GMD  ARRFLW  +  +  E + +V+LTSH+MEECE LC RLAIMV+G  + +GS QHLK +F   + + +R+       + R++         +  A ++E +   + ++     + + + RVF +L  +     V+++SVSQ  L+EVF+ F+K+  
Sbjct:  266 ACSELI-GALDSHPLSRLLWRRLKPLILGKLLFAPDTPFTRKLMAQVNRTFEELTLLRDVREVWEMLGPRIFTFMNDSSNVAMLQRLLQMQDEGRRQPRPGGRDHMEALRSFLDPGSGGYSWQDAHADVGHLVGTLGRVTECLSLDKLEAAPSEAALVSRALQLLAEHRFWAGVVFLGPEDSSDPTEHPTPDLGPGHVRIKIRMDIDVV--TRTNKIRDRFWDPGPAADPLTDLRYVWGGFVYLQDLVERAAVRVLSG-ANPRAGLYLQQMPYPCYVDDVFLRVLSRSLPLFLTLAWIYSVTLTVKAVVREKETRLRDTMRAMGLSRAVLWLGWFLSCLGPFLLSAALLVLVLKLGDILPYSHPGVVFLFLAAFAVATVTQSFLLSAFFSRANLAAACGGLAYFSLYLPYVLCVAWRDRLPAGGRVAASLLSPVAFGFGCESLALLEEQGEGAQWHNVGTRPTADV-FSLAQVSGLLLLDAALYGLATWYLEAVCPGQYGIPEPWNFPFRRSYWCGPRPPKSPAPCPTPL---DPKVLV---EEAPPGLSPGVSVRSLEKRFPGSPQPALRGLSLDFYQGHITAFLGHNGAGKTTTLSILSGLFPPSGGSAFILGHDVRSSMAAIRPHLGVCPQYNVLFDMLTVDEHVWFYGRLKGLSAAVVGPEQDRLLQDVGLVSKQSVQTRHLSGGMQRKLSVAIAFVGGSQVVILDEPTAGVDPASRRGIWELLLKYRE-GRTLILSTHHLDEAELLGDRVAVVAGGRLCCCGSPLFLRRHLGSGYYLTLVKARLPLTTNEKADTDMEGSVDTRQEKKNGSQGSRVGTPQLLALVQHWVPGARLVEELPHELVLVLPYTGAHDGSFATLFRELDTRLAELRLTGYGISDTSLEEIFLKVVEECA--ADTDMEDGSCGQHLCTGIAGLDV-----TLRLKMPPQETALENGEPAGSAPETDQGSGPDAVGRVQGWALTRQQLQALLLKRFLLARRSRRGLFAQIVLPALFVGLALVFSLIVPPFGHYPALRLSPTMYGAQV------SFFSEDAPGDPGRARLLEALLQEAGLEEPPVQHSSHRFSAPEVPAEVAKVL---ASGNWTPESP------SPACQCSRPGARRLLPDCPAAAGGP-PPPQAVTGSGEVVQNLTGRNLSDFLVKTYPRLVRQGLKTKKWVNEVRYGGFSLGGRDPGLPSGQELGRSVEELWALLSPLPGGALD--------RVLKNLTAWAHSLDAQDSL-KIWFNNKGWHSMVAFVNRASNAILRAHLPPGPARHAHSITTLNHPLNLTKEQLSEGALMASSVDVLVSICVVFAMSFVPASFTLVLIEERVTRAKHLQLMGGLSPTLYWLGNFLWDMCNYLVPACIVVLIFLAFQQRAYVAPANLPALLLLLLLYGWSITPLMYPASFFFSVPSTAYVVLTCINLFIGINGSMATFVLEL--FSDQKLQEVSRILKQVFLIFPHFCLGRGLIDMVRNQAMADAFERL------GDRQFQSPLRWEVVGKNL--LAMVIQGPLFLLFTLLLQHRSQL---LPQPRVRSLPLLGEEDEDVARERERV-VQGATQGDVLVLRNLTKVYR--------------------GQRMPAVDRLCLGIPPGECFGLLGVNGAGKTSTFRMVTGDTLASRGEAVLAGHSVAREPSAAHLSMGYCPQSDAIFELLTGREHLELLARLRGVPEAQVAQTAGSGLARLGLSWYADRPAGTYSGGNKRKLATALALVGDPAVVFLDEPTTGMDPSARRFLWNSLLAVVREGR-SVMLTSHSMEECEALCSRLAIMVNGRFRCLGSPQHLKGRFAAGHTLTLRVP------AARSQPAAAFVAAEFPGAELREAHGGRLRFQLPPGGRCA-LARVFGELAVHGAEHGVEDFSVSQTMLEEVFLYFSKDQG 2105          

HSP 2 Score: 153.295 bits (386), Expect = 3.679e-36
Identity = 102/357 (28.57%), Postives = 175/357 (49.02%), Query Frame = 1
Query: 5251 INVSSEDKR-----KLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYY---VKIRLHPNRNSLSD---RNEIETIINK------------------EIW-SSARMKEENA----VIIEYRFDSSVKLSDIFRVFEDLRTNEM-VKEYSVSQMSLDEVFINFAKNDSVTRNISNGN 6216
            ++V S +KR     + A+  +S    +G     LG NGAGKTTT  +L G    + G+A I G+ +         ++G CPQ++ L  +LT +E ++FY R++G+  + +    D  L+++ L    +  T  +SGG +RK+  AIA +G  ++V LDEPT G+D  +RR +W L+  L       +IL++H+++E E+L  R+A++  G +   GS   L+   G  YY   VK RL    N  +D      ++T   K                  + W   AR+ EE      +++ Y        + +FR   D R  E+ +  Y +S  SL+E+F+   +  +   ++ +G+
Sbjct:  807 VSVRSLEKRFPGSPQPALRGLSLDFYQGHITAFLGHNGAGKTTTLSILSGLFPPSGGSAFILGHDVRSSMAAIRPHLGVCPQYNVLFDMLTVDEHVWFYGRLKGLSAAVVGPEQDRLLQDVGLVSKQSVQTRHLSGGMQRKLSVAIAFVGGSQVVILDEPTAGVDPASRRGIWELL--LKYREGRTLILSTHHLDEAELLGDRVAVVAGGRLCCCGSPLFLRRHLGSGYYLTLVKARLPLTTNEKADTDMEGSVDTRQEKKNGSQGSRVGTPQLLALVQHWVPGARLVEELPHELVLVLPYTGAHDGSFATLFREL-DTRLAELRLTGYGISDTSLEEIFLKVVEECAADTDMEDGS 1160          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Human
Match: ABCA12 (ATP binding cassette subfamily A member 12 [Source:HGNC Symbol;Acc:HGNC:14637])

HSP 1 Score: 884.404 bits (2284), Expect = 0.000e+0
Identity = 627/1887 (33.23%), Postives = 991/1887 (52.52%), Query Frame = 1
Query:  712 PIIFGKIYFTPDSEFTRQIIKKANITFEILDNLRLSAVEWR------LNFRDWLSNQVNNSSTLDNMSNNAKVCMETSQNYYTVCQLIYKSSD-----RNRIQNSIEIASRIFDLIERGLN---CTELNKFQPMKSKVDIDNLAQN--KLINIFAGVVF----NESFQ--YLTLNN--ATVLNYQIRMPTNRIDSTKNFKVLDTFWNPIPRRDTIYDLKYYTSGFLFLQEAFDQAFIELVTGNVTINIGTSMQIMPYPCFVDDRFIKFLSMIMPFILIIAWTPSVTIIIKSIVYEKENRLKEFMLLMGLTNFVHWCSWFISTIVVLIFPVIFMTLILKYNEIIQFSSPGIIFILILSYVISFICQSFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYW--------IPFSKNND----NIEISD-NFRQREENIAIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLK--GMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTN-RNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQITSEMLDTLTDGGNLPRPVSVLSFRKKTINTANINDPKVSFEFENNLVLLSGLSLIFQQISGLFIKRFHHTKRNIKGXXXXXXXXXXXXXXXXXXXXXXXXMDNQPSMTISPWLMMPKTRLVNLNTFYRKENTSDQISFKLNENYRSDIGQSGV--------RCMNTSLYQLENFKCLYPYNTNKW-SEKSPIEISLVTPECDCSTTGNQICSSPLSGGPESSNRIMASSDRLYDLSSYNISDYLMKNFKTFIMKQYGGLQFILPSFFGQSCQVIGESQIWFDFRQSINSSRDNNSNPEQVKFLNYFQLFFNSSGIKTN--LSRIWINSKGYISMPAYANIFSNLLLRSTVNASK-ALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTIT---TFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLS-----FSYLR-YNISGGDENYNAFEWDITGNKICSLGILFVGWCLIIVFMESKHKKTLCIKLKDVKLKPYEIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNM-GFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFD-SSVKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKN 6183
            P++ G+I + P +  T+ I++K+N+T   L  LR  + EW       +N    L+  +     L N   N  V +    +       + K  D     R +++N+I+I  ++  L    +N   C   ++ Q  K+  +++  A+   K   +F  V+F    N S+   Y + N     V+ Y IRM      +T++ +     W P P     ++ + Y   F++LQ++ ++A IEL TG  +  I   +Q +PYPCF+ D F+  +S  +P +L++AW   +   +K +VYEK+ RL E+M +MG+ +  H+ +W I ++  L+  ++ + +ILK+  I+  ++  I+F+    Y  S I  S++ISVFF+N+N+AA++G ++Y I + PF+V +  ++ELS  +   + LL+  +F  A  +I   E+   G Q+ N++ S + D     G    +I  DS  Y LIAWYV  VFPG YG+  PWYF     YW        +   K+N     NI + + N     E +     E EP DL +G+ +  + K +  SK  A+DNLNL FY+  IT  LG NGAGKTTTIS+LTG+   ++GT F+   DI+ D+  +R  +G+C QH++LF+YLT ++H+  YG +K    TK ++  ++   +K+ GL          LSGGMKRKLSI++A +G SR++ LDEP+ GVDP SRR IWD+I K ++  RTIIL+THH+DEA+ L DRIA + QG L+CCGS  +LK+ FGDGY+L L K    +S   + N   ++   +   I+  +P + L ++   +   VL   ST     + SL   LD+ +  L I  YG+SDT++EEVFL +  +  + S    E     ++ ++  +G + P  +SV S      +     D K+    E     L G  L+ ++I  + IKRFHHT+RN KGL +++ILP++ +    GL  +++S ++ P + ISP L                  TS+Q +F  N +  ++   S +         C+NTS     + +CL   +  KW +   PI    V   C CS    Q C       P   +R   SS  +Y+L+   + +YL+     F+ K+YGG  F LP              +  D R                         F+ +G+  N  L+++W + +GY S+PAY N  +N LLR  VN SK     +GI + ++P    Q    + I +   +++ +A+ ++ G S   ASFV +++ E  T +K  Q++SG+    YW++NF +D + Y + V   I     F   ++    N+ A  +LL L+  A    MY  +    ++  AF+     NL  G  + ++    ++L   + +D +L+  ++ LK+IFLIFPQ+  G G+I+LS       +L+ Y +   +E +   +       + S G +F    L+I   ES  KK L +  +           DED DV  ER R+E       D++Q+Y LTK Y              +I+     K+ +AVNNIS G+  GECFGLLGVNGAGKTT FKML G+   + GN +I   +     + +H ++ G+CPQ DAL  L+T EE LYFY R+ GI   DI   V   L+ L L P  ++ T M S G KRK+ TA+ALIG P I+ LDEP+ GMD  ++R LW++I     ++K +VILTSH+MEECE LC RLAIMV+G+ + IGS+QH+KS+FG  + VK+ L  N+ ++    E  T   +  +    +K+++  ++EY    ++  +++IF + E  +T   +  + VSQ +L+EVFINFAK+
Sbjct:  803 PMLLGRILYAPYNPVTKAIMEKSNVTLRQLAELREKSQEWMDKSPLFMNSFHLLNQAI---PMLQNTLRNPFVQVFVKFSVGLDAVELLKQIDELDILRLKLENNIDIIDQLNTLSSLTVNISSCVLYDRIQAAKTIDEMEREAKRLYKSNELFGSVIFKLPSNRSWHRGYDSGNVFLPPVIKYTIRMSLKTAQTTRSLRT--KIWAPGPHNSPSHN-QIYGRAFIYLQDSIERAIIELQTGRNSQEIAVQVQAIPYPCFMKDNFLTSVSYSLPIVLMVAWVVFIAAFVKKLVYEKDLRLHEYMKMMGVNSCSHFFAWLIESVGFLLVTIVILIIILKFGNILPKTNGFILFLYFSDYSFSVIAMSYLISVFFNNTNIAALIGSLIYIIAFFPFIVLVTVENELSYVLKVFMSLLSPTAFSYASQYIARYEEQGIGLQWENMYTSPVQDDTTSFGWLCCLILADSFIYFLIAWYVRNVFPGTYGMAAPWYFPILPSYWKERFGCAEVKPEKSNGLMFTNIMMQNTNPSASPEYMFSSNIEPEPKDLTVGVALHGVTKIY-GSKV-AVDNLNLNFYEGHITSLLGPNGAGKTTTISMLTGLFGASAGTIFVYGKDIKTDLHTVRKNMGVCMQHDVLFSYLTTKEHLLLYGSIKVPHWTKKQLHEEVKRTLKDTGLYSHRHKRVGTLSGGMKRKLSISIALIGGSRVVILDEPSTGVDPCSRRSIWDVISKNKTA-RTIILSTHHLDEAEVLSDRIAFLEQGGLRCCGSPFYLKEAFGDGYHLTLTKK---KSPNLNANAVCDT-MAVTAMIQSHLPEAYLKEDIGGELVYVLPPFSTKVSGAYLSLLRALDNGMGDLNIGCYGISDTTVEEVFLNLTKESQKNSAMSLEHLTQKKIGNSNANGISTPDDLSVSS------SNFTDRDDKILTRGER----LDGFGLLLKKIMAILIKRFHHTRRNWKGLIAQVILPIVFVTTAMGLGTLRNSSNSYPEIQISPSLY----------------GTSEQTAFYANYHPSTEALVSAMWDFPGIDNMCLNTS-----DLQCLNKDSLEKWNTSGEPITNFGV---CSCS-ENVQECPKFNYSPP---HRRTYSSQVIYNLTGQRVENYLISTANEFVQKRYGGWSFGLP--------------LTKDLR-------------------------FDITGVPANRTLAKVWYDPEGYHSLPAYLNSLNNFLLR--VNMSKYDAARHGIIMYSHPYPGVQDQEQATISS--LIDILVALSILMGYSVTTASFVTYVVREHQTKAKQLQHISGIGVTCYWVTNFIYDMVFYLVPVAFSIGIIAIFKLPAFYSENNLGAVSLLLLLFGYATFSWMYLLAGLFHETGMAFITYVCVNLFFGINSIVSLSVVYFLSKEKPNDPTLELISETLKRIFLIFPQFCFGYGLIELSQQQSVLDFLKAYGVEYPNETFEMNKLGAMFVALVSQGTMFFSLRLLI--NESLIKK-LRLFFRKFNSSHVRETIDEDEDVRAERLRVESGAAEF-DLVQLYCLTKTYQ-------------LIH-----KKIIAVNNISIGIPAGECFGLLGVNGAGKTTIFKMLTGDIIPSSGNILIRNKTGSLGHVDSHSSLVGYCPQEDALDDLVTVEEHLYFYARVHGIPEKDIKETVHKLLRRLHLMPFKDRATSMCSYGTKRKLSTALALIGKPSILLLDEPSSGMDPKSKRHLWKIISEEV-QNKCSVILTSHSMEECEALCTRLAIMVNGKFQCIGSLQHIKSRFGRGFTVKVHLKNNKVTM----ETLTKFMQLHFPKTYLKDQHLSMLEYHVPVTAGGVANIFDLLETNKTALNITNFLVSQTTLEEVFINFAKD 2568          

HSP 2 Score: 157.918 bits (398), Expect = 1.560e-37
Identity = 165/675 (24.44%), Postives = 301/675 (44.59%), Query Frame = 1
Query: 1384 GTSMQIMPYPCFVDDRFIKFLSMI---MPFILIIAWTPSVTIIIKSIVYEKENRLKEFMLLMGLTNFVHWCSWFISTIVVLIFPVIFMTLILKYNEIIQFSSPGIIFILILSYVISFICQSFMISVFFDNSNVAAIVGGIVYFIF----YLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTI-----IDLNFGVGHCLIMI-WIDSVFYILIAWYVE------------AVFPGKYGVPKPWYFLFT----------RRYWIPFSKNNDNIEISDNFRQREENIAIDGFEKEPDDLEIGILIE--NLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRY-DMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQITSEMLDTLTD 3294
            G  M   PYP   D       S+I   +   +++ ++ +    +  +V E + + K+   + G+    +W + FI  +V  + PV F              S GII I             F +  F+  +N+ A+   ++ F +    ++  L  +  +  ++   Y  V L   ++   +++ + +L +         L + T+     I   F  G+ LI +    SV   L A+ VE            A+F         ++ L            R ++  F+ ++    I ++   R E + ++    E D +++  L +   L+ K    K  A++N+++     +  G LG NGAGKTT   +LTG + P+SG   I +       ++   S +G CPQ + L   +TVE+H+YFY  + G+ + +IK  +  +++ + L       +   S G KRKLS A+A +G   I+ LDEP++G+DP S+R +W +I +      ++ILT+H M+E + LC R+AI+  GK +C GS   +K  FG G        F ++    +N    E+ TK   F++   P + L D+     +++  H         ++F+ L+++   L I ++ +S T+LEEVF+  A D           Q ++  +D+  D
Sbjct: 1962 GIIMYSHPYPGVQDQEQATISSLIDILVALSILMGYSVTTASFVTYVVREHQTKAKQLQHISGIGVTCYWVTNFIYDMVFYLVPVAF--------------SIGIIAI-------------FKLPAFYSENNLGAVSLLLLLFGYATFSWMYLLAGLFHETGMAFITYVCVNLFFGINSIVSLSVVYFLSKEKPNDPTLELISETLKRIFLIFPQFCFGYGLIELSQQQSVLDFLKAYGVEYPNETFEMNKLGAMFVALVSQGTMFFSLRLLINESLIKKLRLFFRKFNSSHVRETIDEDEDVRAERLRVESGAAEFDLVQLYCLTKTYQLIHK----KIIAVNNISIGIPAGECFGLLGVNGAGKTTIFKMLTGDIIPSSGNILIRNKTGSLGHVDSHSSLVGYCPQEDALDDLVTVEEHLYFYARVHGIPEKDIKETVHKLLRRLHLMPFKDRATSMCSYGTKRKLSTALALIGKPSILLLDEPSSGMDPKSKRHLWKIISEEVQNKCSVILTSHSMEECEALCTRLAIMVNGKFQCIGSLQHIKSRFGRG--------FTVKVHLKNNKVTMETLTK---FMQLHFPKTYLKDQ---HLSMLEYHVPVTAGGVANIFDLLETNKTALNITNFLVSQTTLEEVFINFAKDQKSYETADTSSQGSTISVDSQDD 2591          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Human
Match: ABCA12 (ATP binding cassette subfamily A member 12 [Source:HGNC Symbol;Acc:HGNC:14637])

HSP 1 Score: 882.863 bits (2280), Expect = 0.000e+0
Identity = 629/1887 (33.33%), Postives = 991/1887 (52.52%), Query Frame = 1
Query:  712 PIIFGKIYFTPDSEFTRQIIKKANITFEILDNLRLSAVEWR------LNFRDWLSNQVNNSSTLDNMSNNAKVCMETSQNYYTVCQLIYKSSD-----RNRIQNSIEIASRIFDLIERGLN---CTELNKFQPMKSKVDIDNLAQN--KLINIFAGVVF----NESFQ--YLTLNN--ATVLNYQIRMPTNRIDSTKNFKVLDTFWNPIPRRDTIYDLKYYTSGFLFLQEAFDQAFIELVTGNVTINIGTSMQIMPYPCFVDDRFIKFLSMIMPFILIIAWTPSVTIIIKSIVYEKENRLKEFMLLMGLTNFVHWCSWFISTIVVLIFPVIFMTLILKYNEIIQFSSPGIIFILILSYVISFICQSFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYW--------IPFSKNND----NIEISD-NFRQREENIAIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLK--GMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTN-RNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQITSEMLDTLTDGGNLPRPVSVLSFRKKTINTANINDPKVSFEFENNLVLLSGLSLIFQQISGLFIKRFHHTKRNIKGXXXXXXXXXXXXXXXXXXXXXXXXMDNQPSMTISPWLMMPKTRLVNLNTFYRKENTSDQISFKLNENYRSDIGQSGV--------RCMNTSLYQLENFKCLYPYNTNKW-SEKSPIEISLVTPECDCSTTGNQICSSPLSGGPESSNRIMASSDRLYDLSSYNISDYLMKNFKTFIMKQYGGLQFILPSFFGQSCQVIGESQIWFDFRQSINSSRDNNSNPEQVKFLNYFQLFFNSSGIKTN--LSRIWINSKGYISMPAYANIFSNLLLRSTVNASK-ALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTIT---TFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLS-----FSYLR-YNISGGDENYNAFEWDITGNKICSLGILFVGWCLIIVFMESKHKKTLCIKLKDVKLKPYEIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNM-GFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFD-SSVKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKN 6183
            P++ G+I + P +  T+ I++K+N+T   L  LR  + EW       +N    L+  +     L N   N  V +    +       + K  D     R +++N+I+I  ++  L    +N   C   ++ Q  K+  +++  A+   K   +F  V+F    N S+   Y + N     V+ Y IRM      +T++ +     W P P     ++ + Y   F++LQ++ ++A IEL TG  +  I   +Q +PYPCF+ D F+  +S  +P +L++AW   +   +K +VYEK+ RL E+M +MG+ +  H+ +W I ++  L+  ++ + +ILK+  I+  ++  I+F+    Y  S I  S++ISVFF+N+N+AA++G ++Y I + PF+V +  ++ELS  +   + LL+  +F  A  +I   E+   G Q+ N++ S + D     G    +I  DS  Y LIAWYV  VFPG YG+  PWYF     YW        +   K+N     NI + + N     E +     E EP DL +G+ +  + K +  SK  A+DNLNL FY+  IT  LG NGAGKTTTIS+LTG+   ++GT F+   DI+ D+  +R  +G+C QH++LF+YLT ++H+  YG +K    TK ++  ++   +K+ GL          LSGGMKRKLSI++A +G SR++ LDEP+ GVDP SRR IWD+I K ++  RTIIL+THH+DEA+ L DRIA + QG L+CCGS  +LK+ FGDGY+L L K    +S   + N   ++   +   I+  +P + L ++   +   VL   ST     + SL   LD+ +  L I  YG+SDT++EEVFL +  +  + S    E     ++ ++  +G + P  +SV S      +     D K+    E     L G  L+ ++I  + IKRFHHT+RN KGL +++ILP++ +    GL  +++S ++ P + ISP L                  TS+Q +F  N +  ++   S +         C+NTS     + +CL   +  KW +   PI    V   C CS    Q C       P   +R   SS  +Y+L+   + +YL+     F+ K+YGG  F LP              +  D R                         F+ +G+  N  L+++W + +GY S+PAY N  +N LLR  VN SK     +GI + ++P    Q    + I +   +++ +A+ ++ G S   ASFV +++ E  T +K  Q++SG+    YW++NF +D + Y + V   I     F   ++    N+ A  +LL L+  A    MY  +    ++  AF+     NL  G  + ++    ++L   + +D +L+  ++ LK+IFLIFPQ+  G G+I+LS       +L+ Y +   +E +   +       + S G +F    L+I   ES  KK      K       E I DED DV  ER R+E       D++Q+Y LTK Y              +I+     K+ +AVNNIS G+  GECFGLLGVNGAGKTT FKML G+   + GN +I   +     + +H ++ G+CPQ DAL  L+T EE LYFY R+ GI   DI   V   L+ L L P  ++ T M S G KRK+ TA+ALIG P I+ LDEP+ GMD  ++R LW++I     ++K +VILTSH+MEECE LC RLAIMV+G+ + IGS+QH+KS+FG  + VK+ L  N+ ++    E  T   +  +    +K+++  ++EY    ++  +++IF + E  +T   +  + VSQ +L+EVFINFAK+
Sbjct:  485 PMLLGRILYAPYNPVTKAIMEKSNVTLRQLAELREKSQEWMDKSPLFMNSFHLLNQAI---PMLQNTLRNPFVQVFVKFSVGLDAVELLKQIDELDILRLKLENNIDIIDQLNTLSSLTVNISSCVLYDRIQAAKTIDEMEREAKRLYKSNELFGSVIFKLPSNRSWHRGYDSGNVFLPPVIKYTIRMSLKTAQTTRSLRT--KIWAPGPHNSPSHN-QIYGRAFIYLQDSIERAIIELQTGRNSQEIAVQVQAIPYPCFMKDNFLTSVSYSLPIVLMVAWVVFIAAFVKKLVYEKDLRLHEYMKMMGVNSCSHFFAWLIESVGFLLVTIVILIIILKFGNILPKTNGFILFLYFSDYSFSVIAMSYLISVFFNNTNIAALIGSLIYIIAFFPFIVLVTVENELSYVLKVFMSLLSPTAFSYASQYIARYEEQGIGLQWENMYTSPVQDDTTSFGWLCCLILADSFIYFLIAWYVRNVFPGTYGMAAPWYFPILPSYWKERFGCAEVKPEKSNGLMFTNIMMQNTNPSASPEYMFSSNIEPEPKDLTVGVALHGVTKIY-GSKV-AVDNLNLNFYEGHITSLLGPNGAGKTTTISMLTGLFGASAGTIFVYGKDIKTDLHTVRKNMGVCMQHDVLFSYLTTKEHLLLYGSIKVPHWTKKQLHEEVKRTLKDTGLYSHRHKRVGTLSGGMKRKLSISIALIGGSRVVILDEPSTGVDPCSRRSIWDVISKNKTA-RTIILSTHHLDEAEVLSDRIAFLEQGGLRCCGSPFYLKEAFGDGYHLTLTKK---KSPNLNANAVCDT-MAVTAMIQSHLPEAYLKEDIGGELVYVLPPFSTKVSGAYLSLLRALDNGMGDLNIGCYGISDTTVEEVFLNLTKESQKNSAMSLEHLTQKKIGNSNANGISTPDDLSVSS------SNFTDRDDKILTRGER----LDGFGLLLKKIMAILIKRFHHTRRNWKGLIAQVILPIVFVTTAMGLGTLRNSSNSYPEIQISPSLY----------------GTSEQTAFYANYHPSTEALVSAMWDFPGIDNMCLNTS-----DLQCLNKDSLEKWNTSGEPITNFGV---CSCSEN-VQECPKFNYSPP---HRRTYSSQVIYNLTGQRVENYLISTANEFVQKRYGGWSFGLP--------------LTKDLR-------------------------FDITGVPANRTLAKVWYDPEGYHSLPAYLNSLNNFLLR--VNMSKYDAARHGIIMYSHPYPGVQDQEQATISS--LIDILVALSILMGYSVTTASFVTYVVREHQTKAKQLQHISGIGVTCYWVTNFIYDMVFYLVPVAFSIGIIAIFKLPAFYSENNLGAVSLLLLLFGYATFSWMYLLAGLFHETGMAFITYVCVNLFFGINSIVSLSVVYFLSKEKPNDPTLELISETLKRIFLIFPQFCFGYGLIELSQQQSVLDFLKAYGVEYPNETFEMNKLGAMFVALVSQGTMFFSLRLLI--NESLIKKLRLFFRKFNSSHVRETI-DEDEDVRAERLRVESGAAEF-DLVQLYCLTKTYQ-------------LIH-----KKIIAVNNISIGIPAGECFGLLGVNGAGKTTIFKMLTGDIIPSSGNILIRNKTGSLGHVDSHSSLVGYCPQEDALDDLVTVEEHLYFYARVHGIPEKDIKETVHKLLRRLHLMPFKDRATSMCSYGTKRKLSTALALIGKPSILLLDEPSSGMDPKSKRHLWKIISEEV-QNKCSVILTSHSMEECEALCTRLAIMVNGKFQCIGSLQHIKSRFGRGFTVKVHLKNNKVTM----ETLTKFMQLHFPKTYLKDQHLSMLEYHVPVTAGGVANIFDLLETNKTALNITNFLVSQTTLEEVFINFAKD 2250          

HSP 2 Score: 157.532 bits (397), Expect = 1.934e-37
Identity = 165/675 (24.44%), Postives = 301/675 (44.59%), Query Frame = 1
Query: 1384 GTSMQIMPYPCFVDDRFIKFLSMI---MPFILIIAWTPSVTIIIKSIVYEKENRLKEFMLLMGLTNFVHWCSWFISTIVVLIFPVIFMTLILKYNEIIQFSSPGIIFILILSYVISFICQSFMISVFFDNSNVAAIVGGIVYFIF----YLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTI-----IDLNFGVGHCLIMI-WIDSVFYILIAWYVE------------AVFPGKYGVPKPWYFLFT----------RRYWIPFSKNNDNIEISDNFRQREENIAIDGFEKEPDDLEIGILIE--NLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRY-DMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQITSEMLDTLTD 3294
            G  M   PYP   D       S+I   +   +++ ++ +    +  +V E + + K+   + G+    +W + FI  +V  + PV F              S GII I             F +  F+  +N+ A+   ++ F +    ++  L  +  +  ++   Y  V L   ++   +++ + +L +         L + T+     I   F  G+ LI +    SV   L A+ VE            A+F         ++ L            R ++  F+ ++    I ++   R E + ++    E D +++  L +   L+ K    K  A++N+++     +  G LG NGAGKTT   +LTG + P+SG   I +       ++   S +G CPQ + L   +TVE+H+YFY  + G+ + +IK  +  +++ + L       +   S G KRKLS A+A +G   I+ LDEP++G+DP S+R +W +I +      ++ILT+H M+E + LC R+AI+  GK +C GS   +K  FG G        F ++    +N    E+ TK   F++   P + L D+     +++  H         ++F+ L+++   L I ++ +S T+LEEVF+  A D           Q ++  +D+  D
Sbjct: 1644 GIIMYSHPYPGVQDQEQATISSLIDILVALSILMGYSVTTASFVTYVVREHQTKAKQLQHISGIGVTCYWVTNFIYDMVFYLVPVAF--------------SIGIIAI-------------FKLPAFYSENNLGAVSLLLLLFGYATFSWMYLLAGLFHETGMAFITYVCVNLFFGINSIVSLSVVYFLSKEKPNDPTLELISETLKRIFLIFPQFCFGYGLIELSQQQSVLDFLKAYGVEYPNETFEMNKLGAMFVALVSQGTMFFSLRLLINESLIKKLRLFFRKFNSSHVRETIDEDEDVRAERLRVESGAAEFDLVQLYCLTKTYQLIHK----KIIAVNNISIGIPAGECFGLLGVNGAGKTTIFKMLTGDIIPSSGNILIRNKTGSLGHVDSHSSLVGYCPQEDALDDLVTVEEHLYFYARVHGIPEKDIKETVHKLLRRLHLMPFKDRATSMCSYGTKRKLSTALALIGKPSILLLDEPSSGMDPKSKRHLWKIISEEVQNKCSVILTSHSMEECEALCTRLAIMVNGKFQCIGSLQHIKSRFGRG--------FTVKVHLKNNKVTMETLTK---FMQLHFPKTYLKDQ---HLSMLEYHVPVTAGGVANIFDLLETNKTALNITNFLVSQTTLEEVFINFAKDQKSYETADTSSQGSTISVDSQDD 2273          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Celegans
Match: abt-2 (ABC Transporter family [Source:UniProtKB/TrEMBL;Acc:Q1RS86])

HSP 1 Score: 390.963 bits (1003), Expect = 1.949e-109
Identity = 265/767 (34.55%), Postives = 429/767 (55.93%), Query Frame = 1
Query:  640 TCQEV-YEKYLSVDYFHRQLLEMTAPIIFGKIYFTPDSEFTRQIIKKANITFEILDNLR-------LSAVEW--RLNFRD-WLSNQVNNSSTLDNMSNNAKVCMETSQNYYTVCQLIYKSSDR----NRIQNSIEIASRIFDLIERGLNCTELNKFQPMKSKVDIDNLAQNKL--INIFAGVVFNESFQYLTLNNATVLNYQIRMPTNRIDSTKNFKVLDTFWNPIPRRDTIYDLKYYTSGFLFLQEAFDQAFIELVTGNVTINIGTSMQIMPYPCFVDDRFIKFLSMIMPFILIIAWTPSVTIIIKSIVYEKENRLKEFMLLMGLTNFVHWCSWFISTIVVLIFPVIFMTLILKYNEIIQFSSPGIIFILILSYVISFICQSFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLL---TQVSFCNAINFIGYLEQ--ASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENIA-IDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQ 2871
            TC  V + + ++       +L      + G I  TPD+  TR+++ + NI    +++LR         A+E+  RL+  D W ++Q         +  N +  + T   ++ +  L   SSD        +N  EIA++          C  L++F+ +  + +++  A   +     F G+VFN        +  T   Y+IR     +DST +F  +D+  NP  R   + DLKY T GF FLQE+ D+A +  +T     N+G   Q  PYPC V D F   +++ MP  L+I++     +++K+IVYEKE ++KE M  MGL + VH+ SW + ++V+    V+ +++I K  +I  ++   ++  +++ ++ S I  S   S  F N+N+A     +++F+F++PF +     D +S+  +  + L+   T +  C  +     LE   A + A +S+L+      L   V  C+IM+ +D+  ++++AWY+ AV PG +GV +P +F FT +YW P    N  +E  D+  +  + I   D F+ EP +L + + I ++ K + ++ T ALD LNL+ Y+ QITG LGHNGAGKTTT+SIL G+  P+SGTA I   DIR D+  +R  +G+CPQHN+LF++LTV + +  +  LKG+  SE+  Q+ +I+  V L++K   ++  LSGGMKR+L I +AF+G SR + LDEPTAGVD  +R+ IW L+ + +   RTI+L+THHMDEAD L DRIAI+SQ
Sbjct:  358 TCTPVPHHQDMNCSSLESPILMKVREALSGYILVTPDNPVTRRVVDRLNIPLRDIEHLRNLLYTYPSDALEFQDRLHASDLWPASQ--KLLHFIKVYKNGQNQLNTRTIHFFLEHLFAPSSDEYSFGTYTKNITEIANKY-------TGCFLLDRFRFVTDEKELETNAVCLMDTHQYFTGIVFNIDSNATEFDGFTT--YKIRHYPEMVDSTTSF--MDSKSNPFSRDKPLIDLKYITFGFSFLQESIDRAIMSELTNQTDANLGVYAQQEPYPCTVKDTF--NVALFMPLFLLISFIFPSALLVKNIVYEKEQKIKEQMRAMGLGDAVHFISWGLISLVLNFISVLIISIISKVAKIFDYTDYTLLLFVLILFLFSSIAMSIFFSTLFTNANIATAATCVLWFVFFIPFQLLRT--DRISSPTFNRISLILPPTAMGHCFKL-----LESFNAMERATWSDLWEMNNPVLGISVELCMIMLVVDTAVFLILAWYISAVAPGDFGVRQPLWFPFTLKYWAPGLYKN-RVEFVDD--EHFDTIPNSDSFDSEPTNLTLAVHINSMSKVY-ENGTKALDCLNLRLYEGQITGLLGHNGAGKTTTMSILCGLYAPSSGTAKIYQRDIRTDLRRVRDVLGICPQHNVLFSHLTVSEQLRLFAALKGVPDSELTSQVDEILASVSLTEKANKLASTLSGGMKRRLCIGIAFIGGSRFVILDEPTAGVDVTARKDIWKLLQRNKE-GRTILLSTHHMDEADVLSDRIAILSQ 1097          

HSP 2 Score: 335.88 bits (860), Expect = 1.859e-92
Identity = 224/711 (31.50%), Postives = 368/711 (51.76%), Query Frame = 1
Query: 4198 RIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQS-----DLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIG-SKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFSYLRYNISGGDENY----------------NAFEWDITGNKICSL--GILFVGWCLIIVFMES-----KHKKTLCIKLKDVKLKPYEIITDEDLDVFKERERIEL----NHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLI-----GEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFD-SSVKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKNDSVTRNISNG 6213
            ++W N+K +   P  +NI SN LLR    A    ++ GI   N+P+  T S     +   F  A     +++ + V   LS IPA F ++L+E+R+  +   Q V G+    YW++++ +D + Y++ +++++L +L F    +        AF++L F++ ++ I + Y F    S ++ +FV+I+  +  VG +  +T   L+     D SL  A+     +FL+ PQY+LG   I +    + Y +     N+                +   +D  G  I  L   ++    CLI   M+      K ++ L      + L+  E  T +D DV KER+R++     + D  N  L V  L K YNP +                     LAV  ISF V+ GECFGLLG+NGAGKTTTF ML      G  +I + N  IN  S  D  ++  + +G+CPQFDAL+  L+  E L FY RIRGI P+ I   +D  L  L L P+ N  T  +SGGN+RK+  A+AL+  P ++FLDEP+ GMD G+++FLW++I+ L    K AV+LTSH+MEECE LC R+AIM  G ++ +G  QHLKSK+G    + +++  + N+     EI  I+  ++   +R++  +   I    +  +  ++ +  +   ++    V +++++Q +LD VF + A++D+++    +G
Sbjct: 1420 KVWFNNKIWPGFPIASNILSNALLRQEDYAIDP-EDLGILTMNHPMNKTISQTLDQNALKFTQALAVFRITILLLV---LSMIPAGFTVYLVEDRICEALHLQLVGGLRKVTYWVTSYLYDMVVYTLVIIVIMLIYLCFRVSDFTADGATFFAFLLLFFVHGMSTILYAYVFQKAFSVAALSFVLIAIGSYFVGIVCALTVIMLESLMVQDPSLIPAHTVCSIVFLVLPQYNLG---IAIFRGLMIYQVRAIGSNFLQQMNRPDMINQLPLPSLLAFDQMGIHIMCLFIHVIIATICLIFSQMDEFGFVRKRERNLT---DAMMLR--EPSTCDDEDVVKERQRVDAIPMDSSD--NHALIVRNLAKAYNPEL---------------------LAVKGISFAVEPGECFGLLGLNGAGKTTTFAMLTAKIRPGHGSIEMQNTRINTGSFSD--VRNFQQLGYCPQFDALNMKLSTRENLKFYARIRGIVPTQIDSIIDRLLIALHLRPYANTQTSSLSGGNRRKLSVAVALVSQPSLIFLDEPSAGMDPGSQQFLWKVIERLCKSGK-AVVLTSHSMEECEALCTRIAIMDRGRIRCLGGKQHLKSKYGKGSMLTMKMGKDENA----KEIAGIMRSKLGDGSRVEAIHCSTIFIHIEQGTASVARVLEIVNQVKKMYDVDDFTLTQSTLDNVFQSIAESDNLSEEGHHG 2088          

HSP 3 Score: 138.272 bits (347), Expect = 4.541e-32
Identity = 74/191 (38.74%), Postives = 113/191 (59.16%), Query Frame = 1
Query: 5284 AVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIM 5856
            A++ ++  + EG+  GLLG NGAGKTTT  +L G    + G A I    I  D  +    +G CPQ + L S LT  E+L  +  ++G+  S++   VD  L ++SLT   NK    +SGG KR++   IA IG  + V LDEPT G+D  AR+ +W+L+Q   N+    ++L++H+M+E +VL  R+AI+
Sbjct:  907 ALDCLNLRLYEGQITGLLGHNGAGKTTTMSILCGLYAPSSGTAKIYQRDIRTDLRRVRDVLGICPQHNVLFSHLTVSEQLRLFAALKGVPDSELTSQVDEILASVSLTEKANKLASTLSGGMKRRLCIGIAFIGGSRFVILDEPTAGVDVTARKDIWKLLQ--RNKEGRTILLSTHHMDEADVLSDRIAIL 1095          

HSP 4 Score: 133.65 bits (335), Expect = 1.192e-30
Identity = 80/258 (31.01%), Postives = 143/258 (55.43%), Query Frame = 1
Query: 2182 RQREENIAIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRY-DMEIIRS--KIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLE 2946
            RQR + I +D  +         +++ NL K +   +  A+  ++      +  G LG NGAGKTTT ++LT  + P  G+  + +  I       +R+  ++G CPQ + L   L+  +++ FY  ++G+  ++I   +  ++  + L       + +LSGG +RKLS+A+A V    +IFLDEP+AG+DP S++ +W +I +     + ++LT+H M+E + LC RIAI+ +G+++C G    LK  +G G  L ++
Sbjct: 1749 RQRVDAIPMDSSDNH------ALIVRNLAKAY-NPELLAVKGISFAVEPGECFGLLGLNGAGKTTTFAMLTAKIRPGHGSIEMQNTRINTGSFSDVRNFQQLGYCPQFDALNMKLSTRENLKFYARIRGIVPTQIDSIIDRLLIALHLRPYANTQTSSLSGGNRRKLSVAVALVSQPSLIFLDEPSAGMDPGSQQFLWKVIERLCKSGKAVVLTSHSMEECEALCTRIAIMDRGRIRCLGGKQHLKSKYGKGSMLTMK 1999          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Celegans
Match: abt-2 (ABC Transporter family [Source:UniProtKB/TrEMBL;Acc:Q1RS86])

HSP 1 Score: 390.963 bits (1003), Expect = 2.188e-109
Identity = 265/767 (34.55%), Postives = 429/767 (55.93%), Query Frame = 1
Query:  640 TCQEV-YEKYLSVDYFHRQLLEMTAPIIFGKIYFTPDSEFTRQIIKKANITFEILDNLR-------LSAVEW--RLNFRD-WLSNQVNNSSTLDNMSNNAKVCMETSQNYYTVCQLIYKSSDR----NRIQNSIEIASRIFDLIERGLNCTELNKFQPMKSKVDIDNLAQNKL--INIFAGVVFNESFQYLTLNNATVLNYQIRMPTNRIDSTKNFKVLDTFWNPIPRRDTIYDLKYYTSGFLFLQEAFDQAFIELVTGNVTINIGTSMQIMPYPCFVDDRFIKFLSMIMPFILIIAWTPSVTIIIKSIVYEKENRLKEFMLLMGLTNFVHWCSWFISTIVVLIFPVIFMTLILKYNEIIQFSSPGIIFILILSYVISFICQSFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLL---TQVSFCNAINFIGYLEQ--ASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENIA-IDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQ 2871
            TC  V + + ++       +L      + G I  TPD+  TR+++ + NI    +++LR         A+E+  RL+  D W ++Q         +  N +  + T   ++ +  L   SSD        +N  EIA++          C  L++F+ +  + +++  A   +     F G+VFN        +  T   Y+IR     +DST +F  +D+  NP  R   + DLKY T GF FLQE+ D+A +  +T     N+G   Q  PYPC V D F   +++ MP  L+I++     +++K+IVYEKE ++KE M  MGL + VH+ SW + ++V+    V+ +++I K  +I  ++   ++  +++ ++ S I  S   S  F N+N+A     +++F+F++PF +     D +S+  +  + L+   T +  C  +     LE   A + A +S+L+      L   V  C+IM+ +D+  ++++AWY+ AV PG +GV +P +F FT +YW P    N  +E  D+  +  + I   D F+ EP +L + + I ++ K + ++ T ALD LNL+ Y+ QITG LGHNGAGKTTT+SIL G+  P+SGTA I   DIR D+  +R  +G+CPQHN+LF++LTV + +  +  LKG+  SE+  Q+ +I+  V L++K   ++  LSGGMKR+L I +AF+G SR + LDEPTAGVD  +R+ IW L+ + +   RTI+L+THHMDEAD L DRIAI+SQ
Sbjct:  395 TCTPVPHHQDMNCSSLESPILMKVREALSGYILVTPDNPVTRRVVDRLNIPLRDIEHLRNLLYTYPSDALEFQDRLHASDLWPASQ--KLLHFIKVYKNGQNQLNTRTIHFFLEHLFAPSSDEYSFGTYTKNITEIANKY-------TGCFLLDRFRFVTDEKELETNAVCLMDTHQYFTGIVFNIDSNATEFDGFTT--YKIRHYPEMVDSTTSF--MDSKSNPFSRDKPLIDLKYITFGFSFLQESIDRAIMSELTNQTDANLGVYAQQEPYPCTVKDTF--NVALFMPLFLLISFIFPSALLVKNIVYEKEQKIKEQMRAMGLGDAVHFISWGLISLVLNFISVLIISIISKVAKIFDYTDYTLLLFVLILFLFSSIAMSIFFSTLFTNANIATAATCVLWFVFFIPFQLLRT--DRISSPTFNRISLILPPTAMGHCFKL-----LESFNAMERATWSDLWEMNNPVLGISVELCMIMLVVDTAVFLILAWYISAVAPGDFGVRQPLWFPFTLKYWAPGLYKN-RVEFVDD--EHFDTIPNSDSFDSEPTNLTLAVHINSMSKVY-ENGTKALDCLNLRLYEGQITGLLGHNGAGKTTTMSILCGLYAPSSGTAKIYQRDIRTDLRRVRDVLGICPQHNVLFSHLTVSEQLRLFAALKGVPDSELTSQVDEILASVSLTEKANKLASTLSGGMKRRLCIGIAFIGGSRFVILDEPTAGVDVTARKDIWKLLQRNKE-GRTILLSTHHMDEADVLSDRIAILSQ 1134          

HSP 2 Score: 335.88 bits (860), Expect = 2.309e-92
Identity = 224/711 (31.50%), Postives = 368/711 (51.76%), Query Frame = 1
Query: 4198 RIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQS-----DLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIG-SKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFSYLRYNISGGDENY----------------NAFEWDITGNKICSL--GILFVGWCLIIVFMES-----KHKKTLCIKLKDVKLKPYEIITDEDLDVFKERERIEL----NHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLI-----GEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFD-SSVKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKNDSVTRNISNG 6213
            ++W N+K +   P  +NI SN LLR    A    ++ GI   N+P+  T S     +   F  A     +++ + V   LS IPA F ++L+E+R+  +   Q V G+    YW++++ +D + Y++ +++++L +L F    +        AF++L F++ ++ I + Y F    S ++ +FV+I+  +  VG +  +T   L+     D SL  A+     +FL+ PQY+LG   I +    + Y +     N+                +   +D  G  I  L   ++    CLI   M+      K ++ L      + L+  E  T +D DV KER+R++     + D  N  L V  L K YNP +                     LAV  ISF V+ GECFGLLG+NGAGKTTTF ML      G  +I + N  IN  S  D  ++  + +G+CPQFDAL+  L+  E L FY RIRGI P+ I   +D  L  L L P+ N  T  +SGGN+RK+  A+AL+  P ++FLDEP+ GMD G+++FLW++I+ L    K AV+LTSH+MEECE LC R+AIM  G ++ +G  QHLKSK+G    + +++  + N+     EI  I+  ++   +R++  +   I    +  +  ++ +  +   ++    V +++++Q +LD VF + A++D+++    +G
Sbjct: 1457 KVWFNNKIWPGFPIASNILSNALLRQEDYAIDP-EDLGILTMNHPMNKTISQTLDQNALKFTQALAVFRITILLLV---LSMIPAGFTVYLVEDRICEALHLQLVGGLRKVTYWVTSYLYDMVVYTLVIIVIMLIYLCFRVSDFTADGATFFAFLLLFFVHGMSTILYAYVFQKAFSVAALSFVLIAIGSYFVGIVCALTVIMLESLMVQDPSLIPAHTVCSIVFLVLPQYNLG---IAIFRGLMIYQVRAIGSNFLQQMNRPDMINQLPLPSLLAFDQMGIHIMCLFIHVIIATICLIFSQMDEFGFVRKRERNLT---DAMMLR--EPSTCDDEDVVKERQRVDAIPMDSSD--NHALIVRNLAKAYNPEL---------------------LAVKGISFAVEPGECFGLLGLNGAGKTTTFAMLTAKIRPGHGSIEMQNTRINTGSFSD--VRNFQQLGYCPQFDALNMKLSTRENLKFYARIRGIVPTQIDSIIDRLLIALHLRPYANTQTSSLSGGNRRKLSVAVALVSQPSLIFLDEPSAGMDPGSQQFLWKVIERLCKSGK-AVVLTSHSMEECEALCTRIAIMDRGRIRCLGGKQHLKSKYGKGSMLTMKMGKDENA----KEIAGIMRSKLGDGSRVEAIHCSTIFIHIEQGTASVARVLEIVNQVKKMYDVDDFTLTQSTLDNVFQSIAESDNLSEEGHHG 2125          

HSP 3 Score: 138.272 bits (347), Expect = 4.976e-32
Identity = 74/191 (38.74%), Postives = 113/191 (59.16%), Query Frame = 1
Query: 5284 AVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIM 5856
            A++ ++  + EG+  GLLG NGAGKTTT  +L G    + G A I    I  D  +    +G CPQ + L S LT  E+L  +  ++G+  S++   VD  L ++SLT   NK    +SGG KR++   IA IG  + V LDEPT G+D  AR+ +W+L+Q   N+    ++L++H+M+E +VL  R+AI+
Sbjct:  944 ALDCLNLRLYEGQITGLLGHNGAGKTTTMSILCGLYAPSSGTAKIYQRDIRTDLRRVRDVLGICPQHNVLFSHLTVSEQLRLFAALKGVPDSELTSQVDEILASVSLTEKANKLASTLSGGMKRRLCIGIAFIGGSRFVILDEPTAGVDVTARKDIWKLLQ--RNKEGRTILLSTHHMDEADVLSDRIAIL 1132          

HSP 4 Score: 133.265 bits (334), Expect = 1.328e-30
Identity = 80/258 (31.01%), Postives = 143/258 (55.43%), Query Frame = 1
Query: 2182 RQREENIAIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRY-DMEIIRS--KIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLE 2946
            RQR + I +D  +         +++ NL K +   +  A+  ++      +  G LG NGAGKTTT ++LT  + P  G+  + +  I       +R+  ++G CPQ + L   L+  +++ FY  ++G+  ++I   +  ++  + L       + +LSGG +RKLS+A+A V    +IFLDEP+AG+DP S++ +W +I +     + ++LT+H M+E + LC RIAI+ +G+++C G    LK  +G G  L ++
Sbjct: 1786 RQRVDAIPMDSSDNH------ALIVRNLAKAY-NPELLAVKGISFAVEPGECFGLLGLNGAGKTTTFAMLTAKIRPGHGSIEMQNTRINTGSFSDVRNFQQLGYCPQFDALNMKLSTRENLKFYARIRGIVPTQIDSIIDRLLIALHLRPYANTQTSSLSGGNRRKLSVAVALVSQPSLIFLDEPSAGMDPGSQQFLWKVIERLCKSGKAVVLTSHSMEECEALCTRIAIMDRGRIRCLGGKQHLKSKYGKGSMLTMK 2036          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Celegans
Match: abt-4 (ABC Transporter family [Source:UniProtKB/TrEMBL;Acc:Q9TXV8])

HSP 1 Score: 384.8 bits (987), Expect = 4.630e-108
Identity = 258/759 (33.99%), Postives = 411/759 (54.15%), Query Frame = 1
Query: 1120 IFAGVVFNESF-QYLTLNNATVLNYQIRMPTNRIDSTKNFKVLDTFWN------------PI-PRRDTIYDLKYYTSGFLFLQEAFDQAFIELVTGNVT--INIGTSMQI--MPYPCFVDDRFIKFLSMIMPFILIIAWTPSVTIIIKSIVYEKENRLKEFMLLMGLTNFVHWCSWFISTIVVLIFPVIFMTLILKYNEIIQFSSPGIIFILILSYVISFICQSFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGV--GLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVP-KPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENIAIDGFEKEPDDLEIGILIENLVK-------------KFPKS-KTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKV---ADDPSQISHKRQEKQITSEMLD 3282
            + AG+VF++S  + L   +     Y IR+      S   F      W+            PI P  +      Y+  GF+ +Q A D A  E++TG       +  S Q+   P+P +   + I+  +  MP I+I ++  SV  I++++V EKE+RLKE+M +MGL+ F++W + FI     L F VI +T+++ +  +   S   ++F+ ++ Y    +  +FMIS F +++  A ++  + + + Y  +  F +        + Y +   +   ++    +  +   E  +DG ++  LF     D N   GH LI + +D +  I++ WY+EAV PG  GVP KPW+F+    YW P S  +  ++ SD F+Q +    +   EKEP DL   I + NL K             KF KS +  A+ NLNLK Y  Q T  LGHNGAGK+TT S+LTG+ +P+SG+A++ D DIR  +  IR ++GLCPQ+N LF ++TV +H+ F+  LK  T      +  +I+  + +  K   M+  LSGG KRKLS+A+A +G S ++ LDEPT+G+DP +R   W LI + +   RTI+LTTH M+EAD L DRIAI++ G+L+CCGS +FLKQ +GDGY+L +           ++  ++   +K  + I++ IP + +      + T +LS  +T+R  F  LF++L+       I S+G+S T++EEVFLKV   AD+     H  +     SEM++
Sbjct:  193 LLAGIVFDDSIAKDLKNPDKRDFTYTIRLSNTHRRSRNAFGDNSYPWDTSVSFAVQYVSGPINPDDNDGGSPGYWQEGFMTVQRAVDVAITEIITGEDAQLTPLLDSYQVSRFPFPGY-STKIIEIGAFFMPVIVIFSFMTSVIYIVRAVVVEKEDRLKEYMRVMGLSQFINWVAHFIINYAKLTFAVIVLTILMHF--VALKSDMTLMFVFLMIYAFDVVYFAFMISSFMNSATSATLISVVFWMLLYFWYAFFSSIDQTNPYPLGYRLINCINPDIALNYGLQLLAAYETQADGLKWGELFTPPSPDNNLTFGHALIALIVDGIIMIILTWYIEAVIPGGEGVPQKPWFFVLPS-YWFPNS-GSKTVDSSDQFQQIQYADHVK-LEKEPTDLIPTINVVNLTKTYGTSFFKKLFDCKFGKSGEKRAVSNLNLKMYPGQCTVLLGHNGAGKSTTFSMLTGVASPSSGSAYVNDFDIRTSLPKIRREMGLCPQYNTLFGFMTVMEHLEFFAKLKERTWD--PEEAREILARLRIDFKADFMAGALSGGQKRKLSLAIALIGGSEVVMLDEPTSGMDPGARHETWTLIQREKE-RRTILLTTHFMEEADLLGDRIAIMAHGQLECCGSPMFLKQQYGDGYHLTI----------VYDTTSTPDVSKTTDIIREYIPEAHVFSYIGQEATYLLS--ATHRPIFPKLFKELEDHQTQCGITSFGVSITTMEEVFLKVGHTADERYNYEHGIEND--ISEMIE 928          

HSP 2 Score: 244.202 bits (622), Expect = 2.099e-64
Identity = 126/309 (40.78%), Postives = 196/309 (63.43%), Query Frame = 1
Query: 5284 AVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFDSSVKLSDIFRVFEDLRTNEMV---KEYSVSQMSLDEVFINFAKNDSVTRN 6201
            AV  ++F V   +CFGLLGVNGAGKT+TF+ML GE +I+ G+A +NG+S+ ++  +A  N G+CPQ+DA+   ++ EE LY + RIRGI   DIP  V+  +  + +  + ++     SGGNKR++   IA++G P ++ LDEPT G+D  ARR +W ++  L  +   A++LTSH+M+ECE LC  LAIMV G+ +  GS QH+KS++G  Y + IRL  NRN   D  + ++ I K+ +  + +KEE+  +++  FD         R+FE L T        +YS+SQ +L++VFI F+++  V+ +
Sbjct: 1464 AVKGVNFHVNSKDCFGLLGVNGAGKTSTFQMLTGENSISSGDAYVNGWSVKNNWREAGANTGYCPQYDAIIKEMSGEETLYMFARIRGIPEKDIPKKVNAVIHAIGIGMYASRQIKTYSGGNKRRLSLGIAIVGLPDVLLLDEPTSGVDPKARRIIWNILNRL-RDLGTALVLTSHSMDECEALCTELAIMVYGKFRCYGSCQHIKSRYGSGYTLLIRLK-NRN---DAEKTKSTI-KQTFRGSVIKEEH--VLQLNFDIPRDGDSWSRLFEKLETVSTSLNWDDYSLSQTTLEQVFIEFSRDAGVSSD 1764          

HSP 3 Score: 170.244 bits (430), Expect = 7.172e-42
Identity = 167/658 (25.38%), Postives = 303/658 (46.05%), Query Frame = 1
Query: 4369 YAQMFLEVS---LAIFVIFGLSFIPASFVIFLIEERVTGS--KLQQY--VSGVNPYVYWISNFF--WDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMI-----DLSFSYLRYNISGGDENYNAFEWDITGNKICSLGILFVGWCLI-------IVFMESKHKKTLCIKLKDVKLKPYEII------------TDEDLDVFKERE-----RIELNHDVLNDVLQVYGLTKIYNPSIDFRN--KC-FGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFDSSVK--LSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKNDSVTRNISNG 6213
            Y+   +E+    + + VIF  SF+ +  VI+++   V     +L++Y  V G++ ++ W+++F   +  + +++ VL +++ F+A          ++    V L +Y+  V+   +  S F++ +++A ++   + +L+        F+   +    +S+   N            Y LG  +I     D++ +Y    ++  +   +  +W            L  G  LI       I+ + + + + +    + V  KP+  +            T +  D F++ +     ++E     L   + V  LTK Y  S  F+    C FGK      S +KR  AV+N++  +  G+C  LLG NGAGK+TTF ML G  + + G+A +N + I     K  + MG CPQ++ L   +T  E L F+ +++  + +  P      L  L +    +     +SGG KRK+  AIALIG  ++V LDEPT GMD GAR   W LIQ    + +  ++LT+H MEE ++L  R+AIM  G+++  GS   LK ++G  Y++ I    +  S  D ++   II + I   A +         Y   ++ +     +F+  ED +T   +  + VS  +++EVF+          N  +G
Sbjct:  310 YSTKIIEIGAFFMPVIVIF--SFMTS--VIYIVRAVVVEKEDRLKEYMRVMGLSQFINWVAHFIINYAKLTFAVIVLTILMHFVALK-------SDMTLMFVFLMIYAFDVVYFAFMISSFMNSATSATLISVVFWMLL-------YFWYAFF----SSIDQTN-----------PYPLGYRLINCINPDIALNYGLQLLAAYETQADGLKWGELFTPPSPDNNLTFGHALIALIVDGIIMIILTWYIEAVIPGGEGVPQKPWFFVLPSYWFPNSGSKTVDSSDQFQQIQYADHVKLEKEPTDLIPTINVVNLTKTYGTSF-FKKLFDCKFGK------SGEKR--AVSNLNLKMYPGQCTVLLGHNGAGKSTTFSMLTGVASPSSGSAYVNDFDIRTSLPKIRREMGLCPQYNTLFGFMTVMEHLEFFAKLK--ERTWDPEEAREILARLRIDFKADFMAGALSGGQKRKLSLAIALIGGSEVVMLDEPTSGMDPGARHETWTLIQ--REKERRTILLTTHFMEEADLLGDRIAIMAHGQLECCGSPMFLKQQYGDGYHLTIVY--DTTSTPDVSKTTDIIREYI-PEAHVFSYIGQEATYLLSATHRPIFPKLFKELEDHQTQCGITSFGVSITTMEEVFLKVGHTADERYNYEHG 918          

HSP 4 Score: 155.992 bits (393), Expect = 1.875e-37
Identity = 93/310 (30.00%), Postives = 166/310 (53.55%), Query Frame = 1
Query: 2296 ALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADD 3225
            A+  +N         G LG NGAGKT+T  +LTG  + +SG A++    ++ +     +  G CPQ++ +   ++ E+ +Y +  ++G+ + +I  ++  ++  +G+        K  SGG KR+LS+ +A VG   ++ LDEPT+GVDP +RR IW+++ + R +   ++LT+H MDE + LC  +AI+  GK +C GS   +K  +G GY L +           + N A ++ +     IK+    S + +E   Q    +  +    + ++ LFE+L++    L    Y LS T+LE+VF++ + D
Sbjct: 1464 AVKGVNFHVNSKDCFGLLGVNGAGKTSTFQMLTGENSISSGDAYVNGWSVKNNWREAGANTGYCPQYDAIIKEMSGEETLYMFARIRGIPEKDIPKKVNAVIHAIGIGMYASRQIKTYSGGNKRRLSLGIAIVGLPDVLLLDEPTSGVDPKARRIIWNILNRLRDLGTALVLTSHSMDECEALCTELAIMVYGKFRCYGSCQHIKSRYGSGYTLLIRLK--------NRNDAEKTKST----IKQTFRGSVIKEEHVLQLNFDIPRDG---DSWSRLFEKLETVSTSLNWDDYSLSQTTLEQVFIEFSRD 1758          

HSP 5 Score: 82.4185 bits (202), Expect = 4.089e-15
Identity = 56/213 (26.29%), Postives = 96/213 (45.07%), Query Frame = 1
Query: 4144 LNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLF-LYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTIT 4779
            L +    FN S +     + + N+ G +  PA A  F++    S + + K  + Y     N+PL  +  D              +A  +I   +   A +  FLI ER   SK  Q +SG+ P+++W++ F WDA  + I +L     F  FN  +Y     ++  + L F LY    +P  Y F FF   +   F++++ Y++L G + +I 
Sbjct: 1080 LGFVPSMFNFSTVSVPSLKTFFNNFG-LYTPALAITFTD----SMILSQKQKKQYSFTAVNHPLPPSTQDTLKNTNRSDGAAFLIAYGLIVSFAVCVAGYSQFLITERKKKSKHMQLLSGIRPWMFWLTAFIWDAAWFVIRILCFDAIFYIFNITAYTHDFGVMLILTLSFLLYGWTALPFTYWFQFFFESAPKGFMMVTMYHILTGMIGSIA 1287          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Celegans
Match: ced-7 (ABC transporter ced-7 [Source:UniProtKB/Swiss-Prot;Acc:P34358])

HSP 1 Score: 251.906 bits (642), Expect = 9.049e-67
Identity = 220/762 (28.87%), Postives = 370/762 (48.56%), Query Frame = 1
Query: 1126 AGVVFNESFQYLTLNNATVLNYQIRMPTNRIDSTKNFKVLDTFWNPIPRRDTIYDL-----KYYTSGFLFLQEAFDQAFIELVTGNVTINIGTSMQIMPYPCFVDDR---FIKFLSMIMPFILIIAWTPSVTIIIKSIVYEKENRLKEFMLLMGLTNFVHWCSWFISTIVVLIFPVIFMTLILKYNEIIQFSSPGIIFILILSYVISFICQSFMISVFFDNSNVA--AIV---GGIVYFIFYL-PFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISD-----NFRQREENIAIDGFEKEP-------------------DDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFL--------EKSFEIQSETC-HNNKASESGTKLLEFIKKIIPNSKLIDETKT-QWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQIT 3267
            AGVVF+E    + + N   LNY+I +        + + + +T +NP       Y        Y+TS FL  Q A + +F+  V      ++  +++ +P P +       FI F   I  F+  I    +V  I + I  E  + +K ++  MGL+ F+ + +  +  +  L F VIF+  I+    +++F SP  + + +L Y +  +     ++ FF+N+N A  AI+   G ++   + L P L      D++S+   YG+ +    +F  A+  I    +       +N+FN +   L+F +G  L+M+ +D ++  + A  V+ +              F+ R    F    D+   +D     N R  E+   +      P                   D     I++ NLVK +  +   A+D L+L+  + Q +  LGHNGAGK+TT S + GI+ PT+G   I   D+  +    R  IG+CPQ+N L+  LTV +H+     LKG  + + K  +  ++ +V L  K    + NLSGGMKRKL + MA +G+S ++ LDEPTAG+DP +R+ +  L+ + ++ NRTI+LTTH+MDEA+ L D + I+S GKL   G++ +LKQ FG GY L +         K   I ++ C H  K +E G    + I+ I+P ++  +     Q    +   +   N F ++   L S L  L++ S+GLS  +LE+VF+ + D   +    RQ  +I+
Sbjct:  223 AGVVFDE----VDVTNKK-LNYRILLGKT---PEETWHLTETSYNPYGPSSGRYSRIPSSPPYWTSAFLTFQHAIESSFLSSVQSGAP-DLPITLRGLPEPRYKTSSVSAFIDFFPFIWAFVTFI----NVIHITREIAAEN-HAVKPYLTAMGLSTFMFYAAHVV--MAFLKFFVIFLCSIIPLTFVMEFVSPAALIVTVLMYGLGAVIFGAFVASFFNNTNSAIKAILVAWGAMIGISYKLRPEL------DQISSCFLYGLNI--NGAFALAVEAISDYMRRERELNLTNMFNDS--SLHFSLGWALVMMIVDILWMSIGALVVDHIRTSAD---------FSLRTLFDFEAPEDDENQTDGVTAQNTRINEQMNPMASTSLNPPNADSDSLLEGSTEADGARDTARADIIVRNLVKIWSTTGERAVDGLSLRAVRGQCSILLGHNGAGKSTTFSSIAGIIRPTNGRITICGYDVGNEPGETRRHIGMCPQYNPLYDQLTVSEHLKLVYGLKGAREKDFKQDMKRLLSDVKLDFKENEKAVNLSGGMKRKLCVCMALIGDSEVVLLDEPTAGMDPGARQDVQKLVEREKA-NRTILLTTHYMDEAERLGDWVFIMSHGKLVASGTNQYLKQKFGTGYLLTVVLDHNGDKRKMAVILTDVCTHYVKEAERGEMHGQQIEIILPEARKKEFVPLFQALEAIQDRNYRSNVFDNMPNTLKSQLATLEMRSFGLSLNTLEQVFITIGDKVDKAIASRQNSRIS 948          

HSP 2 Score: 250.751 bits (639), Expect = 2.029e-66
Identity = 191/674 (28.34%), Postives = 324/674 (48.07%), Query Frame = 1
Query: 4210 NSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLL-FLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFL-IFPQYDLGRGMIDLSFSYLRYNISGGDENYNAFEWDITGNKICSLGILFVGWCLIIVFMESKHKKTLCIKLKDVKLKPYEIITDEDLD------VFKERERIELNHDV--LNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLH-PNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFDSSVKLSDI----FRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKND 6186
            N + Y  +P   ++ +   L  TV+A          +++    Y++S   S +     ++V LA  +I   + + ++FV+FLIEER      QQ+++G++P  ++ ++  +D I YS+  LI +  FLAF++       + LA ++L  FLY  + +P +Y  SF     S A V++  + +++ G   +  F + +    D  LKS    L  IF+ + P Y  G  +I ++   +   I   +E  N   WD  G     +G   V    + V ++ K  +    ++  V+   +  +     D      V +ERER+   H V   N  L +  LTK +                       R  AVN +   V + ECFGLLGVNGAGKTTTF +L G+   + G A+I G  + +       ++G+CPQFDAL   LT  E L    ++ G +  +     +L L+ + +  H +K     SGG KRK+   +AL+   +++ LDEPT G+D  ARR +W L+         A++LTSH+M+ECE LC R+A++  G +  IGS Q LKS +G++Y + + L+ PN+     R+ +  ++   + +S          +  ++    +  D     F + + L  +  VK++ ++Q SL+E F+  A  D
Sbjct: 1127 NMRYYHVLPTLISMINRARLTGTVDAE---------ISSGVFLYSKSTSNSNLLPSQLIDVLLAPMLILIFAMVTSTFVMFLIEERTCQFAHQQFLTGISPITFYSASLIYDGILYSLICLIFLFMFLAFHWM-----YDHLAIVILFWFLYFFSSVPFIYAVSFLFQSPSKANVLLIIWQVVISGAALLAVFLIFMIFNIDEWLKSI---LVNIFMFLLPSYAFGSAIITINTYGM---ILPSEELMN---WDHCGKNAWLMGTFGVCSFALFVLLQFKFVRRFLSQVWTVRRSSHNNVQPMMGDLPVCESVSEERERV---HRVNSQNSALVIKDLTKTFG----------------------RFTAVNELCLAVDQKECFGLLGVNGAGKTTTFNILTGQSFASSGEAMIGGRDVTELI-----SIGYCPQFDALMLDLTGRESLEILAQMHGFE--NYKAKAELILECVGMIAHADKLVRFYSGGQKRKISVGVALLAPTQMIILDEPTAGIDPKARREVWELLLWCREHSNSALMLTSHSMDECEALCSRIAVLNRGSLIAIGSSQELKSLYGNNYTMTLSLYEPNQ-----RDMVVQLVQTRLPNSVLKTTSTNKTLNLKWQIPKEKEDCWSAKFEMVQALAKDLGVKDFILAQSSLEETFLRLAGLD 1740          

HSP 3 Score: 143.665 bits (361), Expect = 9.751e-34
Identity = 108/328 (32.93%), Postives = 177/328 (53.96%), Query Frame = 1
Query: 2245 GILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRS-INRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQ--FTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVA 3219
             ++I++L K F   +  A++ L L   Q +  G LG NGAGKTTT +ILTG    +SG A I   D+    E+I   IG CPQ + L   LT  + +     + G    + K +L  I++ VG+      + +  SGG KRK+S+ +A +  +++I LDEPTAG+DP +RR +W+L++  R   N  ++LT+H MDE + LC RIA++++G L   GSS  LK  +G+ Y + L      Q +             +++ ++  +PNS ++  T T  T+ L        +  +++ FE + +    L +  + L+ +SLEE FL++A
Sbjct: 1432 ALVIKDLTKTF--GRFTAVNELCLAVDQKECFGLLGVNGAGKTTTFNILTGQSFASSGEAMIGGRDV---TELI--SIGYCPQFDALMLDLTGRESLEILAQMHGFENYKAKAEL--ILECVGMIAHADKLVRFYSGGQKRKISVGVALLAPTQMIILDEPTAGIDPKARREVWELLLWCREHSNSALMLTSHSMDECEALCSRIAVLNRGSLIAIGSSQELKSLYGNNYTMTLSLYEPNQRDM------------VVQLVQTRLPNS-VLKTTSTNKTLNLKWQIPKEKEDCWSAKFEMVQALAKDLGVKDFILAQSSLEETFLRLA 1737          

HSP 4 Score: 142.124 bits (357), Expect = 2.508e-33
Identity = 81/237 (34.18%), Postives = 130/237 (54.85%), Query Frame = 1
Query: 5284 AVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIIN 5994
            AV+ +S     G+C  LLG NGAGK+TTF  + G    T G   I GY + ++  +  +++G CPQ++ L+  LT  E L     ++G +  D   ++   L ++ L    N+    +SGG KRK+   +ALIG  ++V LDEPT GMD GAR+ + +L++    +    ++LT+H M+E E L   + IM  G++   G+ Q+LK KFG  Y + + L  N     D+ ++  I+ 
Sbjct:  616 AVDGLSLRAVRGQCSILLGHNGAGKSTTFSSIAGIIRPTNGRITICGYDVGNEPGETRRHIGMCPQYNPLYDQLTVSEHLKLVYGLKGAREKDFKQDMKRLLSDVKLDFKENEKAVNLSGGMKRKLCVCMALIGDSEVVLLDEPTAGMDPGARQDVQKLVE--REKANRTILLTTHYMDEAERLGDWVFIMSHGKLVASGTNQYLKQKFGTGYLLTVVLDHN----GDKRKMAVILT 846          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Celegans
Match: ced-7 (ABC transporter ced-7 [Source:UniProtKB/Swiss-Prot;Acc:P34358])

HSP 1 Score: 251.521 bits (641), Expect = 1.153e-66
Identity = 220/762 (28.87%), Postives = 370/762 (48.56%), Query Frame = 1
Query: 1126 AGVVFNESFQYLTLNNATVLNYQIRMPTNRIDSTKNFKVLDTFWNPIPRRDTIYDL-----KYYTSGFLFLQEAFDQAFIELVTGNVTINIGTSMQIMPYPCFVDDR---FIKFLSMIMPFILIIAWTPSVTIIIKSIVYEKENRLKEFMLLMGLTNFVHWCSWFISTIVVLIFPVIFMTLILKYNEIIQFSSPGIIFILILSYVISFICQSFMISVFFDNSNVA--AIV---GGIVYFIFYL-PFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISD-----NFRQREENIAIDGFEKEP-------------------DDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFL--------EKSFEIQSETC-HNNKASESGTKLLEFIKKIIPNSKLIDETKT-QWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQIT 3267
            AGVVF+E    + + N   LNY+I +        + + + +T +NP       Y        Y+TS FL  Q A + +F+  V      ++  +++ +P P +       FI F   I  F+  I    +V  I + I  E  + +K ++  MGL+ F+ + +  +  +  L F VIF+  I+    +++F SP  + + +L Y +  +     ++ FF+N+N A  AI+   G ++   + L P L      D++S+   YG+ +    +F  A+  I    +       +N+FN +   L+F +G  L+M+ +D ++  + A  V+ +              F+ R    F    D+   +D     N R  E+   +      P                   D     I++ NLVK +  +   A+D L+L+  + Q +  LGHNGAGK+TT S + GI+ PT+G   I   D+  +    R  IG+CPQ+N L+  LTV +H+     LKG  + + K  +  ++ +V L  K    + NLSGGMKRKL + MA +G+S ++ LDEPTAG+DP +R+ +  L+ + ++ NRTI+LTTH+MDEA+ L D + I+S GKL   G++ +LKQ FG GY L +         K   I ++ C H  K +E G    + I+ I+P ++  +     Q    +   +   N F ++   L S L  L++ S+GLS  +LE+VF+ + D   +    RQ  +I+
Sbjct:  156 AGVVFDE----VDVTNKK-LNYRILLGKT---PEETWHLTETSYNPYGPSSGRYSRIPSSPPYWTSAFLTFQHAIESSFLSSVQSGAP-DLPITLRGLPEPRYKTSSVSAFIDFFPFIWAFVTFI----NVIHITREIAAEN-HAVKPYLTAMGLSTFMFYAAHVV--MAFLKFFVIFLCSIIPLTFVMEFVSPAALIVTVLMYGLGAVIFGAFVASFFNNTNSAIKAILVAWGAMIGISYKLRPEL------DQISSCFLYGLNI--NGAFALAVEAISDYMRRERELNLTNMFNDS--SLHFSLGWALVMMIVDILWMSIGALVVDHIRTSAD---------FSLRTLFDFEAPEDDENQTDGVTAQNTRINEQMNPMASTSLNPPNADSDSLLEGSTEADGARDTARADIIVRNLVKIWSTTGERAVDGLSLRAVRGQCSILLGHNGAGKSTTFSSIAGIIRPTNGRITICGYDVGNEPGETRRHIGMCPQYNPLYDQLTVSEHLKLVYGLKGAREKDFKQDMKRLLSDVKLDFKENEKAVNLSGGMKRKLCVCMALIGDSEVVLLDEPTAGMDPGARQDVQKLVEREKA-NRTILLTTHYMDEAERLGDWVFIMSHGKLVASGTNQYLKQKFGTGYLLTVVLDHNGDKRKMAVILTDVCTHYVKEAERGEMHGQQIEIILPEARKKEFVPLFQALEAIQDRNYRSNVFDNMPNTLKSQLATLEMRSFGLSLNTLEQVFITIGDKVDKAIASRQNSRIS 881          

HSP 2 Score: 250.751 bits (639), Expect = 1.780e-66
Identity = 191/674 (28.34%), Postives = 324/674 (48.07%), Query Frame = 1
Query: 4210 NSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLL-FLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFL-IFPQYDLGRGMIDLSFSYLRYNISGGDENYNAFEWDITGNKICSLGILFVGWCLIIVFMESKHKKTLCIKLKDVKLKPYEIITDEDLD------VFKERERIELNHDV--LNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLH-PNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFDSSVKLSDI----FRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKND 6186
            N + Y  +P   ++ +   L  TV+A          +++    Y++S   S +     ++V LA  +I   + + ++FV+FLIEER      QQ+++G++P  ++ ++  +D I YS+  LI +  FLAF++       + LA ++L  FLY  + +P +Y  SF     S A V++  + +++ G   +  F + +    D  LKS    L  IF+ + P Y  G  +I ++   +   I   +E  N   WD  G     +G   V    + V ++ K  +    ++  V+   +  +     D      V +ERER+   H V   N  L +  LTK +                       R  AVN +   V + ECFGLLGVNGAGKTTTF +L G+   + G A+I G  + +       ++G+CPQFDAL   LT  E L    ++ G +  +     +L L+ + +  H +K     SGG KRK+   +AL+   +++ LDEPT G+D  ARR +W L+         A++LTSH+M+ECE LC R+A++  G +  IGS Q LKS +G++Y + + L+ PN+     R+ +  ++   + +S          +  ++    +  D     F + + L  +  VK++ ++Q SL+E F+  A  D
Sbjct: 1060 NMRYYHVLPTLISMINRARLTGTVDAE---------ISSGVFLYSKSTSNSNLLPSQLIDVLLAPMLILIFAMVTSTFVMFLIEERTCQFAHQQFLTGISPITFYSASLIYDGILYSLICLIFLFMFLAFHWM-----YDHLAIVILFWFLYFFSSVPFIYAVSFLFQSPSKANVLLIIWQVVISGAALLAVFLIFMIFNIDEWLKSI---LVNIFMFLLPSYAFGSAIITINTYGM---ILPSEELMN---WDHCGKNAWLMGTFGVCSFALFVLLQFKFVRRFLSQVWTVRRSSHNNVQPMMGDLPVCESVSEERERV---HRVNSQNSALVIKDLTKTFG----------------------RFTAVNELCLAVDQKECFGLLGVNGAGKTTTFNILTGQSFASSGEAMIGGRDVTELI-----SIGYCPQFDALMLDLTGRESLEILAQMHGFE--NYKAKAELILECVGMIAHADKLVRFYSGGQKRKISVGVALLAPTQMIILDEPTAGIDPKARREVWELLLWCREHSNSALMLTSHSMDECEALCSRIAVLNRGSLIAIGSSQELKSLYGNNYTMTLSLYEPNQ-----RDMVVQLVQTRLPNSVLKTTSTNKTLNLKWQIPKEKEDCWSAKFEMVQALAKDLGVKDFILAQSSLEETFLRLAGLD 1673          

HSP 3 Score: 143.665 bits (361), Expect = 1.028e-33
Identity = 108/328 (32.93%), Postives = 177/328 (53.96%), Query Frame = 1
Query: 2245 GILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRS-INRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQ--FTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVA 3219
             ++I++L K F   +  A++ L L   Q +  G LG NGAGKTTT +ILTG    +SG A I   D+    E+I   IG CPQ + L   LT  + +     + G    + K +L  I++ VG+      + +  SGG KRK+S+ +A +  +++I LDEPTAG+DP +RR +W+L++  R   N  ++LT+H MDE + LC RIA++++G L   GSS  LK  +G+ Y + L      Q +             +++ ++  +PNS ++  T T  T+ L        +  +++ FE + +    L +  + L+ +SLEE FL++A
Sbjct: 1365 ALVIKDLTKTF--GRFTAVNELCLAVDQKECFGLLGVNGAGKTTTFNILTGQSFASSGEAMIGGRDV---TELI--SIGYCPQFDALMLDLTGRESLEILAQMHGFENYKAKAEL--ILECVGMIAHADKLVRFYSGGQKRKISVGVALLAPTQMIILDEPTAGIDPKARREVWELLLWCREHSNSALMLTSHSMDECEALCSRIAVLNRGSLIAIGSSQELKSLYGNNYTMTLSLYEPNQRDM------------VVQLVQTRLPNS-VLKTTSTNKTLNLKWQIPKEKEDCWSAKFEMVQALAKDLGVKDFILAQSSLEETFLRLA 1670          

HSP 4 Score: 142.51 bits (358), Expect = 2.253e-33
Identity = 81/236 (34.32%), Postives = 130/236 (55.08%), Query Frame = 1
Query: 5284 AVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETII 5991
            AV+ +S     G+C  LLG NGAGK+TTF  + G    T G   I GY + ++  +  +++G CPQ++ L+  LT  E L     ++G +  D   ++   L ++ L    N+    +SGG KRK+   +ALIG  ++V LDEPT GMD GAR+ + +L++    +    ++LT+H M+E E L   + IM  G++   G+ Q+LK KFG  Y + + L  N     D+ ++  I+
Sbjct:  549 AVDGLSLRAVRGQCSILLGHNGAGKSTTFSSIAGIIRPTNGRITICGYDVGNEPGETRRHIGMCPQYNPLYDQLTVSEHLKLVYGLKGAREKDFKQDMKRLLSDVKLDFKENEKAVNLSGGMKRKLCVCMALIGDSEVVLLDEPTAGMDPGARQDVQKLVE--REKANRTILLTTHYMDEAERLGDWVFIMSHGKLVASGTNQYLKQKFGTGYLLTVVLDHN----GDKRKMAVIL 778          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Fly
Match: ABCA (gene:FBgn0031170 transcript:FBtr0332489)

HSP 1 Score: 422.165 bits (1084), Expect = 2.966e-120
Identity = 269/822 (32.73%), Postives = 444/822 (54.01%), Query Frame = 1
Query: 1075 SKVDIDNLAQNKLINIFAGVVFNESFQYLTLNNATV--LNYQIRMPTNRIDST-------KNFKVLDTFWNPIPRRDTIYD----LKYYTSGFLFLQEAFDQAFIELVTGNVTINIGTSMQIMPYPCFVDDRFIKFLSMIMPFILIIAWTPSVTIIIKSIVYEKENRLKEFMLLMGLTNFVHWCSWFISTIVVLIFPVIFMTLILKYN------EIIQFSSPGIIFILILSYVISFICQSFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENIAIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQITSEMLDTLTDGGNLPRPVSVLSFRKKTINTANINDPKVSFEFENNLVLLSGLSLIFQQISGLFIKRFHHTKRN 3483
            +++++D +++N     FAGV F++++  LT N+      ++ +R P     +T          ++  T     PR +   D      Y   GFL LQ +   A++   +G   +     M+  P+P ++ D  ++ +S IM  I+++++    T I K I  EKE +LKE M +MGL+N++HW +WF+ + ++L    I + +++K N       +   +   ++F LI+ Y++S IC  FM++ FF  ++ AA V G+++FI Y+P+   IN  D+LS     G  L++  +    I  I   E   +G Q+SN F    +D    +G  +IM+ +  V Y++I  YVE V PG +GVP+PW F FTR +W    +     +I +   ++ +  A   FE EP+   IG+ + +L K+F       +  L++  ++ +IT  LGHNGAGKTTTIS+LTG+  PTSGTA I  +DIR ++E  R  +G+CPQHN+LF  ++V +HI F+  +KG+    ++ ++   +K + L  K    S  LSGGMKRKLS+  A  G+++++  DEP++G+DP +RR +WDL+ +   + RT++LTTH MDEAD L DRIAI+  G+LKC G+S FLK+ +G GY L       ++ + C  N+ +         + K IP  K   +   + +  L  +++ +  F  +F QL+   D L +  YG+  TS+EEVF+KV  +     + + + +I         +GG+         FR +  N +  +D      F  N  LL GL L+  Q   + +K+F +T RN
Sbjct:  115 TQLELDTVSKNA----FAGVQFDDAWANLTENDPLPNDFHFALRFPAELRTATIAIANTWLTMRLFPTIDLTGPRNEGDDDGGIPPGYLREGFLPLQHSLSMAYLRQKSGEQDLP-NVVMKRYPFPAYIFDPLLEGMSSIMSLIILLSFIYPCTYITKYITAEKEKQLKEVMKIMGLSNWLHWTAWFVKSFIMLTISAILIAILVKINWSEDVAVLTHANFTALVFFLII-YIVSSICFCFMMATFFSRASTAAAVTGLIWFIAYIPYSFTINSYDDLSLSSKLGWSLISNTAMGFGIKLILGFEGTGEGLQWSNFFTPVSVDDTLTLGAVMIMMLVSCVIYMIICLYVEQVMPGSFGVPRPWNFPFTREFWCGEREYTGVEDIPNGHVEQRDPKA---FETEPEGKHIGLQMRHLKKRF--GNKMVVKGLSMNMFEDEITVLLGHNGAGKTTTISMLTGMFPPTSGTAIINGSDIRTNIEGARMSLGICPQHNVLFDEMSVSNHIRFFSRMKGLRGKAVEQEVAKYLKMIELEDKANVASSKLSGGMKRKLSVCCALCGDTKVVLCDEPSSGMDPSARRQLWDLL-QQEKVGRTLLLTTHFMDEADVLGDRIAIMCDGELKCQGTSFFLKKQYGSGYRLIC-----VKRDDCETNEVT-------ALLNKYIPGLKPECDIGAELSYQLPDSASAK--FEEMFGQLEEQSDELHLNGYGVGITSMEEVFMKVGAEKDNTGNIKDQHEI--------MNGGS--------GFRGEDDNESVQSDGI----FSENRRLLQGLQLLSNQWKAMLLKKFLYTWRN 890          

HSP 2 Score: 338.191 bits (866), Expect = 2.023e-93
Identity = 238/710 (33.52%), Postives = 359/710 (50.56%), Query Frame = 1
Query: 4204 WINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFSYLRYNISGGDENYNA---------------------FEWDITG--NKICSLGILFVGWCLIIVFMESKHKKTLCIKLKDVKLKPYEIITDEDLD--VFKERERI-ELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDI-PINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLH------------------------PNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFDSSVKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAK 6180
            W+N++   + P   N+  N +      +S  +Q     V N PL YT S L S +     L   LA  + F + F+ + +++FLI+ER + +KL Q+V GV  + +W+S F  D   Y ++ LIV++  + F          +  + +LL L+  AV+P +Y  S F  + +T F  +S  N+  G    I    +    +D    K   D L  IF IFP + L      +S + +  N +  +    A                     F W+  G   +   + +  V + LII+ +E +    L  K++ +  KP    T+  LD  V  ERERI +++ + L         TK  N  +D   K +G+            +AVN +S  V+E ECFGLLGVNGAGKTTTFKM+ G+E I+ G A + G S+  +    +K +G+CPQFDAL   LT  E L  +  +RG+Q S I  ++ DL+ K+     H +K T+  SGGNKRK+ TAIA+IG P +++LDEPT GMD  ARR LW ++  + +  K +++LTSH+MEECE LC RLAIMV+GE K IGS QHLK+KF     +KI++                         P + S  D + ++  +  E  +S   +E   ++  Y   + VK S IF + E  R    V++YSVSQ +L+E+F+ FAK
Sbjct: 1009 WLNNQALHTAPLTVNMVHNAIADKLFGSSVKIQ-----VTNAPLPYTTSTLLSQLSTGNNLGTQLASNLCFCMCFVSSIYILFLIKERESRAKLLQFVGGVKVWTFWLSQFICDFASYIVTALIVVITIVCFQETGLSTFGELGRYYLLLLLFGFAVLPFIYIMSLFFREPATGFARVSIVNIFCGMALFIVVVVMSSELFDT---KDTADILGWIFRIFPHFSLA-----MSLNKVYTNTATRNACAKAGALPPILLCELVPQCCNLKPYFAWEEPGVLPETVYMAVTGVVFFLIIIVLEFRLINELMFKIRQLISKPPPPPTEGQLDDDVANERERILQMSSNELA--------TK--NLVLDRVTKYYGQF-----------MAVNQVSLCVQEVECFGLLGVNGAGKTTTFKMMTGDERISSGAAYVQGLSLESNMNSIYKMIGYCPQFDALLDDLTGREVLRIFCMLRGVQESRIRQLSEDLA-KSFGFMKHIDKQTHAYSGGNKRKLSTAIAVIGSPSVIYLDEPTTGMDPAARRQLWNMVCRIRDSGK-SIVLTSHSMEECEALCTRLAIMVNGEFKCIGSTQHLKNKFSKGLILKIKVRRNLEALRQARLSGGYARNPDEQTVPAQMSQRDIDAVKEFVETEYPNSILQEEYQGILTFYIPLTGVKWSRIFGLMESNRDQLNVEDYSVSQTTLEEIFLEFAK 1682          

HSP 3 Score: 182.956 bits (463), Expect = 1.239e-45
Identity = 170/638 (26.65%), Postives = 291/638 (45.61%), Query Frame = 1
Query: 4360 SFIYAQMFLEVSLAIFVIFGLSFI-PASFVI-FLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQ---SYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMI-DLSFSYLRYNISGGDENYNAFEWDITGNKICSLGILFVGWCLIIVFMESKHKKTLCIKLKDVKLKPYEIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAI-INVSSEDKR---KLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVA--VILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFD----SSVKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKNDSVTRNISNGNALI 6225
            ++I+  +   +S  + +I  LSFI P +++  ++  E+    K    + G++ +++W + F    I  +IS  I+I   +  N+    + +   N  A +  L +Y ++ I   +  + F S++STA  V      L+  +  I  +   +  YDD SL S                LG  +I + +  +    I G +      +W      +     L +G  +I++ +       +C+ ++ V    + +    +    +E    E  +  + D+    G  +  +P   F  +  GK I + +    KR   K+ V  +S  + E E   LLG NGAGKTTT  ML G    T G AIING  I  +   A  ++G CPQ + L   ++    + F++R++G++   +   V   LK + L    N  +  +SGG KRK+    AL G  K+V  DEP+ GMD  ARR LW L+Q    + KV   ++LT+H M+E +VL  R+AIM DGE+K  G+   LK ++G  Y    RL   +    + NE+  ++NK I     +K E  +  E  +     +S K  ++F   E+      +  Y V   S++EVF+        T NI + + ++
Sbjct:  236 AYIFDPLLEGMSSIMSLIILLSFIYPCTYITKYITAEKEKQLKEVMKIMGLSNWLHWTAWFVKSFIMLTISA-ILIAILVKINWSEDVAVLTHANFTALVFFLIIYIVSSICFCFMMATFFSRASTAAAVTG----LIWFIAYIP-YSFTINSYDDLSLSS---------------KLGWSLISNTAMGFGIKLILGFEGTGEGLQWSNFFTPVSVDDTLTLGAVMIMMLVSCVIYMIICLYVEQVMPGSFGVPRPWNFPFTREFWCGEREYTGVEDIPN--GHVEQRDPKA-FETEPEGKHIGLQMRHLKKRFGNKMVVKGLSMNMFEDEITVLLGHNGAGKTTTISMLTGMFPPTSGTAIINGSDIRTNIEGARMSLGICPQHNVLFDEMSVSNHIRFFSRMKGLRGKAVEQEVAKYLKMIELEDKANVASSKLSGGMKRKLSVCCALCGDTKVVLCDEPSSGMDPSARRQLWDLLQ----QEKVGRTLLLTTHFMDEADVLGDRIAIMCDGELKCQGTSFFLKKQYGSGY----RLICVKRDDCETNEVTALLNKYI---PGLKPECDIGAELSYQLPDSASAKFEEMFGQLEEQSDELHLNGYGVGITSMEEVFMKVGAEKDNTGNIKDQHEIM 838          

HSP 4 Score: 170.244 bits (430), Expect = 8.294e-42
Identity = 103/324 (31.79%), Postives = 175/324 (54.01%), Query Frame = 1
Query: 2296 ALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQS----------------ETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVA 3219
            A++ ++L   + +  G LG NGAGKTTT  ++TG    +SG A++    +  +M  I   IG CPQ + L   LT  + +  + +L+G+ +S I+    D+ K  G  K +   +   SGG KRKLS A+A +G+  +I+LDEPT G+DP +RR +W+++ + R   ++I+LT+H M+E + LC R+AI+  G+ KC GS+  LK  F  G  L ++    +++                +T     +      + EF++   PNS L +E +   T  +        +++ +F  ++S+ D L +  Y +S T+LEE+FL+ A
Sbjct: 1361 AVNQVSLCVQEVECFGLLGVNGAGKTTTFKMMTGDERISSGAAYVQGLSLESNMNSIYKMIGYCPQFDALLDDLTGREVLRIFCMLRGVQESRIRQLSEDLAKSFGFMKHIDKQTHAYSGGNKRKLSTAIAVIGSPSVIYLDEPTTGMDPAARRQLWNMVCRIRDSGKSIVLTSHSMEECEALCTRLAIMVNGEFKCIGSTQHLKNKFSKGLILKIKVRRNLEALRQARLSGGYARNPDEQTVPAQMSQRDIDAVKEFVETEYPNSILQEEYQGILTFYIPLTGV---KWSRIFGLMESNRDQLNVEDYSVSQTTLEEIFLEFA 1681          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Fly
Match: ABCA (gene:FBgn0031170 transcript:FBtr0306679)

HSP 1 Score: 422.165 bits (1084), Expect = 3.116e-120
Identity = 269/822 (32.73%), Postives = 444/822 (54.01%), Query Frame = 1
Query: 1075 SKVDIDNLAQNKLINIFAGVVFNESFQYLTLNNATV--LNYQIRMPTNRIDST-------KNFKVLDTFWNPIPRRDTIYD----LKYYTSGFLFLQEAFDQAFIELVTGNVTINIGTSMQIMPYPCFVDDRFIKFLSMIMPFILIIAWTPSVTIIIKSIVYEKENRLKEFMLLMGLTNFVHWCSWFISTIVVLIFPVIFMTLILKYN------EIIQFSSPGIIFILILSYVISFICQSFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENIAIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQITSEMLDTLTDGGNLPRPVSVLSFRKKTINTANINDPKVSFEFENNLVLLSGLSLIFQQISGLFIKRFHHTKRN 3483
            +++++D +++N     FAGV F++++  LT N+      ++ +R P     +T          ++  T     PR +   D      Y   GFL LQ +   A++   +G   +     M+  P+P ++ D  ++ +S IM  I+++++    T I K I  EKE +LKE M +MGL+N++HW +WF+ + ++L    I + +++K N       +   +   ++F LI+ Y++S IC  FM++ FF  ++ AA V G+++FI Y+P+   IN  D+LS     G  L++  +    I  I   E   +G Q+SN F    +D    +G  +IM+ +  V Y++I  YVE V PG +GVP+PW F FTR +W    +     +I +   ++ +  A   FE EP+   IG+ + +L K+F       +  L++  ++ +IT  LGHNGAGKTTTIS+LTG+  PTSGTA I  +DIR ++E  R  +G+CPQHN+LF  ++V +HI F+  +KG+    ++ ++   +K + L  K    S  LSGGMKRKLS+  A  G+++++  DEP++G+DP +RR +WDL+ +   + RT++LTTH MDEAD L DRIAI+  G+LKC G+S FLK+ +G GY L       ++ + C  N+ +         + K IP  K   +   + +  L  +++ +  F  +F QL+   D L +  YG+  TS+EEVF+KV  +     + + + +I         +GG+         FR +  N +  +D      F  N  LL GL L+  Q   + +K+F +T RN
Sbjct:  137 TQLELDTVSKNA----FAGVQFDDAWANLTENDPLPNDFHFALRFPAELRTATIAIANTWLTMRLFPTIDLTGPRNEGDDDGGIPPGYLREGFLPLQHSLSMAYLRQKSGEQDLP-NVVMKRYPFPAYIFDPLLEGMSSIMSLIILLSFIYPCTYITKYITAEKEKQLKEVMKIMGLSNWLHWTAWFVKSFIMLTISAILIAILVKINWSEDVAVLTHANFTALVFFLII-YIVSSICFCFMMATFFSRASTAAAVTGLIWFIAYIPYSFTINSYDDLSLSSKLGWSLISNTAMGFGIKLILGFEGTGEGLQWSNFFTPVSVDDTLTLGAVMIMMLVSCVIYMIICLYVEQVMPGSFGVPRPWNFPFTREFWCGEREYTGVEDIPNGHVEQRDPKA---FETEPEGKHIGLQMRHLKKRF--GNKMVVKGLSMNMFEDEITVLLGHNGAGKTTTISMLTGMFPPTSGTAIINGSDIRTNIEGARMSLGICPQHNVLFDEMSVSNHIRFFSRMKGLRGKAVEQEVAKYLKMIELEDKANVASSKLSGGMKRKLSVCCALCGDTKVVLCDEPSSGMDPSARRQLWDLL-QQEKVGRTLLLTTHFMDEADVLGDRIAIMCDGELKCQGTSFFLKKQYGSGYRLIC-----VKRDDCETNEVT-------ALLNKYIPGLKPECDIGAELSYQLPDSASAK--FEEMFGQLEEQSDELHLNGYGVGITSMEEVFMKVGAEKDNTGNIKDQHEI--------MNGGS--------GFRGEDDNESVQSDGI----FSENRRLLQGLQLLSNQWKAMLLKKFLYTWRN 912          

HSP 2 Score: 337.806 bits (865), Expect = 2.352e-93
Identity = 238/710 (33.52%), Postives = 359/710 (50.56%), Query Frame = 1
Query: 4204 WINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFSYLRYNISGGDENYNA---------------------FEWDITG--NKICSLGILFVGWCLIIVFMESKHKKTLCIKLKDVKLKPYEIITDEDLD--VFKERERI-ELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDI-PINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLH------------------------PNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFDSSVKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAK 6180
            W+N++   + P   N+  N +      +S  +Q     V N PL YT S L S +     L   LA  + F + F+ + +++FLI+ER + +KL Q+V GV  + +W+S F  D   Y ++ LIV++  + F          +  + +LL L+  AV+P +Y  S F  + +T F  +S  N+  G    I    +    +D    K   D L  IF IFP + L      +S + +  N +  +    A                     F W+  G   +   + +  V + LII+ +E +    L  K++ +  KP    T+  LD  V  ERERI +++ + L         TK  N  +D   K +G+            +AVN +S  V+E ECFGLLGVNGAGKTTTFKM+ G+E I+ G A + G S+  +    +K +G+CPQFDAL   LT  E L  +  +RG+Q S I  ++ DL+ K+     H +K T+  SGGNKRK+ TAIA+IG P +++LDEPT GMD  ARR LW ++  + +  K +++LTSH+MEECE LC RLAIMV+GE K IGS QHLK+KF     +KI++                         P + S  D + ++  +  E  +S   +E   ++  Y   + VK S IF + E  R    V++YSVSQ +L+E+F+ FAK
Sbjct: 1031 WLNNQALHTAPLTVNMVHNAIADKLFGSSVKIQ-----VTNAPLPYTTSTLLSQLSTGNNLGTQLASNLCFCMCFVSSIYILFLIKERESRAKLLQFVGGVKVWTFWLSQFICDFASYIVTALIVVITIVCFQETGLSTFGELGRYYLLLLLFGFAVLPFIYIMSLFFREPATGFARVSIVNIFCGMALFIVVVVMSSELFDT---KDTADILGWIFRIFPHFSLA-----MSLNKVYTNTATRNACAKAGALPPILLCELVPQCCNLKPYFAWEEPGVLPETVYMAVTGVVFFLIIIVLEFRLINELMFKIRQLISKPPPPPTEGQLDDDVANERERILQMSSNELA--------TK--NLVLDRVTKYYGQF-----------MAVNQVSLCVQEVECFGLLGVNGAGKTTTFKMMTGDERISSGAAYVQGLSLESNMNSIYKMIGYCPQFDALLDDLTGREVLRIFCMLRGVQESRIRQLSEDLA-KSFGFMKHIDKQTHAYSGGNKRKLSTAIAVIGSPSVIYLDEPTTGMDPAARRQLWNMVCRIRDSGK-SIVLTSHSMEECEALCTRLAIMVNGEFKCIGSTQHLKNKFSKGLILKIKVRRNLEALRQARLSGGYARNPDEQTVPAQMSQRDIDAVKEFVETEYPNSILQEEYQGILTFYIPLTGVKWSRIFGLMESNRDQLNVEDYSVSQTTLEEIFLEFAK 1704          

HSP 3 Score: 182.956 bits (463), Expect = 1.354e-45
Identity = 170/638 (26.65%), Postives = 291/638 (45.61%), Query Frame = 1
Query: 4360 SFIYAQMFLEVSLAIFVIFGLSFI-PASFVI-FLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQ---SYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMI-DLSFSYLRYNISGGDENYNAFEWDITGNKICSLGILFVGWCLIIVFMESKHKKTLCIKLKDVKLKPYEIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAI-INVSSEDKR---KLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVA--VILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFD----SSVKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKNDSVTRNISNGNALI 6225
            ++I+  +   +S  + +I  LSFI P +++  ++  E+    K    + G++ +++W + F    I  +IS  I+I   +  N+    + +   N  A +  L +Y ++ I   +  + F S++STA  V      L+  +  I  +   +  YDD SL S                LG  +I + +  +    I G +      +W      +     L +G  +I++ +       +C+ ++ V    + +    +    +E    E  +  + D+    G  +  +P   F  +  GK I + +    KR   K+ V  +S  + E E   LLG NGAGKTTT  ML G    T G AIING  I  +   A  ++G CPQ + L   ++    + F++R++G++   +   V   LK + L    N  +  +SGG KRK+    AL G  K+V  DEP+ GMD  ARR LW L+Q    + KV   ++LT+H M+E +VL  R+AIM DGE+K  G+   LK ++G  Y    RL   +    + NE+  ++NK I     +K E  +  E  +     +S K  ++F   E+      +  Y V   S++EVF+        T NI + + ++
Sbjct:  258 AYIFDPLLEGMSSIMSLIILLSFIYPCTYITKYITAEKEKQLKEVMKIMGLSNWLHWTAWFVKSFIMLTISA-ILIAILVKINWSEDVAVLTHANFTALVFFLIIYIVSSICFCFMMATFFSRASTAAAVTG----LIWFIAYIP-YSFTINSYDDLSLSS---------------KLGWSLISNTAMGFGIKLILGFEGTGEGLQWSNFFTPVSVDDTLTLGAVMIMMLVSCVIYMIICLYVEQVMPGSFGVPRPWNFPFTREFWCGEREYTGVEDIPN--GHVEQRDPKA-FETEPEGKHIGLQMRHLKKRFGNKMVVKGLSMNMFEDEITVLLGHNGAGKTTTISMLTGMFPPTSGTAIINGSDIRTNIEGARMSLGICPQHNVLFDEMSVSNHIRFFSRMKGLRGKAVEQEVAKYLKMIELEDKANVASSKLSGGMKRKLSVCCALCGDTKVVLCDEPSSGMDPSARRQLWDLLQ----QEKVGRTLLLTTHFMDEADVLGDRIAIMCDGELKCQGTSFFLKKQYGSGY----RLICVKRDDCETNEVTALLNKYI---PGLKPECDIGAELSYQLPDSASAKFEEMFGQLEEQSDELHLNGYGVGITSMEEVFMKVGAEKDNTGNIKDQHEIM 860          

HSP 4 Score: 170.244 bits (430), Expect = 8.672e-42
Identity = 103/324 (31.79%), Postives = 175/324 (54.01%), Query Frame = 1
Query: 2296 ALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQS----------------ETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVA 3219
            A++ ++L   + +  G LG NGAGKTTT  ++TG    +SG A++    +  +M  I   IG CPQ + L   LT  + +  + +L+G+ +S I+    D+ K  G  K +   +   SGG KRKLS A+A +G+  +I+LDEPT G+DP +RR +W+++ + R   ++I+LT+H M+E + LC R+AI+  G+ KC GS+  LK  F  G  L ++    +++                +T     +      + EF++   PNS L +E +   T  +        +++ +F  ++S+ D L +  Y +S T+LEE+FL+ A
Sbjct: 1383 AVNQVSLCVQEVECFGLLGVNGAGKTTTFKMMTGDERISSGAAYVQGLSLESNMNSIYKMIGYCPQFDALLDDLTGREVLRIFCMLRGVQESRIRQLSEDLAKSFGFMKHIDKQTHAYSGGNKRKLSTAIAVIGSPSVIYLDEPTTGMDPAARRQLWNMVCRIRDSGKSIVLTSHSMEECEALCTRLAIMVNGEFKCIGSTQHLKNKFSKGLILKIKVRRNLEALRQARLSGGYARNPDEQTVPAQMSQRDIDAVKEFVETEYPNSILQEEYQGILTFYIPLTGV---KWSRIFGLMESNRDQLNVEDYSVSQTTLEEIFLEFA 1703          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Fly
Match: ABCA (gene:FBgn0031170 transcript:FBtr0332488)

HSP 1 Score: 422.165 bits (1084), Expect = 3.143e-120
Identity = 269/822 (32.73%), Postives = 444/822 (54.01%), Query Frame = 1
Query: 1075 SKVDIDNLAQNKLINIFAGVVFNESFQYLTLNNATV--LNYQIRMPTNRIDST-------KNFKVLDTFWNPIPRRDTIYD----LKYYTSGFLFLQEAFDQAFIELVTGNVTINIGTSMQIMPYPCFVDDRFIKFLSMIMPFILIIAWTPSVTIIIKSIVYEKENRLKEFMLLMGLTNFVHWCSWFISTIVVLIFPVIFMTLILKYN------EIIQFSSPGIIFILILSYVISFICQSFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENIAIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQITSEMLDTLTDGGNLPRPVSVLSFRKKTINTANINDPKVSFEFENNLVLLSGLSLIFQQISGLFIKRFHHTKRN 3483
            +++++D +++N     FAGV F++++  LT N+      ++ +R P     +T          ++  T     PR +   D      Y   GFL LQ +   A++   +G   +     M+  P+P ++ D  ++ +S IM  I+++++    T I K I  EKE +LKE M +MGL+N++HW +WF+ + ++L    I + +++K N       +   +   ++F LI+ Y++S IC  FM++ FF  ++ AA V G+++FI Y+P+   IN  D+LS     G  L++  +    I  I   E   +G Q+SN F    +D    +G  +IM+ +  V Y++I  YVE V PG +GVP+PW F FTR +W    +     +I +   ++ +  A   FE EP+   IG+ + +L K+F       +  L++  ++ +IT  LGHNGAGKTTTIS+LTG+  PTSGTA I  +DIR ++E  R  +G+CPQHN+LF  ++V +HI F+  +KG+    ++ ++   +K + L  K    S  LSGGMKRKLS+  A  G+++++  DEP++G+DP +RR +WDL+ +   + RT++LTTH MDEAD L DRIAI+  G+LKC G+S FLK+ +G GY L       ++ + C  N+ +         + K IP  K   +   + +  L  +++ +  F  +F QL+   D L +  YG+  TS+EEVF+KV  +     + + + +I         +GG+         FR +  N +  +D      F  N  LL GL L+  Q   + +K+F +T RN
Sbjct:  115 TQLELDTVSKNA----FAGVQFDDAWANLTENDPLPNDFHFALRFPAELRTATIAIANTWLTMRLFPTIDLTGPRNEGDDDGGIPPGYLREGFLPLQHSLSMAYLRQKSGEQDLP-NVVMKRYPFPAYIFDPLLEGMSSIMSLIILLSFIYPCTYITKYITAEKEKQLKEVMKIMGLSNWLHWTAWFVKSFIMLTISAILIAILVKINWSEDVAVLTHANFTALVFFLII-YIVSSICFCFMMATFFSRASTAAAVTGLIWFIAYIPYSFTINSYDDLSLSSKLGWSLISNTAMGFGIKLILGFEGTGEGLQWSNFFTPVSVDDTLTLGAVMIMMLVSCVIYMIICLYVEQVMPGSFGVPRPWNFPFTREFWCGEREYTGVEDIPNGHVEQRDPKA---FETEPEGKHIGLQMRHLKKRF--GNKMVVKGLSMNMFEDEITVLLGHNGAGKTTTISMLTGMFPPTSGTAIINGSDIRTNIEGARMSLGICPQHNVLFDEMSVSNHIRFFSRMKGLRGKAVEQEVAKYLKMIELEDKANVASSKLSGGMKRKLSVCCALCGDTKVVLCDEPSSGMDPSARRQLWDLL-QQEKVGRTLLLTTHFMDEADVLGDRIAIMCDGELKCQGTSFFLKKQYGSGYRLIC-----VKRDDCETNEVT-------ALLNKYIPGLKPECDIGAELSYQLPDSASAK--FEEMFGQLEEQSDELHLNGYGVGITSMEEVFMKVGAEKDNTGNIKDQHEI--------MNGGS--------GFRGEDDNESVQSDGI----FSENRRLLQGLQLLSNQWKAMLLKKFLYTWRN 890          

HSP 2 Score: 338.191 bits (866), Expect = 1.972e-93
Identity = 238/710 (33.52%), Postives = 359/710 (50.56%), Query Frame = 1
Query: 4204 WINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFSYLRYNISGGDENYNA---------------------FEWDITG--NKICSLGILFVGWCLIIVFMESKHKKTLCIKLKDVKLKPYEIITDEDLD--VFKERERI-ELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDI-PINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLH------------------------PNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFDSSVKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAK 6180
            W+N++   + P   N+  N +      +S  +Q     V N PL YT S L S +     L   LA  + F + F+ + +++FLI+ER + +KL Q+V GV  + +W+S F  D   Y ++ LIV++  + F          +  + +LL L+  AV+P +Y  S F  + +T F  +S  N+  G    I    +    +D    K   D L  IF IFP + L      +S + +  N +  +    A                     F W+  G   +   + +  V + LII+ +E +    L  K++ +  KP    T+  LD  V  ERERI +++ + L         TK  N  +D   K +G+            +AVN +S  V+E ECFGLLGVNGAGKTTTFKM+ G+E I+ G A + G S+  +    +K +G+CPQFDAL   LT  E L  +  +RG+Q S I  ++ DL+ K+     H +K T+  SGGNKRK+ TAIA+IG P +++LDEPT GMD  ARR LW ++  + +  K +++LTSH+MEECE LC RLAIMV+GE K IGS QHLK+KF     +KI++                         P + S  D + ++  +  E  +S   +E   ++  Y   + VK S IF + E  R    V++YSVSQ +L+E+F+ FAK
Sbjct: 1009 WLNNQALHTAPLTVNMVHNAIADKLFGSSVKIQ-----VTNAPLPYTTSTLLSQLSTGNNLGTQLASNLCFCMCFVSSIYILFLIKERESRAKLLQFVGGVKVWTFWLSQFICDFASYIVTALIVVITIVCFQETGLSTFGELGRYYLLLLLFGFAVLPFIYIMSLFFREPATGFARVSIVNIFCGMALFIVVVVMSSELFDT---KDTADILGWIFRIFPHFSLA-----MSLNKVYTNTATRNACAKAGALPPILLCELVPQCCNLKPYFAWEEPGVLPETVYMAVTGVVFFLIIIVLEFRLINELMFKIRQLISKPPPPPTEGQLDDDVANERERILQMSSNELA--------TK--NLVLDRVTKYYGQF-----------MAVNQVSLCVQEVECFGLLGVNGAGKTTTFKMMTGDERISSGAAYVQGLSLESNMNSIYKMIGYCPQFDALLDDLTGREVLRIFCMLRGVQESRIRQLSEDLA-KSFGFMKHIDKQTHAYSGGNKRKLSTAIAVIGSPSVIYLDEPTTGMDPAARRQLWNMVCRIRDSGK-SIVLTSHSMEECEALCTRLAIMVNGEFKCIGSTQHLKNKFSKGLILKIKVRRNLEALRQARLSGGYARNPDEQTVPAQMSQRDIDAVKEFVETEYPNSILQEEYQGILTFYIPLTGVKWSRIFGLMESNRDQLNVEDYSVSQTTLEEIFLEFAK 1682          

HSP 3 Score: 182.956 bits (463), Expect = 1.241e-45
Identity = 170/638 (26.65%), Postives = 291/638 (45.61%), Query Frame = 1
Query: 4360 SFIYAQMFLEVSLAIFVIFGLSFI-PASFVI-FLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQ---SYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMI-DLSFSYLRYNISGGDENYNAFEWDITGNKICSLGILFVGWCLIIVFMESKHKKTLCIKLKDVKLKPYEIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAI-INVSSEDKR---KLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVA--VILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFD----SSVKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKNDSVTRNISNGNALI 6225
            ++I+  +   +S  + +I  LSFI P +++  ++  E+    K    + G++ +++W + F    I  +IS  I+I   +  N+    + +   N  A +  L +Y ++ I   +  + F S++STA  V      L+  +  I  +   +  YDD SL S                LG  +I + +  +    I G +      +W      +     L +G  +I++ +       +C+ ++ V    + +    +    +E    E  +  + D+    G  +  +P   F  +  GK I + +    KR   K+ V  +S  + E E   LLG NGAGKTTT  ML G    T G AIING  I  +   A  ++G CPQ + L   ++    + F++R++G++   +   V   LK + L    N  +  +SGG KRK+    AL G  K+V  DEP+ GMD  ARR LW L+Q    + KV   ++LT+H M+E +VL  R+AIM DGE+K  G+   LK ++G  Y    RL   +    + NE+  ++NK I     +K E  +  E  +     +S K  ++F   E+      +  Y V   S++EVF+        T NI + + ++
Sbjct:  236 AYIFDPLLEGMSSIMSLIILLSFIYPCTYITKYITAEKEKQLKEVMKIMGLSNWLHWTAWFVKSFIMLTISA-ILIAILVKINWSEDVAVLTHANFTALVFFLIIYIVSSICFCFMMATFFSRASTAAAVTG----LIWFIAYIP-YSFTINSYDDLSLSS---------------KLGWSLISNTAMGFGIKLILGFEGTGEGLQWSNFFTPVSVDDTLTLGAVMIMMLVSCVIYMIICLYVEQVMPGSFGVPRPWNFPFTREFWCGEREYTGVEDIPN--GHVEQRDPKA-FETEPEGKHIGLQMRHLKKRFGNKMVVKGLSMNMFEDEITVLLGHNGAGKTTTISMLTGMFPPTSGTAIINGSDIRTNIEGARMSLGICPQHNVLFDEMSVSNHIRFFSRMKGLRGKAVEQEVAKYLKMIELEDKANVASSKLSGGMKRKLSVCCALCGDTKVVLCDEPSSGMDPSARRQLWDLLQ----QEKVGRTLLLTTHFMDEADVLGDRIAIMCDGELKCQGTSFFLKKQYGSGY----RLICVKRDDCETNEVTALLNKYI---PGLKPECDIGAELSYQLPDSASAKFEEMFGQLEEQSDELHLNGYGVGITSMEEVFMKVGAEKDNTGNIKDQHEIM 838          

HSP 4 Score: 171.014 bits (432), Expect = 5.482e-42
Identity = 105/339 (30.97%), Postives = 182/339 (53.69%), Query Frame = 1
Query: 2296 ALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQS----------------ETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVAD---DPSQISHKRQE 3255
            A++ ++L   + +  G LG NGAGKTTT  ++TG    +SG A++    +  +M  I   IG CPQ + L   LT  + +  + +L+G+ +S I+    D+ K  G  K +   +   SGG KRKLS A+A +G+  +I+LDEPT G+DP +RR +W+++ + R   ++I+LT+H M+E + LC R+AI+  G+ KC GS+  LK  F  G  L ++    +++                +T     +      + EF++   PNS L +E +   T  +        +++ +F  ++S+ D L +  Y +S T+LEE+FL+ A    + ++ +H+  E
Sbjct: 1361 AVNQVSLCVQEVECFGLLGVNGAGKTTTFKMMTGDERISSGAAYVQGLSLESNMNSIYKMIGYCPQFDALLDDLTGREVLRIFCMLRGVQESRIRQLSEDLAKSFGFMKHIDKQTHAYSGGNKRKLSTAIAVIGSPSVIYLDEPTTGMDPAARRQLWNMVCRIRDSGKSIVLTSHSMEECEALCTRLAIMVNGEFKCIGSTQHLKNKFSKGLILKIKVRRNLEALRQARLSGGYARNPDEQTVPAQMSQRDIDAVKEFVETEYPNSILQEEYQGILTFYIPLTGV---KWSRIFGLMESNRDQLNVEDYSVSQTTLEEIFLEFAKYQREDTRANHRLSE 1696          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Fly
Match: CG6052 (gene:FBgn0036747 transcript:FBtr0075195)

HSP 1 Score: 360.918 bits (925), Expect = 1.245e-100
Identity = 237/727 (32.60%), Postives = 398/727 (54.75%), Query Frame = 1
Query: 1111 LINIFAGVVFNESFQYLTLNNATV---LNYQIRMPTNR-------IDSTKNFKVLDTFWNPIPRR----DTIYDLKYYTSGFLFLQEAFDQAFIELVTGNVTINI-GTSMQIMPYPCFVDDRFIKFLSMIMPFILIIAWTPSVTIIIKSIVYEKENRLKEFMLLMGLTNFVHWCSWFISTIVVLIFPV-IFMTLIL----KYNEIIQFSSPGIIFILILSYVISFICQSFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLL-TQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENIAIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSE-IKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADD 3225
            L N  AGV F ++ + +  N+A     LNY +R P+         ID+ +  ++  ++     R     D    + Y   GFL +Q A   +++ L +G     I    +Q  PY  +  D+ +  L  ++PF++++++    + + K +  EKE +LKE M L+G+ N++HW +WF+ + ++L+  V + M+LI+        ++ FSS   + + + +YV++ +C  FM++V F  ++ A+ V  I +F+ Y+P+     + + LS      + L+ +  +    I+ I   E   +G  + N+F+    D +  + + ++ +   S+ +I I  YVE VFPG+YGVP+ W F+  + YW  +  +   + I  +F+      A     +     E+GI + NL K + K K  A+  ++LK ++++IT  LGHNGAGKTTTI+++TGI+ PTSGTA +   DIR  +   R  +G+CPQ+NILF  ++V DHI F+  LKG+  ++ +++++   +  + L  K    +KNLSGGMKRKLS+  A  GN++++  DEP++G+D   RR +WDL+   +   RTI+LTTH+MDEAD L DRIAI+S+GKL+C G+S +LK+ FG GY L            C      + G  + + I+K +P  K      T+ T  L    + +  F  L + LD     L++  YGLS  +LE+VF+ V  D
Sbjct:  121 LHNFLAGVQFEDN-ENVNTNDAGYPLNLNYSLRFPSELRTMQGPIIDTWRTSRLFLSYDTSGSRNRLDNDGGVPVGYIREGFLPIQHALTMSWLALASGVTDTGIPAIHLQRFPYRAYTYDQLLSGLRQLLPFVILLSFIYPASTVTKYVTSEKELQLKEIMKLIGVHNWLHWVAWFVKSYIMLMLVVFLIMSLIMVKFYASVAVLTFSSWVPVLLFLHTYVVTSVCLCFMLAVLFSKASTASAVAAIFWFLTYIPYSFGYYYYERLSLMSKLLISLIFSNSALGFGIHVIVMWEGTGEGITWRNMFHPVSTDDSLTLFYIIMTMSFGSIMFISICLYVEQVFPGEYGVPRRWNFMCHKNYWRQYVPS---LNIVPSFQTILHGSAKAKSCRRAR--EVGIQLFNLQKNYGKLK--AVKGISLKMHRNEITVLLGHNGAGKTTTINMITGIVKPTSGTAIVNGYDIRTHLAKARESLGICPQNNILFKEMSVRDHIIFFSKLKGIRGTKAVENEVGKYMTMLKLQDKSYVAAKNLSGGMKRKLSLCCALCGNAKVVLCDEPSSGIDAAGRRSLWDLLQSEKD-GRTILLTTHYMDEADVLGDRIAILSEGKLQCQGTSFYLKKRFGTGYLL-----------VCIMQSGCDVGA-VTQLIRKYVPPIKPERVLGTELTYRLPTEYSKK--FAELLQDLDEKCAQLQLVGYGLSGATLEDVFMAVNTD 824          

HSP 2 Score: 311.997 bits (798), Expect = 2.929e-85
Identity = 233/708 (32.91%), Postives = 349/708 (49.29%), Query Frame = 1
Query: 4201 IWINSKGYISMPAYANIFSNLLLRSTVNASKAL-QNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFSY-LRYNISGGDENYNAFEWDITGNKICSLGILFVGWCLIIVFMESKHKKT------LCIKLKDVKLKPYEIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDI-PINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPN----------------------------------RNSLSDR-NEIETIINKEIWSSARMKEENAVIIEYRFDSSVKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFA-KNDS 6189
            +W+N+K   + P   N+  N L      A K L Q+    V N PL Y+       +     L   ++I +   + FI A + I +I ER T +KL Q++SGV+   YW S+  WD + + +S L  IL   AF    YI   ++  +  +L ++    I   Y  S   S ++T F  IS  N L+G  T +   ++ L  ++   LK   + L   F + P Y L      +   Y +R   S G       +       IC     + GW    V +E  +         L I + D K+    +I ++  + F +R+R+E    + ND   V    ++    I+   K     +  +S   + KLAV  ISF V   ECFGLLG+NGAGKT+TFKML G+E IT G A I+G +I   T K ++ +G+CPQFDAL   LT  E L  Y  +RG+Q   + PI   L++ +     H +K T   SGGN+RK+ TAI+++G P +++LDEPT GMD  ARR LW++I  +    K +++LTSH+M+ECE LC RLAIMVDGE K +GSVQ LK++F     +K+++                                      +S +DR  ++   I+KEI   A +KEE   +I Y    S  LS IF++ E       +++Y + Q  L+E+F++FA K DS
Sbjct:  994 VWLNNKPLHTAPLTLNLLHNAL------AIKLLGQDASTYVTNEPLPYSDDTRTLRLNKGQVLGAEISINLSLTMCFITAFYAIPIIRERETRAKLLQFLSGVDVCAYWTSHIVWDYLVFVLSALSSILTIAAFKEIGYITPLDLSRYFYMLLIFGFPGIMLSYAASGCFSDAATGFTRISIINTLMG--TGLFLMFMTL-NFEAFQLKDVAEKLAWYFRLSPHYSLASSTHSIHIGYNIRRGCSIGGIRKLPKQLRCRNVPICCDIPGYYGWRKPGVLVEITYMIMLGSTLFLLIVMHDAKV--CNLIAEKLGNCFSKRKRVEGGTSIEND--SVVAEQRVVREMINSGRKDVPLLVYKISKRYRSKLAVKAISFHVPHAECFGLLGINGAGKTSTFKMLAGDEKITSGEAYIDGTNI--STHKVYRKIGYCPQFDALFEDLTGRETLNIYCLLRGVQRRHVTPICWGLAI-SFGFAKHMDKQTKHYSGGNRRKLSTAISVLGNPSVLYLDEPTSGMDPAARRQLWQIIGLIRTAGK-SIVLTSHSMDECEALCSRLAIMVDGEFKCLGSVQSLKNQFSKGLILKVKVKHKKKTFQRVVEDSSSSNDKKSISETDLKFLQMASVMESSQADRILKVNRFISKEI-PDAELKEEYNGLITYYIPHSKTLSKIFQLLETNSHKLNIEDYLIMQTRLEEIFLDFASKRDS 1683          

HSP 3 Score: 162.54 bits (410), Expect = 1.856e-39
Identity = 118/366 (32.24%), Postives = 188/366 (51.37%), Query Frame = 1
Query: 2239 EIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLF---------LEKSFEIQSETCHNNKASESGTKLLE------------------FIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVAD--DPSQISHKR 3249
            ++ +L+  + K++ +SK  A+  ++     ++  G LG NGAGKT+T  +L G    TSG A+I   +I      +  KIG CPQ + LF  LT  + +  Y LL+G+ +  +      +    G +K +   +K+ SGG +RKLS A++ +GN  +++LDEPT+G+DP +RR +W +I   R+  ++I+LT+H MDE + LC R+AI+  G+ KC GS   LK  F  G  L           ++  E  S +      SE+  K L+                  FI K IP+++L +E     T  + H+ T     + +F+ L+++   L I  Y +  T LEE+FL  A   D S I  KR
Sbjct: 1333 DVPLLVYKISKRY-RSKL-AVKAISFHVPHAECFGLLGINGAGKTSTFKMLAGDEKITSGEAYIDGTNI--STHKVYRKIGYCPQFDALFEDLTGRETLNIYCLLRGVQRRHVTPICWGLAISFGFAKHMDKQTKHYSGGNRRKLSTAISVLGNPSVLYLDEPTSGMDPAARRQLWQIIGLIRTAGKSIVLTSHSMDECEALCSRLAIMVDGEFKCLGSVQSLKNQFSKGLILKVKVKHKKKTFQRVVEDSSSSNDKKSISETDLKFLQMASVMESSQADRILKVNRFISKEIPDAELKEEYNGLITYYIPHSKT----LSKIFQLLETNSHKLNIEDYLIMQTRLEEIFLDFASKRDSSDIFTKR 1690          

HSP 4 Score: 156.377 bits (394), Expect = 1.512e-37
Identity = 160/626 (25.56%), Postives = 286/626 (45.69%), Query Frame = 1
Query: 4360 SFIYAQMFLEVSLAIFVIFGLSFI-PASFVI-FLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAF----IVLLFLYSLAV--IPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFSYLRYNISGGDENYNAFEWDITGNKICSLGILFVGWCLIIVFMESKHKKTLCIKLKDVKLKPYEIITDEDLDVFKE--RERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPIN-VDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIINKEIWSSARMKEENAVIIE--YRFDS--SVKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKNDSV 6192
            ++ Y Q+   +   +  +  LSFI PAS V  ++  E+    K    + GV+ +++W++ F    +K  I +++V+   ++     +  S  +L F     VLLFL++  V  +   +  +   SK+STA  V + +  L     T   +    Y Y+  SL S       I LIF    LG G+         + I   +       W    + + +   L + + ++ +   S    ++C+ ++ V    Y +    +    K   R+ +   + V +    ++G  K  +     R +  G  + N+     +  AV  IS  +   E   LLG NGAGKTTT  M+ G    T G AI+NGY I     KA +++G CPQ + L   ++  + + F+++++GI+ +    N V   +  L L          +SGG KRK+    AL G  K+V  DEP+ G+DA  RR LW L+Q  + +    ++LT+H M+E +VL  R+AI+ +G+++  G+  +LK +FG  Y +   +     S  D   +  +I K +     +K E  +  E  YR  +  S K +++ +  ++      +  Y +S  +L++VF+    +  V
Sbjct:  236 AYTYDQLLSGLRQLLPFVILLSFIYPASTVTKYVTSEKELQLKEIMKLIGVHNWLHWVAWF----VKSYIMLMLVVFLIMSLIMVKFYASVAVLTFSSWVPVLLFLHTYVVTSVCLCFMLAVLFSKASTASAVAAIFWFL-----TYIPYSFGYYYYERLSLMSK----LLISLIFSNSALGFGI---------HVIVMWEGTGEGITWRNMFHPVSTDDSLTLFYIIMTMSFGSIMFISICLYVEQVFPGEYGVPRRWNFMCHKNYWRQYVPSLNIVPSFQTILHGSAKAKSCR---RAREVGIQLFNLQKNYGKLKAVKGISLKMHRNEITVLLGHNGAGKTTTINMITGIVKPTSGTAIVNGYDIRTHLAKARESLGICPQNNILFKEMSVRDHIIFFSKLKGIRGTKAVENEVGKYMTMLKLQDKSYVAAKNLSGGMKRKLSLCCALCGNAKVVLCDEPSSGIDAAGRRSLWDLLQ--SEKDGRTILLTTHYMDEADVLGDRIAILSEGKLQCQGTSFYLKKRFGTGYLLVCIMQ----SGCDVGAVTQLIRKYV---PPIKPERVLGTELTYRLPTEYSKKFAELLQDLDEKCAQLQLVGYGLSGATLEDVFMAVNTDKRV 827          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Fly
Match: CG42816 (gene:FBgn0261998 transcript:FBtr0307890)

HSP 1 Score: 263.848 bits (673), Expect = 1.358e-70
Identity = 210/658 (31.91%), Postives = 340/658 (51.67%), Query Frame = 1
Query: 1300 YTSGFLFLQEAFDQAFIELVTGNVTINIG----TSMQIMPYPCFVDDRFIKFLSMIMPFILIIAWTPSVTIIIKSIVYEKENRLKEFMLLMGLTNFVHWCSWFISTIVVLIFP----VIFMTLILKYNEI--IQFS--SPGIIFILILSYVISFICQSFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFIN--FQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTR----RYWIPFSKNNDNIEISDNFRQREENIAIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKAS--ESGTKLL-EFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFL 3210
            Y +GFL +Q+A  Q  I+          G      ++ +P P          L  +   I++I     V  + KSIV EKE +LK  + LMG+ + + W +W+I T ++ +       +F  L+L  +EI  + F+  S  +  +L+LS+    IC SF++S     +   ++V  +     YLPFL+  +    + L+  +   +    QV     +  I   E   +G Q+ NLF ++       VG+ L+++ + S   +L+  Y+E + PG YGVP+PW+F  TR       +P+S+  + I    +    EE   +   E +P D   G+ I  L K F   K   + N++   ++ QIT  +GHNGAGKTT IS+L G ++PTSGTA I   DIR +    +  IGLCPQ N+LF +L+   HI  +  L+G+  +E+K ++ + +K++ L +K +  ++NLSGG +R+LS+A +  G  +++  DEP+ G+DP +RR +W LI++ +    TI+LTTH +D+ + L DR+ IIS G+L+C GS  FLK+   D   L           TC   K    E  T L+   +  I P S  I      + + LS +      F+SLF  L+S ++ L +  + LS  SLEE+F+
Sbjct:   11 YKTGFLAVQQALSQVHIKHKCKEFNKTQGDIKFPPIKDLPSPPIFKSDNSSTLQDVGIMIIVIIIFFVVVSLTKSIVEEKELQLKVTLNLMGVGSCLQWVAWYIQTFIIFLIGSSIITLFWKLVLPNSEISFMPFTHWSMALFVLLVLSHCT--ICFSFLMSSLISTTYRISLVTFLALIATYLPFLILHSKGCSEGLNVFLSLFLLSGLQV----LVVGICMWEDYGEGLQWGNLFETSWPGGTLSVGYILLVMILASFLSLLLCLYLEKIRPGPYGVPQPWHFPCTRCCSTESLLPYSRLFNRIFGIYSAAPDEERPDLQLIEPDPVDKIAGVQIRGLSKTF--GKMEVVKNVSFDMFEGQITVLMGHNGAGKTTLISMLAGFISPTSGTALINGFDIRQERRQAQRCIGLCPQQNVLFKHLSSVSHIQLFSRLRGLRGAEVKSEVQNYLKKLNLQEKKRLAARNLSGGTQRRLSVACSLCGGVKVLICDEPSTGLDPSARRELWRLILEAKE-GCTILLTTHQLDDGEVLGDRVVIISDGQLRCIGSLPFLKKQV-DASCLI----------TCEARKRCDLEKLTSLISRHVGTIQPFS--IKGRDVCYKLPLSKS----KYFSSLFRDLESQMNILGVRGFSLSSVSLEEIFM 642          

HSP 2 Score: 210.69 bits (535), Expect = 3.438e-54
Identity = 196/697 (28.12%), Postives = 314/697 (45.05%), Query Frame = 1
Query: 4204 WINSKGYI-SMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIF---LIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNL----------LVGGLTTI-TTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFSYLRYNISGGDENY---------------NAFEWDITGNKICSLGILFVGWCLIIVFMESKHKKTLCIKLKDVKLKPYEIITD-EDLDVFKERERIE-LNHDVLND-VLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVK--IRLHPNRNSLSDRNEIETIINKEIWSSARMKE--ENAVIIEYRFDSSVKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKN 6183
            W+  + Y+ + P   N+  N L +  +          I V + P        F+    + FL  +     I+ + ++  + +IF   +I+ERV+  K+ Q VSG+    YW+S+  +D        ++V    +        G       + +LF   LA +  +Y   F IS  S  F+ +S   L          ++G L  I    Y+ +Y  +   L +  + ++K F       L    I  + + L  N++  DE Y               N   W      + +  ILF    L+I+F E       C+  +     PY      ED  V +E E+I  ++ D +    L V G++K Y                        +LAVNNISF +K   C GLLG NGAGKTTTFKM++GE +I  GN  I+GYS+     KA K +G+CPQ D+    LT  + L  +  I G    D+    +          H +K     SGG KRK+  A+A  G   ++ LDEP+ G+D  +RR +W +I  +  + K AV+LTSHNM+E   LC +  I+VDG +  +GSVQH+K+K      +K  + + P+ N ++   +IE  I    + +A +KE  E +  + ++       S+IF   E  R++  +++YS+SQ SL++ F   A+ 
Sbjct:  815 WVGPRHYVHAAPMILNLVYNALAQELIGP-----KISIEVTSVP--------FTLRKKEDFLISNNGDIPIYVIGYVSIAMIIFSSAVIQERVSHMKMLQEVSGLEMITYWLSHLAFD--------MVVFFILVLALLLPLYGYAPWYLLLCVLFFTGLAGLIFIY---FLISMLSATFLAVSMILLSVIIGSLILMILGALALIFKMVYVAIYVANMHPLIAGYNCIQKCFHYM---SLCGSYISEAQNPLSENLTS-DEMYCINPLAFLEPRCVCVNPMTWPDMLVMLGTAIILF----LLIMFFEYGS----CVWYRCKGCCPYSSKGSIEDPKVSREAEKIRAMDADQIGTRALVVNGVSKKYGCD---------------------QLAVNNISFALKPSHCVGLLGPNGAGKTTTFKMIVGEHSIDKGNIYISGYSMRMKRNKAMKELGYCPQSDSFFEFLTGRQLLKVFLLIWGFPSKDLNKRCEKLADQFGFRKHLDKKITYYSGGTKRKINAAVA-CGANSLICLDEPSAGVDPASRRHVWTIINEVAQQGK-AVLLTSHNMDEINALCSKSVILVDGSIYAMGSVQHVKNKIAKGMTLKLVVNVQPD-NMVAMLTKIEDDIYM-TYPNAELKEKYEFSGRLTFQISKDTSWSEIFEYVEGNRSSWHLEDYSLSQPSLEDAFEEIAEE 1450          

HSP 3 Score: 163.696 bits (413), Expect = 8.295e-40
Identity = 102/329 (31.00%), Postives = 172/329 (52.28%), Query Frame = 1
Query: 5218 DFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIINKEIWSSARMK-EENAVIIEYRFDSSVKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKNDSVTRN 6201
            D  +K  G  I  +S    +   V N+SF + EG+   L+G NGAGKTT   ML G  + T G A+ING+ I  +  +A + +G CPQ + L   L+    +  ++R+RG++ +++   V   LK L+L          +SGG +R++  A +L G  K++  DEP+ G+D  ARR LWRLI  L  +    ++LT+H +++ EVL  R+ I+ DG+++ IGS+  LK +   D    I     +    D  ++ ++I++ + +      +   V  +     S   S +FR  E       V+ +S+S +SL+E+F++F   D  +R 
Sbjct:  331 DPVDKIAGVQIRGLSKTFGKMEVVKNVSFDMFEGQITVLMGHNGAGKTTLISMLAGFISPTSGTALINGFDIRQERRQAQRCIGLCPQQNVLFKHLSSVSHIQLFSRLRGLRGAEVKSEVQNYLKKLNLQEKKRLAARNLSGGTQRRLSVACSLCGGVKVLICDEPSTGLDPSARRELWRLI--LEAKEGCTILLTTHQLDDGEVLGDRVVIISDGQLRCIGSLPFLKKQV--DASCLITCEARKR--CDLEKLTSLISRHVGTIQPFSIKGRDVCYKLPLSKSKYFSSLFRDLESQMNILGVRGFSLSSVSLEEIFMSFGAEDLNSRQ 653          

HSP 4 Score: 132.494 bits (332), Expect = 2.573e-30
Identity = 102/363 (28.10%), Postives = 174/363 (47.93%), Query Frame = 1
Query: 2137 PFSKNNDNIEISDNFRQREENIAIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADD 3225
            P+S +  +IE     R+ E+  A+D      D +    L+ N V K       A++N++     S   G LG NGAGKTTT  ++ G  +   G  +I    +R        ++G CPQ +  F +LT    +  + L+ G    ++  +   +  + G  K L       SGG KRK++ A+A   NS +I LDEP+AGVDP SRR +W +I +     + ++LT+H+MDE + LC +  I+  G +   GS   +K     G  L L  + +        +      TK+ + I    PN++L  + K +++  L+   +    ++ +FE ++ +     +  Y LS  SLE+ F ++A++
Sbjct: 1104 PYS-SKGSIEDPKVSREAEKIRAMDA-----DQIGTRALVVNGVSKKYGCDQLAVNNISFALKPSHCVGLLGPNGAGKTTTFKMIVGEHSIDKGNIYISGYSMRMKRNKAMKELGYCPQSDSFFEFLTGRQLLKVFLLIWGFPSKDLNKRCEKLADQFGFRKHLDKKITYYSGGTKRKINAAVACGANS-LICLDEPSAGVDPASRRHVWTIINEVAQQGKAVLLTSHNMDEINALCSKSVILVDGSIYAMGSVQHVKNKIAKGMTLKLVVNVQ-------PDNMVAMLTKIEDDIYMTYPNAEL--KEKYEFSGRLTFQISKDTSWSEIFEYVEGNRSSWHLEDYSLSQPSLEDAFEEIAEE 1450          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Zebrafish
Match: abca1b (ATP-binding cassette, sub-family A (ABC1), member 1B [Source:ZFIN;Acc:ZDB-GENE-030131-9826])

HSP 1 Score: 1140.18 bits (2948), Expect = 0.000e+0
Identity = 710/1937 (36.65%), Postives = 1086/1937 (56.07%), Query Frame = 1
Query:  688 RQLLEMTAPIIFGKIYFTPDSEFTRQIIKKANITFEILDNLRLSAVEWRLNFRDWLSNQVNNSSTLDNMS----NNAKVCMETSQNYYT------VCQLIYKSSDRNRIQNSIEIASRIFD-------LIERGLNCTELNKFQPMKSKVDIDNLAQNKLIN--IFAGVVFNESFQYLTLNNATV---LNYQIRMPTNRIDSTKNFKVLDTFWNPIPRRDTIYDLKYYTSGFLFLQEAFDQAFIELVTGNVTINIGTSMQIMPYPCFVDDRFIKFLSMIMPFILIIAWTPSVTIIIKSIVYEKENRLKEFMLLMGLTNFVHWCSWFISTIVVLIFPVIFMTLILKYNEIIQFSSPGIIFILILSYVISFICQSFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENIAIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEK-----------------SF----EIQSETCHN-----NKASESGTKLLE------FIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDP---------SQISHKRQEKQI----TSEMLDTLTDGGNLPRPVSVLSFRKKTINTANINDPKVSFEFENNLVLLSGLSLIFQQISGLFIKRFHHTKRNIKGXXXXXXXXXXXXXXXXXXXXXXXXMDNQPSMTISPWLMMPKTRLVNLNTFYRKENTSDQISFKLNENYRSDIGQSGVRCMNTSLYQLENFKCLYPYNTNKWS----EKSPIEISLV--------TPECDCSTTGNQI----CSSPLSGGPESSNRIMASSDRLYDLSSYNISDYLMKNFKTFIMK-----------QYGGLQFILPSFFGQSCQVIGESQIWFD----FRQSINSSRDNNSNPEQVKFLNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFSYLRYNIS---GGDENYNAFEWDITGNKICSLGILFVGWCLIIVFMESK---HKKTLCIKLKDVKLKPYEIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLH-PNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFDSSV-KLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAK 6180
            R +     P++ GKI +TP S  T++II + N TF+ L  LR     W    R  + N + NS+ +D M     NN      ++Q   T      V   + K S+  R Q +      +F+        I R + C  L+K +P+ ++  + N + + L N   +AG+VF +    +  N++ +   +NY+IRM  + ++ T   K+ D +W+P PR D   DL+Y   GF +LQ+  + + I  VTG+     G  +Q MPYPC+VDD F++ +S  MP  + +AW  SV IIIK +VYEKE RLKE M +MGL N + W SWFIS+++ L+     + L+LK   ++ +S PG++F+ + S+ +  I Q F+IS  F  +N+AA  GGI+YF  YLP+++ + +QD +         LL+ V+F     +    E+   G Q++NLF+S + + ++ +  CLI+++ D+  Y ++ WY+E VFPG+YG+P+PWYF FT+ YW  F +N+ N   +     ++ N      E+EP  L++G+ IENLVK +   K  A+D L L F++ QIT FLGHNGAGKTTT+SILTG+  PTSGTA+I+  DIR ++  IR  +G+CPQHN+LF+ LTVE+HI+FY  LKG+++ E+K ++  I+ + GL  K K  +  LSGGM+RKLS+A+AFVG S+++ LDEPTAGVDP++RRGIWDL++KYR+  RTI+L+THHMDEAD L DRIAIIS GKL C GSSLFLK   G GYYL L K                 SF    +  SE+  +     ++ SE+ T +++       I K +P ++++++   + T VL + S     F  LF  LD  L  L I+SYG+SDT+LEE+FLKVA+D            +  +RQ +          L  LT+  +     S      K  +  + +D K S++       + G SL  QQ   L  KR  + +R+ KG F++++LP + + +      I       PS+ ++PW+   +        F+ ++   D  + KL      D G  G RCM      + +  C       +WS     +S IEI           +P C+CS  G +     C +   G P    +I + ++ L +L+  NISDYL+K +   I K           +YGG      S   +S QV+  ++   D     R+     +D+ S  +  +FL     F N    K N+ +IW N+KG+ S+ A+ N+ +N +LR+ +   K    +GI   N+PL  T+  L         ++V ++I VIF +SF+PASFV+FLI+ERV  +K  Q++SGV PY+YW++NF WD   Y +   +VIL F+ F  ++Y+ + N+    +LL LY  ++ P MYP SF     STA+VV+++ N+L+G   +I+TF ++L  + +  +   ND LK + LIFP + LGRG+ID+  +    +     G +   +  EWD+ G  + ++ +  V + +I V ++ +     K+LC KL          I +ED DV +ER+RI ++     D+L++  LTK+Y                    + K+K AV+ +  G+  GECFGLLGVNGAGKT+TFKML G+  +T G A I G SI+ +  + H+NMG+CPQFDA++ LLT  E L FY  +RG+  +++    +  ++ L L  + +K     SGGN RK+ TAI+LIG P +VFLDEPT GMD  ARR LW  I ++  E + +V+LTSH+MEECE LC R+AIMV+G  + +GSVQHLK++FG  Y + +R+  P+     D   +   I  E+  S  +KE++  +++Y+  SS+  L+ IF +    +    +++YSVSQ +LD+VF+NFAK
Sbjct:  373 RMIWRALKPLLMGKILYTPHSPATQKIIHEVNKTFQELGILRDLGGMWE-EARPKVWNFMENSNEMDLMRTLLLNNLTANFFSAQLAGTQWSVEDVISFLSKHSEDTRPQGTAFTWRDVFNETDQAIMSISRFMECVNLDKLEPVSTEEKLVNESMSLLDNRKFWAGIVFLD----IPSNSSELPPNVNYKIRMDIDNVERTN--KIKDGYWDPGPRADPFEDLRYIWGGFSYLQDVVEHSIIRAVTGSKE-KTGVYIQQMPYPCYVDDIFLRIMSRSMPLFMTLAWMYSVAIIIKGVVYEKEARLKETMRIMGLDNGILWFSWFISSLIPLLISAGLLVLLLKMGNLLPYSDPGVVFLFLGSFAVVTIMQCFLISTAFARANLAAACGGIIYFTLYLPYVLCVAWQDYVGFAAKVIASLLSPVAFGFGCEYFALFEEQGVGIQWNNLFSSPVEEDDYNLTTCLILMYFDAFLYGVMTWYIETVFPGQYGIPRPWYFPFTKSYW--FGENSTN---NTAIHGKKSNAGAVCIEEEPTHLKLGVYIENLVKVYRHGKKLAVDGLTLGFHEGQITSFLGHNGAGKTTTMSILTGLFPPTSGTAYIMGKDIRSELSSIRQSLGVCPQHNVLFSMLTVEEHIWFYARLKGLSEEEVKAEMEQILSDTGLPHKRKSRTSQLSGGMQRKLSVALAFVGGSKVVILDEPTAGVDPYARRGIWDLLLKYRA-GRTILLSTHHMDEADILGDRIAIISHGKLCCVGSSLFLKTQLGTGYYLTLVKKNTEPSLSSCRNSSSTVSFVKKDDNASESSSDAGLGSDQESEAATAIVDVTIISRLILKHVPAARMVEDQGHEITYVLPYESAKNGAFVELFHDLDDRLADLGISSYGVSDTTLEEIFLKVAEDSGVDTEMLSDGTLPVRRQRRHAFGADHQSCLKPLTEDDSFDCNESEGDPESKETDYLSGSDGKGSYQ-------VKGWSLKRQQFVALLWKRLLYARRSRKGFFAQIVLPAVFVCIALVFSLIVPPFGKYPSLALNPWMYEEQF------MFFSEDAPYDVSTHKLLRALFDDPG-FGTRCMKGE--SIPDAPCT--MGDEEWSTPEVPESIIEILTTRNWTMNDPSPACECSCNGKKKMLPECPAGAGGLPPPQIKI-SETETLQNLTGRNISDYLVKTYAQIIGKSLKNKIWVNEFRYGGF-----SLGARSTQVLPPAEEIDDAISRVREIFQLGKDSGSAAD--RFLKSLSAFINGLDTKNNV-KIWFNNKGWHSIGAFLNVMNNGILRANLPPGKDPSEFGITAYNHPLNLTKEQLSQVALMTTSVDVLVSICVIFAMSFVPASFVVFLIQERVNKAKHMQFISGVQPYLYWLANFLWDMCNYVVPATLVILIFVCFQQKAYVSATNLPVLALLLLLYGWSITPLMYPASFLFKIPSTAYVVLTSVNILIGINGSISTFVMEL--FGNHEIGGINDILKNVLLIFPHFCLGRGLIDMVKNQAMADALERFGENRFRSPLEWDMVGKNLFAMAVEGVVFFIITVLIQYRFFFEPKSLCPKLSP--------IGEEDEDVARERQRI-MSGAGQGDILELRQLTKVY--------------------KRKQKPAVDRLCVGIPPGECFGLLGVNGAGKTSTFKMLTGDSVVTKGEAFIAGKSILREIDEVHQNMGYCPQFDAINDLLTGREHLEFYAILRGVPENEVCAVAEWGIRKLGLVKYVDKNAGSYSGGNMRKLSTAISLIGAPPVVFLDEPTTGMDPKARRALWNCIHSVIKEGR-SVVLTSHSMEECEALCTRMAIMVNGRFRCLGSVQHLKNRFGDGYTIILRVAGPD----PDLQPVMKFIESELPGST-LKEKHRNMLQYQLPSSLTSLAHIFSILAKNKEFLRIEDYSVSQTTLDQVFVNFAK 2231          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Zebrafish
Match: abca1b (ATP-binding cassette, sub-family A (ABC1), member 1B [Source:ZFIN;Acc:ZDB-GENE-030131-9826])

HSP 1 Score: 1133.63 bits (2931), Expect = 0.000e+0
Identity = 707/1948 (36.29%), Postives = 1081/1948 (55.49%), Query Frame = 1
Query:  688 RQLLEMTAPIIFGKIYFTPDSEFTRQIIKKANITFEILDNLRLSAVEWRLNFRDWLSNQVNNSSTLDNMS----NNAKVCMETSQNYYT------VCQLIYKSSDRNRIQNSIEIASRIFD-------LIERGLNCTELNKFQPMKSKVDIDNLAQNKLIN--IFAGVVFNESFQYLTLNNATV---LNYQIRMPTNRIDSTKNFKVLDTFWNPIPRRDTIYDLKYYTSGFLFLQEAFDQAFIELVTGNVTINIGTSMQIMPYPCFVDDRFIKFLSMIMPFILIIAWTPSVTIIIKSIVYEKENRLKEFMLLMGLTNFVHWCSWFISTIVVLIFPVIFMTLILKYNEIIQFSSPGIIFILILSYVISFICQSFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENIAIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEK-----------------SFEIQSETCHNNKASESG---------------------------TKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDP---------SQISHKRQEKQI----TSEMLDTLTDGGNLPRPVSVLSFRKKTINTANINDPKVSFEFENNLVLLSGLSLIFQQISGLFIKRFHHTKRNIKGXXXXXXXXXXXXXXXXXXXXXXXXMDNQPSMTISPWLMMPKTRLVNLNTFYRKENTSDQISFKLNENYRSDIGQSGVRCMNTSLYQLENFKCLYPYNTNKWS----EKSPIEISLV--------TPECDCSTTGNQI----CSSPLSGGPESSNRIMASSDRLYDLSSYNISDYLMKNFKTFIMK-----------QYGGLQFILPSFFGQSCQVIGESQIWFD----FRQSINSSRDNNSNPEQVKFLNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFSYLRYNIS---GGDENYNAFEWDITGNKICSLGILFVGWCLIIVFMESK---HKKTLCIKLKDVKLKPYEIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFDSSV-KLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAK 6180
            R +     P++ GKI +TP S  T++II + N TF+ L  LR     W    R  + N + NS+ +D M     NN      ++Q   T      V   + K S+  R Q +      +F+        I R + C  L+K +P+ ++  + N + + L N   +AG+VF +    +  N++ +   +NY+IRM  + ++ T   K+ D +W+P PR D   DL+Y   GF +LQ+  + + I  VTG+     G  +Q MPYPC+VDD F++ +S  MP  + +AW  SV IIIK +VYEKE RLKE M +MGL N + W SWFIS+++ L+     + L+LK   ++ +S PG++F+ + S+ +  I Q F+IS  F  +N+AA  GGI+YF  YLP+++ + +QD +         LL+ V+F     +    E+   G Q++NLF+S + + ++ +  CLI+++ D+  Y ++ WY+E VFPG+YG+P+PWYF FT+ YW  F +N+ N   +     ++ N      E+EP  L++G+ IENLVK +   K  A+D L L F++ QIT FLGHNGAGKTTT+SILTG+  PTSGTA+I+  DIR ++  IR  +G+CPQHN+LF+ LTVE+HI+FY  LKG+++ E+K ++  I+ + GL  K K  +  LSGGM+RKLS+A+AFVG S+++ LDEPTAGVDP++RRGIWDL++KYR+  RTI+L+THHMDEAD L DRIAIIS GKL C GSSLFLK   G GYYL L K                 SF ++ +   +  +S++G                           T +   I K +P ++++++   + T VL + S     F  LF  LD  L  L I+SYG+SDT+LEE+FLKVA+D            +  +RQ +          L  LT+  +     S      K  +  + +D K S++       + G SL  QQ   L  KR  + +R+ KG F++++LP + + +      I       PS+ ++PW+   +        F+ ++   D  + KL      D G  G RCM      + +  C       +WS     +S IEI           +P C+CS  G +     C +   G P    +I + ++ L +L+  NISDYL+K +   I K           +YGG      S   +S QV+  ++   D     R+     +D+ S  +  +FL     F N    K N+ +IW N+KG+ S+ A+ N+ +N +LR+ +   K    +GI   N+PL  T+  L         ++V ++I VIF +SF+PASFV+FLI+ERV  +K  Q++SGV PY+YW++NF WD   Y +   +VIL F+ F  ++Y+ + N+    +LL LY  ++ P MYP SF     STA+VV+++ N+L+G   +I+TF ++L  + +  +   ND LK + LIFP + LGRG+ID+  +    +     G +   +  EWD+ G  + ++ +  V + +I V ++ +     K+LC KL          I +ED DV +ER+RI ++     D+L++  LTK+Y                    + K+K AV+ +  G+  GECFGLLGVNGAGKT+TFKML G+  +T G A I G SI+ +  + H+NMG+CPQFDA++ LLT  E L FY  +RG+  +++    +  ++ L L  + +K     SGGN RK+ TAI+LIG P +VFLDEPT GMD  ARR LW  I ++  E + +V+LTSH+MEECE LC R+AIMV+G  + +GSVQHLK++FG  Y + +R+        D   +   I  E+  S  +KE++  +++Y+  SS+  L+ IF +    +    +++YSVSQ +LD+VF+NFAK
Sbjct:  373 RMIWRALKPLLMGKILYTPHSPATQKIIHEVNKTFQELGILRDLGGMWE-EARPKVWNFMENSNEMDLMRTLLLNNLTANFFSAQLAGTQWSVEDVISFLSKHSEDTRPQGTAFTWRDVFNETDQAIMSISRFMECVNLDKLEPVSTEEKLVNESMSLLDNRKFWAGIVFLD----IPSNSSELPPNVNYKIRMDIDNVERTN--KIKDGYWDPGPRADPFEDLRYIWGGFSYLQDVVEHSIIRAVTGSKE-KTGVYIQQMPYPCYVDDIFLRIMSRSMPLFMTLAWMYSVAIIIKGVVYEKEARLKETMRIMGLDNGILWFSWFISSLIPLLISAGLLVLLLKMGNLLPYSDPGVVFLFLGSFAVVTIMQCFLISTAFARANLAAACGGIIYFTLYLPYVLCVAWQDYVGFAAKVIASLLSPVAFGFGCEYFALFEEQGVGIQWNNLFSSPVEEDDYNLTTCLILMYFDAFLYGVMTWYIETVFPGQYGIPRPWYFPFTKSYW--FGENSTN---NTAIHGKKSNAGAVCIEEEPTHLKLGVYIENLVKVYRHGKKLAVDGLTLGFHEGQITSFLGHNGAGKTTTMSILTGLFPPTSGTAYIMGKDIRSELSSIRQSLGVCPQHNVLFSMLTVEEHIWFYARLKGLSEEEVKAEMEQILSDTGLPHKRKSRTSQLSGGMQRKLSVALAFVGGSKVVILDEPTAGVDPYARRGIWDLLLKYRA-GRTILLSTHHMDEADILGDRIAIISHGKLCCVGSSLFLKTQLGTGYYLTLVKKNTEPSLSSCRNSSSTVSF-VKKDDNASESSSDAGLGSDQESEAATAIGTSWPESPVVPVDVTIISRLILKHVPAARMVEDQGHEITYVLPYESAKNGAFVELFHDLDDRLADLGISSYGVSDTTLEEIFLKVAEDSGVDTEMLSDGTLPVRRQRRHAFGADHQSCLKPLTEDDSFDCNESEGDPESKETDYLSGSDGKGSYQ-------VKGWSLKRQQFVALLWKRLLYARRSRKGFFAQIVLPAVFVCIALVFSLIVPPFGKYPSLALNPWMYEEQF------MFFSEDAPYDVSTHKLLRALFDDPG-FGTRCMKGE--SIPDAPCT--MGDEEWSTPEVPESIIEILTTRNWTMNDPSPACECSCNGKKKMLPECPAGAGGLPPPQIKI-SETETLQNLTGRNISDYLVKTYAQIIGKSLKNKIWVNEFRYGGF-----SLGARSTQVLPPAEEIDDAISRVREIFQLGKDSGSAAD--RFLKSLSAFINGLDTKNNV-KIWFNNKGWHSIGAFLNVMNNGILRANLPPGKDPSEFGITAYNHPLNLTKEQLSQVALMTTSVDVLVSICVIFAMSFVPASFVVFLIQERVNKAKHMQFISGVQPYLYWLANFLWDMCNYVVPATLVILIFVCFQQKAYVSATNLPVLALLLLLYGWSITPLMYPASFLFKIPSTAYVVLTSVNILIGINGSISTFVMEL--FGNHEIGGINDILKNVLLIFPHFCLGRGLIDMVKNQAMADALERFGENRFRSPLEWDMVGKNLFAMAVEGVVFFIITVLIQYRFFFEPKSLCPKLSP--------IGEEDEDVARERQRI-MSGAGQGDILELRQLTKVY--------------------KRKQKPAVDRLCVGIPPGECFGLLGVNGAGKTSTFKMLTGDSVVTKGEAFIAGKSILREIDEVHQNMGYCPQFDAINDLLTGREHLEFYAILRGVPENEVCAVAEWGIRKLGLVKYVDKNAGSYSGGNMRKLSTAISLIGAPPVVFLDEPTTGMDPKARRALWNCIHSVIKEGR-SVVLTSHSMEECEALCTRMAIMVNGRFRCLGSVQHLKNRFGDGYTIILRV---AGPDPDLQPVMKFIESELPGST-LKEKHRNMLQYQLPSSLTSLAHIFSILAKNKEFLRIEDYSVSQTTLDQVFVNFAK 2242          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Zebrafish
Match: abca1a (ATP-binding cassette, sub-family A (ABC1), member 1A [Source:ZFIN;Acc:ZDB-GENE-031006-12])

HSP 1 Score: 1118.22 bits (2891), Expect = 0.000e+0
Identity = 707/1954 (36.18%), Postives = 1063/1954 (54.40%), Query Frame = 1
Query:  661 KYLSVDYFHRQLLEMTAPIIFGKIYFTPDSEFTRQIIKKANITFEILDNLRLSAVEWRLNFRDWLSNQVNNSSTLDN----MSNNAKV------CMETSQNYYTVCQLIYKSSDRNRIQNSIEIASRIFD-------LIERGLNCTELNKFQPMKSKVDIDNLAQNKLIN--IFAGVVFNESFQYLTLNNATVLNYQIRMPTNRIDSTKNFKVLDTFWNPIPRRDTIYDLKYYTSGFLFLQEAFDQAFIELVTGNVTINIGTSMQIMPYPCFVDDRFIKFLSMIMPFILIIAWTPSVTIIIKSIVYEKENRLKEFMLLMGLTNFVHWCSWFISTIVVLIFPVIFMTLILKYNEIIQFSSPGIIFILILSYVISFICQSFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENIAIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFL-EKSFEIQSET-----------------------------CHNNKASESGTKLLEFIKKII----PNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQITSEMLDTLTDGGNLP----------------RPVSVLSF---------RKKTINTANINDPKVSFEFENNLVLLSGLSLIFQQISGLFIKRFHHTKRNIKGXXXXXXXXXXXXXXXXXXXXXXXXMDNQPSMTISPWLM----------MPKTRLVN--LNTFYRKENTSDQISFKLNENYRSDIGQSGVRCMNTSLYQLENFKCLYPYNTNKWSEKSPIEISLVTPECDCSTTGNQ--ICSSPLSGGPESSNRIMASSDR-LYDLSSYNISDYLMKNFKTFIMK-----------QYGGLQFILPSFFGQSCQVIGESQIWFDFRQSINSSRDNNSNPEQVKFLNYFQLFFNSSGIKTNLS-RIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFSYLRYNIS---GGDENYNAFEWDITGNKICSLGILFVGWCLIIVFMESKHKKTLCIKLKDV--KLKPYEIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFDSSV-KLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKNDS 6189
            K L      R +     P++ GKI +TPD+  T++II + N TF+ L  LR     W    R  + N + NS  +D     + NNA           T      V + + KSS+  R   +      +F+        I R + C  L+K +P+ ++  + N +   L +   +AG+VF +  Q  T +    +NY+IRM  + ++ T   K+ D +W+P PR D   DL+Y   GF +LQ+  +   I  +TG+     G  +Q MPYPC+VDD F++ +S  MP  + +AW  SV IIIK +VYEKE RLKE M +MGL N + W SWFIS+++ L+     + LILK   ++ +S PG+I++ + S+ +  I Q F+IS  F  +N+AA  GGI+YF  YLP+++ + +Q+ +       V LL+ V+F     +    E+   G Q+SNL +S + + ++ +   + ++  DSV Y ++ WY+EAVFPG+YG+P+PWYF FT+ YW    K      +  N ++  E + I   E+EP  ++ G+ IENL+K +   K  A+D L L FY+ QIT FLGHNGAGKTTT+SILTG+  PTSGTA+I   DIR D+  IR  +G+CPQHN+LF+ LTVE+HI+FY  LKG++  ++K ++  IV ++GL  K    S  LSGGM+RKLS+A+AFVG S+++ LDEPTAGVDP++RRGIWDL++KYR   RTIIL+THHMDEAD L DRIAIIS GKL C GSSLFLK   G GYYL L +K F++ + +                               ++  SE+ T  +  I  +I    P ++L+++   + T VL + S     F  LF ++D  L  L I+SYG+SDT+LEE+FLKVA+D                 +D  T  G LP                +P +   F           +  +  +  D K S++       + G SL  QQ   L  KR  + +R+ KG F++++LP + + +      I       PS+ + P +            P+ R  N  L+        +DQ +   N   RS   + G   +      +E       +    WS ++P      +P C+CS  G +  +   P   G     +I  + D  L +LS  NISDYL+K +   I K           +YGG      S   ++ Q +       D    I S     S     +FL     F    G+ TN + +IW N+KG+ S+ ++ N+ +N +LR+ +        +GI   N+PL  T+  L         ++V ++I VIF +SF+PASFV+FLI+ERV  +K  Q++SGV P++YW++NF WD   Y +   +VI+ F+ F  ++Y+ S N+    +LL LY  ++ P MYP SFF    STA+VV+++ N+L+G   +++TF L+L+  ++  +   ND LK +FLIFP + LGRG+ID+  +    +     G +   +   WD+ G  + ++ I  V +  I V ++ +     CIK + +  KLKP   I +ED DV +ER+RI L      D+L++  LTK+Y                    + K+K AV+ +  G+  GECFGLLGVNGAGKT+TFKML G+  +T G A + G S++ +  + H+NMG+CPQFDA++ LLT  E L FY  +RG+   ++    D  ++ L L  + +K     SGGN RK+ TA+ALIG P +VFLDEPT GMD  ARR LW  I ++  E + +V+LTSH+MEECE LC R+AIMV+G  + +GSVQHLK+KFG  Y + +R+      L    E    I +E+  S  +KE++  +++Y+  SS+  L+ IF +    +    +++YSVSQ +LD+VF+NFAK+ S
Sbjct:  365 KGLESSPISRMIWRALKPLLMGKILYTPDTPATQRIIHEVNKTFQELGVLRDLGGMWE-EMRPKIWNFMENSEEMDLVRTLLQNNASARFFNAKLSGTEWRVEDVSRFLSKSSEDTRPHGTAYTWREVFNETDQAIQTISRFMECVNLDKLEPVANEERLVNKSMRLLDDRKFWAGIVFPD-MQSNTSDLPLNVNYKIRMDIDNVERTN--KIKDGYWDPGPRADPFEDLRYIWGGFTYLQDVIEHGIIRALTGSKE-KTGVYIQQMPYPCYVDDIFLRVMSRSMPLFMTLAWMYSVAIIIKGVVYEKEARLKETMRIMGLDNGILWLSWFISSLIPLLISAALLVLILKMGNLLPYSDPGVIYLFLSSFAVVTIMQCFLISTLFSRANLAAACGGIIYFTLYLPYVLCVAWQNYVGFGAKIVVSLLSPVAFGFGCEYFALFEEQGVGIQWSNLLSSPMQEDSYNLTTSICLMLFDSVLYAVMTWYIEAVFPGQYGIPRPWYFPFTKSYWCG-EKCGWTTSVPSNRKENAEAVCI---EEEPAHIDPGVYIENLMKIYSNGKV-AVDGLTLGFYEGQITSFLGHNGAGKTTTMSILTGLFPPTSGTAYIQGKDIRTDLNAIRQNLGVCPQHNVLFSMLTVEEHIWFYARLKGLSAEKVKSEMEQIVMDLGLPHKRTSRSNQLSGGMQRKLSVALAFVGGSKVVILDEPTAGVDPYARRGIWDLLLKYRQ-GRTIILSTHHMDEADILGDRIAIISHGKLCCVGSSLFLKTQLGTGYYLTLVKKDFDLSASSCRTSSSTVSYSKGSLKKDDSVSESSSDAGLGSDHESETTTIDISLISNVIFKHVPTARLVEDLGHEITYVLPYESAKDGAFVELFHEIDDRLTDLSISSYGISDTTLEEIFLKVAEDCG---------------VDAETSDGTLPARRNRRHAFGDHQSCLKPFTEDDFDFNDSEGDPESRETDWLDGADGKGSYQ-------VKGWSLKRQQFVALLWKRLLYARRSRKGFFAQIVLPAVFVCIALVFSLIVPPFGKYPSLALEPSMYEEQFTFISNDAPEDRHTNRLLDALKDSPAYTDQCTDGKNTASRSCPIKDGEWLVPEVTESIEAI-----FLNGNWSMENP------SPLCECSCEGRKKMLPECPPGAGGLPPPQIKVTHDETLQNLSGRNISDYLVKTYAQIIGKSLKNKLWVNEFRYGGF-----SLGARNTQALPPGDELTDAISHIRSRFSLESGTAADRFLGSLSTFIR--GLDTNNNVKIWFNNKGWHSIGSFLNVMNNAVLRANLPPGLDRSKFGINAFNHPLNLTKEQLSHVALMTTSVDVLVSICVIFAMSFVPASFVVFLIQERVNKAKHMQFISGVQPFLYWLANFVWDMCNYIVPATLVIIIFVCFQQEAYVSSTNLPVLALLLLLYGWSITPLMYPASFFFKIPSTAYVVLTSVNILIGINGSVSTFVLELFGSNE--IGGINDILKNVFLIFPHFCLGRGLIDMVKNQAMADALERFGENRFRSPLAWDMVGKNLFAMAIEGVIFFSITVLIQYR----FCIKARSLSTKLKP---IGEEDEDVARERQRI-LGGGGQTDILELRQLTKVY--------------------KRKQKPAVDRLCVGIPPGECFGLLGVNGAGKTSTFKMLTGDSVVTSGEAYLAGNSVLTEIDEVHQNMGYCPQFDAINDLLTGREHLEFYAILRGVPEKEVCKVADWGIRKLGLMKYVDKAAGSYSGGNMRKLSTAMALIGGPPVVFLDEPTTGMDPKARRALWNCILSIIKEGR-SVVLTSHSMEECEALCTRMAIMVNGRFRCLGSVQHLKNKFGDGYTIILRVAGADPRLEPVME---FIERELPGST-LKEKHRNMLQYQLSSSLTSLARIFNILSKNKEQLHIEDYSVSQTTLDQVFVNFAKDQS 2232          

HSP 2 Score: 192.2 bits (487), Expect = 3.142e-48
Identity = 119/360 (33.06%), Postives = 193/360 (53.61%), Query Frame = 1
Query: 2164 EISDNFRQREENIAIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISH 3243
            E  D  R+R+    I G   + D LE+      L K + + + PA+D L +     +  G LG NGAGKT+T  +LTG    TSG A++  N +  +++ +   +G CPQ + +   LT  +H+ FY +L+G+ + E+       ++++GL K +   + + SGG  RKLS AMA +G   ++FLDEPT G+DP +RR +W+ I+      R+++LT+H M+E + LC R+AI+  G+ +C GS   LK  FGDGY + L  +            A      ++EFI++ +P S L ++ +      LS + T+      +F  L  + + L I  Y +S T+L++VF+  A D S   H
Sbjct: 1898 EDEDVARERQR---ILGGGGQTDILEL----RQLTKVYKRKQKPAVDRLCVGIPPGECFGLLGVNGAGKTSTFKMLTGDSVVTSGEAYLAGNSVLTEIDEVHQNMGYCPQFDAINDLLTGREHLEFYAILRGVPEKEVCKVADWGIRKLGLMKYVDKAAGSYSGGNMRKLSTAMALIGGPPVVFLDEPTTGMDPKARRALWNCILSIIKEGRSVVLTSHSMEECEALCTRMAIMVNGRFRCLGSVQHLKNKFGDGYTIILRVA-----------GADPRLEPVMEFIERELPGSTLKEKHRNMLQYQLSSSLTS---LARIFNILSKNKEQLHIEDYSVSQTTLDQVFVNFAKDQSDEDH 2236          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Zebrafish
Match: abca1a (ATP-binding cassette, sub-family A (ABC1), member 1A [Source:ZFIN;Acc:ZDB-GENE-031006-12])

HSP 1 Score: 1118.22 bits (2891), Expect = 0.000e+0
Identity = 707/1954 (36.18%), Postives = 1063/1954 (54.40%), Query Frame = 1
Query:  661 KYLSVDYFHRQLLEMTAPIIFGKIYFTPDSEFTRQIIKKANITFEILDNLRLSAVEWRLNFRDWLSNQVNNSSTLDN----MSNNAKV------CMETSQNYYTVCQLIYKSSDRNRIQNSIEIASRIFD-------LIERGLNCTELNKFQPMKSKVDIDNLAQNKLIN--IFAGVVFNESFQYLTLNNATVLNYQIRMPTNRIDSTKNFKVLDTFWNPIPRRDTIYDLKYYTSGFLFLQEAFDQAFIELVTGNVTINIGTSMQIMPYPCFVDDRFIKFLSMIMPFILIIAWTPSVTIIIKSIVYEKENRLKEFMLLMGLTNFVHWCSWFISTIVVLIFPVIFMTLILKYNEIIQFSSPGIIFILILSYVISFICQSFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENIAIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFL-EKSFEIQSET-----------------------------CHNNKASESGTKLLEFIKKII----PNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQITSEMLDTLTDGGNLP----------------RPVSVLSF---------RKKTINTANINDPKVSFEFENNLVLLSGLSLIFQQISGLFIKRFHHTKRNIKGXXXXXXXXXXXXXXXXXXXXXXXXMDNQPSMTISPWLM----------MPKTRLVN--LNTFYRKENTSDQISFKLNENYRSDIGQSGVRCMNTSLYQLENFKCLYPYNTNKWSEKSPIEISLVTPECDCSTTGNQ--ICSSPLSGGPESSNRIMASSDR-LYDLSSYNISDYLMKNFKTFIMK-----------QYGGLQFILPSFFGQSCQVIGESQIWFDFRQSINSSRDNNSNPEQVKFLNYFQLFFNSSGIKTNLS-RIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFSYLRYNIS---GGDENYNAFEWDITGNKICSLGILFVGWCLIIVFMESKHKKTLCIKLKDV--KLKPYEIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFDSSV-KLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKNDS 6189
            K L      R +     P++ GKI +TPD+  T++II + N TF+ L  LR     W    R  + N + NS  +D     + NNA           T      V + + KSS+  R   +      +F+        I R + C  L+K +P+ ++  + N +   L +   +AG+VF +  Q  T +    +NY+IRM  + ++ T   K+ D +W+P PR D   DL+Y   GF +LQ+  +   I  +TG+     G  +Q MPYPC+VDD F++ +S  MP  + +AW  SV IIIK +VYEKE RLKE M +MGL N + W SWFIS+++ L+     + LILK   ++ +S PG+I++ + S+ +  I Q F+IS  F  +N+AA  GGI+YF  YLP+++ + +Q+ +       V LL+ V+F     +    E+   G Q+SNL +S + + ++ +   + ++  DSV Y ++ WY+EAVFPG+YG+P+PWYF FT+ YW    K      +  N ++  E + I   E+EP  ++ G+ IENL+K +   K  A+D L L FY+ QIT FLGHNGAGKTTT+SILTG+  PTSGTA+I   DIR D+  IR  +G+CPQHN+LF+ LTVE+HI+FY  LKG++  ++K ++  IV ++GL  K    S  LSGGM+RKLS+A+AFVG S+++ LDEPTAGVDP++RRGIWDL++KYR   RTIIL+THHMDEAD L DRIAIIS GKL C GSSLFLK   G GYYL L +K F++ + +                               ++  SE+ T  +  I  +I    P ++L+++   + T VL + S     F  LF ++D  L  L I+SYG+SDT+LEE+FLKVA+D                 +D  T  G LP                +P +   F           +  +  +  D K S++       + G SL  QQ   L  KR  + +R+ KG F++++LP + + +      I       PS+ + P +            P+ R  N  L+        +DQ +   N   RS   + G   +      +E       +    WS ++P      +P C+CS  G +  +   P   G     +I  + D  L +LS  NISDYL+K +   I K           +YGG      S   ++ Q +       D    I S     S     +FL     F    G+ TN + +IW N+KG+ S+ ++ N+ +N +LR+ +        +GI   N+PL  T+  L         ++V ++I VIF +SF+PASFV+FLI+ERV  +K  Q++SGV P++YW++NF WD   Y +   +VI+ F+ F  ++Y+ S N+    +LL LY  ++ P MYP SFF    STA+VV+++ N+L+G   +++TF L+L+  ++  +   ND LK +FLIFP + LGRG+ID+  +    +     G +   +   WD+ G  + ++ I  V +  I V ++ +     CIK + +  KLKP   I +ED DV +ER+RI L      D+L++  LTK+Y                    + K+K AV+ +  G+  GECFGLLGVNGAGKT+TFKML G+  +T G A + G S++ +  + H+NMG+CPQFDA++ LLT  E L FY  +RG+   ++    D  ++ L L  + +K     SGGN RK+ TA+ALIG P +VFLDEPT GMD  ARR LW  I ++  E + +V+LTSH+MEECE LC R+AIMV+G  + +GSVQHLK+KFG  Y + +R+      L    E    I +E+  S  +KE++  +++Y+  SS+  L+ IF +    +    +++YSVSQ +LD+VF+NFAK+ S
Sbjct:  365 KGLESSPISRMIWRALKPLLMGKILYTPDTPATQRIIHEVNKTFQELGVLRDLGGMWE-EMRPKIWNFMENSEEMDLVRTLLQNNASARFFNAKLSGTEWRVEDVSRFLSKSSEDTRPHGTAYTWREVFNETDQAIQTISRFMECVNLDKLEPVANEERLVNKSMRLLDDRKFWAGIVFPD-MQSNTSDLPLNVNYKIRMDIDNVERTN--KIKDGYWDPGPRADPFEDLRYIWGGFTYLQDVIEHGIIRALTGSKE-KTGVYIQQMPYPCYVDDIFLRVMSRSMPLFMTLAWMYSVAIIIKGVVYEKEARLKETMRIMGLDNGILWLSWFISSLIPLLISAALLVLILKMGNLLPYSDPGVIYLFLSSFAVVTIMQCFLISTLFSRANLAAACGGIIYFTLYLPYVLCVAWQNYVGFGAKIVVSLLSPVAFGFGCEYFALFEEQGVGIQWSNLLSSPMQEDSYNLTTSICLMLFDSVLYAVMTWYIEAVFPGQYGIPRPWYFPFTKSYWCG-EKCGWTTSVPSNRKENAEAVCI---EEEPAHIDPGVYIENLMKIYSNGKV-AVDGLTLGFYEGQITSFLGHNGAGKTTTMSILTGLFPPTSGTAYIQGKDIRTDLNAIRQNLGVCPQHNVLFSMLTVEEHIWFYARLKGLSAEKVKSEMEQIVMDLGLPHKRTSRSNQLSGGMQRKLSVALAFVGGSKVVILDEPTAGVDPYARRGIWDLLLKYRQ-GRTIILSTHHMDEADILGDRIAIISHGKLCCVGSSLFLKTQLGTGYYLTLVKKDFDLSASSCRTSSSTVSYSKGSLKKDDSVSESSSDAGLGSDHESETTTIDISLISNVIFKHVPTARLVEDLGHEITYVLPYESAKDGAFVELFHEIDDRLTDLSISSYGISDTTLEEIFLKVAEDCG---------------VDAETSDGTLPARRNRRHAFGDHQSCLKPFTEDDFDFNDSEGDPESRETDWLDGADGKGSYQ-------VKGWSLKRQQFVALLWKRLLYARRSRKGFFAQIVLPAVFVCIALVFSLIVPPFGKYPSLALEPSMYEEQFTFISNDAPEDRHTNRLLDALKDSPAYTDQCTDGKNTASRSCPIKDGEWLVPEVTESIEAI-----FLNGNWSMENP------SPLCECSCEGRKKMLPECPPGAGGLPPPQIKVTHDETLQNLSGRNISDYLVKTYAQIIGKSLKNKLWVNEFRYGGF-----SLGARNTQALPPGDELTDAISHIRSRFSLESGTAADRFLGSLSTFIR--GLDTNNNVKIWFNNKGWHSIGSFLNVMNNAVLRANLPPGLDRSKFGINAFNHPLNLTKEQLSHVALMTTSVDVLVSICVIFAMSFVPASFVVFLIQERVNKAKHMQFISGVQPFLYWLANFVWDMCNYIVPATLVIIIFVCFQQEAYVSSTNLPVLALLLLLYGWSITPLMYPASFFFKIPSTAYVVLTSVNILIGINGSVSTFVLELFGSNE--IGGINDILKNVFLIFPHFCLGRGLIDMVKNQAMADALERFGENRFRSPLAWDMVGKNLFAMAIEGVIFFSITVLIQYR----FCIKARSLSTKLKP---IGEEDEDVARERQRI-LGGGGQTDILELRQLTKVY--------------------KRKQKPAVDRLCVGIPPGECFGLLGVNGAGKTSTFKMLTGDSVVTSGEAYLAGNSVLTEIDEVHQNMGYCPQFDAINDLLTGREHLEFYAILRGVPEKEVCKVADWGIRKLGLMKYVDKAAGSYSGGNMRKLSTAMALIGGPPVVFLDEPTTGMDPKARRALWNCILSIIKEGR-SVVLTSHSMEECEALCTRMAIMVNGRFRCLGSVQHLKNKFGDGYTIILRVAGADPRLEPVME---FIERELPGST-LKEKHRNMLQYQLSSSLTSLARIFNILSKNKEQLHIEDYSVSQTTLDQVFVNFAKDQS 2232          

HSP 2 Score: 192.2 bits (487), Expect = 3.142e-48
Identity = 119/360 (33.06%), Postives = 193/360 (53.61%), Query Frame = 1
Query: 2164 EISDNFRQREENIAIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISH 3243
            E  D  R+R+    I G   + D LE+      L K + + + PA+D L +     +  G LG NGAGKT+T  +LTG    TSG A++  N +  +++ +   +G CPQ + +   LT  +H+ FY +L+G+ + E+       ++++GL K +   + + SGG  RKLS AMA +G   ++FLDEPT G+DP +RR +W+ I+      R+++LT+H M+E + LC R+AI+  G+ +C GS   LK  FGDGY + L  +            A      ++EFI++ +P S L ++ +      LS + T+      +F  L  + + L I  Y +S T+L++VF+  A D S   H
Sbjct: 1898 EDEDVARERQR---ILGGGGQTDILEL----RQLTKVYKRKQKPAVDRLCVGIPPGECFGLLGVNGAGKTSTFKMLTGDSVVTSGEAYLAGNSVLTEIDEVHQNMGYCPQFDAINDLLTGREHLEFYAILRGVPEKEVCKVADWGIRKLGLMKYVDKAAGSYSGGNMRKLSTAMALIGGPPVVFLDEPTTGMDPKARRALWNCILSIIKEGRSVVLTSHSMEECEALCTRMAIMVNGRFRCLGSVQHLKNKFGDGYTIILRVA-----------GADPRLEPVMEFIERELPGSTLKEKHRNMLQYQLSSSLTS---LARIFNILSKNKEQLHIEDYSVSQTTLDQVFVNFAKDQSDEDH 2236          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Zebrafish
Match: abca4a (ATP-binding cassette, sub-family A (ABC1), member 4a [Source:ZFIN;Acc:ZDB-GENE-050517-3])

HSP 1 Score: 1097.03 bits (2836), Expect = 0.000e+0
Identity = 708/1946 (36.38%), Postives = 1059/1946 (54.42%), Query Frame = 1
Query:  712 PIIFGKIYFTPDSEFTRQIIKKANITFEILDNLRLSAVEWR-LNFRDW-----------LSNQVNNSSTLDNMSNNAKVCMETSQNYYTVCQLIYKSSDRNRIQ--------NSIEIASRIFDLIERGLNCTELNKFQPMKSKVDIDNLAQNKLIN--IFAGVVFNESFQYLTLNNATVLNYQIRMPTNRIDSTKNFKVLDTFWNPIPRRDTIYDLKYYTSGFLFLQEAFDQAFIELVTGNVTINIGTSMQIMPYPCFVDDRFIKFLSMIMPFILIIAWTPSVTIIIKSIVYEKENRLKEFMLLMGLTNFVHWCSWFISTIVVLIFPVIFMTLILKYNEIIQFSSPGIIFILILSYVISFICQSFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFP--GKYGVPKPWY--------------FLFTRRYWIPFSKNNDNIEIS---DNFRQR--EENI----AIDG-----FEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFL-----EKSFEIQSET--------------CHNNKASESGT-------------KLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQITSEMLDTLTDGGNLPRPVSVLSFRKKTINTANINDPKVSFEFENNLVLLSGLSLIFQQISGLFIKRFHHTKRNIKGXXXXXXXXXXXXXXXXXXXXXXXXMDNQPSMTISPWLMMPKTRLVNLNTFYRKENTSDQISFKLNENYRSDIGQSGVRCMNTSLYQLENFKC----------------LYPYNTNKWSEKSPIEISLVTPECDCSTTGNQICSSPL----SGGPESSNRIMASSDRLYDLSSYNISDYLMKNFKTFIMKQYGGLQFILPSFFGQSCQVIGESQIW-FDFRQSINSSRD-----NNSNPEQVKF-LNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFS------YLRYNISGGDENYNAFEWDITGNKICSLGILFVGWCLIIVFMESKHKKTLCIKLKDVKLKPYEIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNR-NSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFDSSVKLSDIFRVFEDLRTNEM--VKEYSVSQMSLDEVFINFAKNDS 6189
            P + GKI + PDS   RQIIK AN TFE L+ LR     W  +  + W           L + + N + +D+++   +    T Q+   +   +Y   + +R Q        N   +  ++  LI R   C  L+KF  +  +  + + A N L     +AG+VF + + + T     V   +IRM  + ++ T   K+ D +W+P PR D + DL+Y   GF +LQ+  +   I+  TG     +G  +Q MPYPC+VDD F+  L+   P  +++AW  SV++ +KSIV EKE RLKE +  MG+TN V WC+WFI T  ++      +TLI+   +++ +S+P I+F+ +L++  + I Q F++SVFF+ +N+AA   GI+YF  YLP +V   +QD ++ +M     L++QV+F     ++   E+   G Q+ N+  S +    F   + +IM+ +D+V Y ++AWY+++VFP  GK  V KP +                  +    P S  + +I      +  ++R  EE I    + D      FE EP  L  G+ +ENL K F  S  PA+D L+L FY+ QIT FLGHNGAGKTTT+S+LTG+  PTSGTA+I   DIR DM+ IR  +G+CPQHNI+F ++TV +HI FY LLKG    E + ++ ++++++GL  K    ++NLSGGM+RKLS+AMAFVG ++++FLDEPT+GVDP+SRR IWDL++KYR   RT+IL+THHMDEAD L DR+AIISQG+L CCGS LFLK   G G+YL L     E+   ++ E               C   KAS++                +   +   +P ++LI+    + T +L   +     + SLF +L+ +L  + ++S+G+SDTSLEEVFLKV  D  + +H           ++T +D           S      N+AN+    +S E   +   + G  L+ +Q   L IKRFHHT R+ K   ++++LP   + +      I       PS+T+SPW+   +       TF+  E           E   +  G  G RCM      LE + C                +   + ++W++ SP      +P C CST  N++   P+    +GG     RI ++ D L DL+  NISDYL+K +   I        ++    +G    V G   +   D +   N++       N +     K  L+ F  F      + N+ ++W N+KG+ +M A+ N+ +N +LR+ +     L  YGI   N+PL  T+  L         ++  +AI VIF +SF+PA FV++LI+ERVT +K  Q+VSGV+P VYW +NFFWD I YS+S  +V+  F+AF+ + Y    N+ A I LL LY  +V P MYP S+  +  STA+V +S  NL +G  ++  TF LDL+   +A L   N  LKK  L+FP + LGRG+ID++ +      Y R+   G D + + F WD  G  +  + +   G+   I+ +  +++  L   + D K  P   ITDED+DV KERERI       ND+LQ+  L+K Y  +  FR                   AV+ I  GV  GECFGLLGVNGAGKTTTFKML G+ ++T G A + GYSI+ + L  H+NMG+CPQFDA+  LLT  E L+ Y R+RG+  S+I    +  ++ L L+ +        SGGNKRK+ TAIA+IG P ++ LDEPT GMD  +RRFLW  I ++    + AV+LTSH+MEECE LC RLAIMV+G  K +G++QHLK KFG  Y V +++   +  ++ D N  E  + +  +     +E++   ++Y   SS  L+ IF+V   L   EM  +++YSVSQ +LD+VF+NFAK+ S
Sbjct:  392 PFLMGKILYAPDSPAARQIIKNANTTFEELERLRNMGRAWEEVGPQIWSFFQDSVQINMLRDSIRNPTVMDHINKGLRNAAFTGQH---ILNFLYSGPEEDREQDMPNFDWRNIFNLTDQVIRLINRYGECLVLDKFSSISDEDQLTHRALNLLEEGKFWAGLVFVDMYSWTTKVPPHV-KVKIRMDIDVVERTN--KIKDRYWDPGPRADPMDDLRYIWGGFAYLQDMIEHGIIKTHTGK-EWPLGVYLQQMPYPCYVDDLFMLTLNRCFPIFMVLAWVYSVSMTVKSIVLEKEMRLKETLKAMGVTNRVLWCTWFIDTFFMMASSTALLTLIIMGGKVLNYSNPIILFLFLLTFTTATIMQCFLMSVFFNKANLAAACSGIIYFTLYLPHVVCFAWQDRITKDMKIMASLMSQVAFGFGTEYLSRYEEQGLGLQWDNIQTSLLEGDEFSFLNSIIMMAVDTVLYGVLAWYLDSVFPVPGKPTVEKPAFDNLVNNTDDQAKNHTAPEKPPEPPGSCKHGDIREKLEREKLQKRIVEEEINRSMSTDSSGKVFFEPEPSGLVAGVCVENLYKVFSGSSRPAVDGLSLTFYEGQITAFLGHNGAGKTTTMSVLTGMFPPTSGTAYIYGKDIRTDMDAIRKSLGMCPQHNIIFHHMTVAEHILFYSLLKGRPLPEAQLEVENMLEDLGLPHKRNEEAQNLSGGMQRKLSVAMAFVGGAKVVFLDEPTSGVDPYSRRSIWDLLLKYR---RTLILSTHHMDEADLLSDRVAIISQGRLYCCGSPLFLKNCLGAGFYLTLVRRIKEQPAPVRKEGQCDCTDDCSCKCSLCTKFKASDTEKPRVSERQMEGNIESITALVHHHVPEARLIEVIGQELTFLLPSRAFKHRSYASLFRELEETLADMGLSSFGVSDTSLEEVFLKVTAD-GEAAH-----------INTASDTDR--------SHANGQSNSANV----ISKEGRGS-QQVKGFFLVVKQFFALLIKRFHHTTRSGKDFLAQIVLPASFVFISLMFTLIVPPFGEYPSLTLSPWMYGRQF------TFFSNEQMQSPDMRYFGEVLLNRPG-FGTRCMVDE--PLEEYPCNNITTEWEMPLVNPMLIEMLSNSEWTDISP------SPSCQCSTP-NKLTMLPVCPEGAGGLPPPQRIQSTGDMLMDLTGRNISDYLVKTYPNLIRTSLKSKYWVNEQRYG-GISVGGRLPVLNLDPKSIQNAAAQIGRLLNVTGGRYSKLALDEFATFLRYMETENNV-KVWFNNKGWHAMVAFMNVANNAILRANLPPGVDLNEYGITAINHPLNLTKEQLSEVTVLTTSVDAVVAINVIFAMSFVPAGFVLYLIQERVTQAKHLQFVSGVSPLVYWTANFFWDMINYSVSAAMVVGIFIAFDKKCYTSPGNLQALIALLMLYGWSVTPMMYPMSYIFNVPSTAYVSLSCINLFIGINSSAITFILDLFDSTEA-LYKCNQVLKKALLVFPHFCLGRGLIDMAMNQAVMDVYARF---GEDFSLDPFSWDFVGENLTFMAV--EGFVYFILNILIQYRFFLDHWMSDFKKPP---ITDEDVDVAKERERI-YKGGSSNDILQIKDLSKTYTGT--FRP------------------AVDRICVGVSPGECFGLLGVNGAGKTTTFKMLTGDIDVTSGEADVAGYSILTNILDVHQNMGYCPQFDAIDDLLTGREHLHLYARLRGVPESEISRVAEWGIQKLGLSEYAGCTAGTYSGGNKRKLSTAIAMIGCPALLLLDEPTTGMDPHSRRFLWNSIMSVIQGGR-AVVLTSHSMEECEALCTRLAIMVNGTFKCLGTIQHLKYKFGDGYVVTMKIRAAKVGAVPDLNPAEAFM-ESTFPGCIQREKHYNTLQYEIASS-SLAKIFQVV--LANKEMLNIEDYSVSQTTLDQVFVNFAKHQS 2249          

HSP 2 Score: 164.081 bits (414), Expect = 1.073e-39
Identity = 108/342 (31.58%), Postives = 180/342 (52.63%), Query Frame = 1
Query: 2254 IENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTS-----LFEQLDSSLDFLKIASYGLSDTSLEEVFLKVA-----DDPSQISHKR 3249
            I++L K +  +  PA+D + +     +  G LG NGAGKTTT  +LTG +  TSG A +    I  ++  +   +G CPQ + +   LT  +H++ Y  L+G+ +SEI       ++++GLS+   C +   SGG KRKLS A+A +G   ++ LDEPT G+DP SRR +W+ I+      R ++LT+H M+E + LC R+AI+  G  KC G+   LK  FGDGY + ++             +A++ G      +  + P    ++ T         H +T + +  S     +F+ + ++ + L I  Y +S T+L++VF+  A     +D + + H R
Sbjct: 1936 IKDLSKTYTGTFRPAVDRICVGVSPGECFGLLGVNGAGKTTTFKMLTGDIDVTSGEADVAGYSILTNILDVHQNMGYCPQFDAIDDLLTGREHLHLYARLRGVPESEISRVAEWGIQKLGLSEYAGCTAGTYSGGNKRKLSTAIAMIGCPALLLLDEPTTGMDPHSRRFLWNSIMSVIQGGRAVVLTSHSMEECEALCTRLAIMVNGTFKCLGTIQHLKYKFGDGYVVTMKI------------RAAKVGA-----VPDLNPAEAFMESTFPGCIQREKHYNTLQYEIASSSLAKIFQVVLANKEMLNIEDYSVSQTTLDQVFVNFAKHQSGEDDAVVLHPR 2260          

HSP 3 Score: 52.7582 bits (125), Expect = 6.963e-6
Identity = 36/121 (29.75%), Postives = 60/121 (49.59%), Query Frame = 1
Query:   49 NQISLLLWKNFRLRKRRPFQLTFEXXXXXXXXXXXXXXRQAQLKFRIGRCELREKNMASLGPIPFLRDYLCTFNTTCYNETQIDWKDNKTNDYLTFLNNC--TRIYNSYPKRQLTSTEFLQ 405
            +Q+ LLLWKN+ +RKR+  +L  EI+  +   + L+ +R+A   +R   C    K M S G +P+++  +C  N  C+  T         ++Y    NN    R ++   +     TEFLQ
Sbjct:    5 SQVRLLLWKNWTVRKRQKTRLFMEIMWPVVLFIGLVWLRKANPLYRQHECHFPNKAMPSSGVLPWIQGIVCNANNPCFQHTTRGESPGLVSNY----NNSILARFWSDAQELLFEDTEFLQ 121          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Xenopus
Match: ABCA1 (ATP binding cassette subfamily A member 1 [Source:NCBI gene;Acc:100491942])

HSP 1 Score: 1116.29 bits (2886), Expect = 0.000e+0
Identity = 691/1929 (35.82%), Postives = 1055/1929 (54.69%), Query Frame = 1
Query:  682 FHRQLLEMTAPIIFGKIYFTPDSEFTRQIIKKANITFEILDNLRLSAVEWRLNFRDWLSNQVNNSSTLD-------NMSNNAKVCMETSQNYYT---VCQLIYKSSDRNRIQN--------SIEIASRIFDLIERGLNCTELNKFQPMKSKVDIDNLAQNKLIN---IFAGVVFNESFQYLTLNNATVLNYQIRMPTNRIDSTKNFKVLDTFWNPIPRRDTIYDLKYYTSGFLFLQEAFDQAFIELVTGNVTINIGTSMQIMPYPCFVDDRFIKFLSMIMPFILIIAWTPSVTIIIKSIVYEKENRLKEFMLLMGLTNFVHWCSWFISTIVVLIFPVIFMTLILKYNEIIQFSSPGIIFILILSYVISFICQSFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENIAIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFE----------------IQSETCHNNKASESG--------------TKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQITSEMLDTLTDGGNLPRPVSVLSF-------RKKTINTA-NINDPKVSFEFENNLVL----------LSGLSLIFQQISGLFIKRFHHTKRNIKGXXXXXXXXXXXXXXXXXXXXXXXXMDNQPSMTISPWLMMPKTRLVNLNTFYRKENTSDQISFKLNENYRSDIGQSGVRCMNTSLYQLENFKCLYPYNTNKWS----EKSPIEISL--------VTPECDCSTTGNQ----ICSSPLSGGPESSNRIMASSDRLYDLSSYNISDYLMKNFKTFIMKQYGGLQFILPSFFGQSCQVIGESQIWFDFRQSINSSRDNNSNPEQV---KFLNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFSYLRYNIS---GGDENYNAFEWDITGNKICSL---GILFVGWCLIIVFMESKHKKTLCIKLKDV--KLKPYEIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFDSS-VKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFA 6177
             +R +     P++ GKI +TP +  T+ ++ + N TF+ L   R     W    R  + N + +S  +D       N  +   +  + +   +T   + + + K +     +N        ++    R+   + R + C  L+K +P+ ++  + + +  +L+N    +AG+VF +  +  T     V  Y+IRM  + ++ T   K+ D +W+P PR D   D++Y   GF +LQ+  +QA I + TG V    G  +Q MPYPC+VDD F++ +S  MP  + +AW  SV +IIK IVYEKE RLKE M +MGL N + W SWFIS+++ L+     + LILK   ++ +S P ++F+ +  + +  I Q F+IS  F  +N+AA  GGI+YF  YLP+++ + +QD +   +      L+ V+F         LE+   G Q+ NL  S + +  + +     M+  D++ Y ++ WY+EAVFPG+YG+P+PWYF FT+ YW       +  +  +     ++  +    E+EP  L +G+ I+NLVK +   K  A+D L L FY+ QIT FLGHNGAGKTTT+SILTG+  PT+GTA+I+  DIR ++  IR  +G+CPQHN+LF  LTVE+HI+FY  LKG+++ ++K ++  +V +VGL  K K  +  LSGGM+RKLS+A+AFVG S+++ LDEPTAGVDP+SRRGIW+L++KYR   RTIIL+THHMDEAD L DRIAIIS GKL C GSSLFLK   G GYYL L K                   ++ E   +  +S++G              + +   I K +P ++L+++   + T VL + +     F  LF ++D  L  L I+SYG++DT+LEE+FLKVADD                 +D  T  G LP      +F       R  T + A + ND  +  E      L          L   +L+ QQ + L  KR  + KR+ KG F++++LP + +L+      I       PS+ + PW+   +       TF+  +   DQ +  L +      G  G  CM    + +    C       +WS     +S +++ L         +P C+CS+   +    IC  P +GG     R   +SD L +L+  NISDYL+K +   I K+YGG      S    +   +  ++   +   SIN  +     P+     +FL+ F  F      K N+ ++W N+KG+ ++ A+ N+ +N +LRS +   +   +YGI   N+PL  T+  L         ++V ++I VIF +SF+PASFV+FLI+ERV+ +K  Q +SGV P +YW++NF WD   Y +   +VI+ F+ F   SY+ S N+    +LL LY  ++ P MYP SF     STA+VV+++ NL +G   ++ TF L+L+   +  L + N+ LK + LIFP + LGRG+ID+  +    +     G +   +   WD+ G  + ++   G++F    L+I +          IK + V  KL P   + DED DV +ER+RI  N    ND+L++ GLTKIY                      KRK AV+ +  G+  GECFGLLGVNGAGKTTTFKML G+ ++T G A +  +SI+ +  + H+NMG+CPQFDA++ LLT  E L  Y  +RG+   ++    + +++ L L  +  K     SGGNKRK+ TAIALIG P +VFLDEPT GMD  ARRFLW    ++  E + +V+LTSH+MEECE LC R+AIMV+G  K +GSVQHLK++FG  Y + +R+     S  D   +E   +     S  +KE++  +++Y+  SS   L+ IF +    +    +++YSVSQ +LD+VF+NFA
Sbjct:  367 LYRMIWRALKPLLVGKILYTPSTPATQMLMSEVNKTFQELSVFRDLGAMWE-EVRPQIKNFMESSQEMDLIRTLLTNKGSKTFLDQQLNSTGWTTENISRFLAKETADVETENGPFYSWREALNETDRVVLTLSRFMECVNLDKLEPVATEEMLIDKSM-ELLNERKFWAGIVFMDMPEEETELPHHV-KYKIRMDIDNVERTN--KIKDGYWDPGPRADPFEDMRYIWGGFSYLQDVVEQAIIRVQTG-VEKRTGIYVQQMPYPCYVDDIFLRVMSRSMPLFMTLAWIYSVAVIIKGIVYEKEARLKETMRIMGLDNGILWLSWFISSLIPLLMSAALLVLILKTGNLLPYSDPSVVFVFLSVFAVVTISQCFLISTIFSRANLAAACGGIIYFTLYLPYVLCVAWQDYVGYTLKIFASFLSPVAFGFGCEVFALLEEQGVGVQWDNLLESPLEENGYNITTSGFMMLFDTLLYGIMTWYIEAVFPGQYGIPRPWYFPFTKSYWC-----GEECKEYNQPHTVQKGSSEVCMEEEPSHLPLGVSIQNLVKIYRNGKKVAVDGLTLNFYEGQITSFLGHNGAGKTTTMSILTGLFPPTTGTAYIMKKDIRTELNSIRQNLGVCPQHNVLFDALTVEEHIWFYARLKGLSEEKVKAEMEQMVNDVGLPHKKKYKTSQLSGGMQRKLSVALAFVGGSKVVILDEPTAGVDPYSRRGIWELLIKYRQ-GRTIILSTHHMDEADILGDRIAIISHGKLCCVGSSLFLKNQLGTGYYLTLVKRDNDSSLSSCRNSSSTMSYLKKEDSVSQSSSDAGLGSDHESDTMTIDVSAISNLINKHVPEARLVEDIGHELTYVLPYEAAKEGAFVELFHEIDDRLSDLGISSYGIADTTLEEIFLKVADDTG---------------VDAETSDGTLPARRKRYAFGDHQSCLRPFTEDDAFDTNDSDMDPESRETDYLSGIDGKGSYQLKSWNLMRQQFTALLWKRLLYAKRSRKGFFAQIVLPAVFVLIALVFSLIVPPFGKYPSLELEPWMYDEQY------TFFSNDAPDDQGTQALLKALIDKPG-FGTACMEG--HSVMKVSC--SGEEEEWSTQFVSQSVMDLFLNGNWTMENPSPSCECSSDKRKKMLPIC-PPGAGGLPPFQRRQNTSDILQNLTGRNISDYLVKTYSQIIEKRYGGF-----SLGASNSPALPPNE---EVVASINHIKKRLELPQNGAANRFLDSFGAFMKGLDTKDNV-KVWFNNKGWHAVGAFLNVMNNAILRSKLREGEDPASYGITAFNHPLNLTKEQLSEVALMTTSVDVLVSICVIFAMSFVPASFVVFLIQERVSKAKHMQCISGVKPVIYWLANFVWDMCNYVVPATLVIIIFICFQQDSYVSSSNLPVLALLLLLYGWSITPLMYPASFIFKIPSTAYVVLTSVNLFIGINGSVATFVLELFT--NNKLSNINEILKSVLLIFPHFCLGRGLIDMVKNQAMADALERFGENRFVSPMSWDLVGRNLFAMAVEGVVFFAITLMIQY-------RFFIKPRPVNAKLPP---VVDEDEDVARERQRI--NEGGRNDILELKGLTKIY--------------------RMKRKPAVDRLCVGIPPGECFGLLGVNGAGKTTTFKMLTGDTDVTAGEAFLKNHSILRNIHEVHQNMGYCPQFDAINELLTGREHLELYALLRGVPEKEVCKVAEWAIRKLGLVKYSEKHAGNYSGGNKRKLSTAIALIGGPPVVFLDEPTTGMDPKARRFLWNCALSVIKEGR-SVVLTSHSMEECEALCTRMAIMVNGRFKCLGSVQHLKNRFGDGYTIIVRI---AGSNPDLKPVEEFFSHAFPGSV-LKEKHRSMLQYQLRSSQSSLARIFSILSKNKKRLHIEDYSVSQTTLDQVFVNFA 2208          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Xenopus
Match: ABCA1 (ATP binding cassette subfamily A member 1 [Source:NCBI gene;Acc:100491942])

HSP 1 Score: 1108.98 bits (2867), Expect = 0.000e+0
Identity = 691/1943 (35.56%), Postives = 1055/1943 (54.30%), Query Frame = 1
Query:  682 FHRQLLEMTAPIIFGKIYFTPDSEFTRQIIKKANITFEILDNLRLSAVEWRLNFRDWLSNQVNNSSTLD-------NMSNNAKVCMETSQNYYT---VCQLIYKSSDRNRIQN--------SIEIASRIFDLIERGLNCTELNKFQPMKSKVDIDNLAQNKLIN---IFAGVVFNESFQYLTLNNATVLNYQIRMPTNRIDSTKNFKVLDTFWNPIPRRDTIYDLKYYTSGFLFLQEAFDQAFIELVTGNVTINIGTSMQIMPYPCFVDDRFIKFLSMIMPFILIIAWTPSVTIIIKSIVYEKENRLKEFMLLMGLTNFVHWCSWFISTIVVLIFPVIFMTLILKYNEIIQFSSPGIIFILILSYVISFICQSFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENIAIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFE----------------IQSETCHNNKASESG-----------------TKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQITSEMLDTLTDGGNLPRPVSVLSF-------RKKTINTA-NINDPKVSFEFENNLVL----------LSGLSLIFQQISGLFIKRFHHTKRNIKGXXXXXXXXXXXXXXXXXXXXXXXXMDNQPSMTISPWLMMPKTRLVNLNTFYRKENTSDQISFKLNENYRSDIGQSGVRCMNTSLYQLENFKCLYPYNTNKWS----EKSPIEISL--------VTPECDCSTTGNQ----ICSSPLSGGPESSNRIMASSDRLYDLSSYNISDYLMKNFKTFIMK-----------QYGGLQFILPSFFGQSCQVIGESQIWFDFRQSINSSRDNNSNPEQV---KFLNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFSYLRYNIS---GGDENYNAFEWDITGNKICSL---GILFVGWCLIIVFMESKHKKTLCIKLKDV--KLKPYEIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFDSS-VKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFA 6177
             +R +     P++ GKI +TP +  T+ ++ + N TF+ L   R     W    R  + N + +S  +D       N  +   +  + +   +T   + + + K +     +N        ++    R+   + R + C  L+K +P+ ++  + + +  +L+N    +AG+VF +  +  T     V  Y+IRM  + ++ T   K+ D +W+P PR D   D++Y   GF +LQ+  +QA I + TG V    G  +Q MPYPC+VDD F++ +S  MP  + +AW  SV +IIK IVYEKE RLKE M +MGL N + W SWFIS+++ L+     + LILK   ++ +S P ++F+ +  + +  I Q F+IS  F  +N+AA  GGI+YF  YLP+++ + +QD +   +      L+ V+F         LE+   G Q+ NL  S + +  + +     M+  D++ Y ++ WY+EAVFPG+YG+P+PWYF FT+ YW       +  +  +     ++  +    E+EP  L +G+ I+NLVK +   K  A+D L L FY+ QIT FLGHNGAGKTTT+SILTG+  PT+GTA+I+  DIR ++  IR  +G+CPQHN+LF  LTVE+HI+FY  LKG+++ ++K ++  +V +VGL  K K  +  LSGGM+RKLS+A+AFVG S+++ LDEPTAGVDP+SRRGIW+L++KYR   RTIIL+THHMDEAD L DRIAIIS GKL C GSSLFLK   G GYYL L K                   ++ E   +  +S++G                 + +   I K +P ++L+++   + T VL + +     F  LF ++D  L  L I+SYG++DT+LEE+FLKVADD                 +D  T  G LP      +F       R  T + A + ND  +  E      L          L   +L+ QQ + L  KR  + KR+ KG F++++LP + +L+      I       PS+ + PW+   +       TF+  +   DQ +  L +      G  G  CM    + +    C       +WS     +S +++ L         +P C+CS+   +    IC  P +GG     R   +SD L +L+  NISDYL+K +   I K           +YGG      S    +   +  ++   +   SIN  +     P+     +FL+ F  F      K N+ ++W N+KG+ ++ A+ N+ +N +LRS +   +   +YGI   N+PL  T+  L         ++V ++I VIF +SF+PASFV+FLI+ERV+ +K  Q +SGV P +YW++NF WD   Y +   +VI+ F+ F   SY+ S N+    +LL LY  ++ P MYP SF     STA+VV+++ NL +G   ++ TF L+L+   +  L + N+ LK + LIFP + LGRG+ID+  +    +     G +   +   WD+ G  + ++   G++F    L+I +          IK + V  KL P   + DED DV +ER+RI  N    ND+L++ GLTKIY                      KRK AV+ +  G+  GECFGLLGVNGAGKTTTFKML G+ ++T G A +  +SI+ +  + H+NMG+CPQFDA++ LLT  E L  Y  +RG+   ++    + +++ L L  +  K     SGGNKRK+ TAIALIG P +VFLDEPT GMD  ARRFLW    ++  E + +V+LTSH+MEECE LC R+AIMV+G  K +GSVQHLK++FG  Y + +R+     S  D   +E   +     S  +KE++  +++Y+  SS   L+ IF +    +    +++YSVSQ +LD+VF+NFA
Sbjct:  371 LYRMIWRALKPLLVGKILYTPSTPATQMLMSEVNKTFQELSVFRDLGAMWE-EVRPQIKNFMESSQEMDLIRTLLTNKGSKTFLDQQLNSTGWTTENISRFLAKETADVETENGPFYSWREALNETDRVVLTLSRFMECVNLDKLEPVATEEMLIDKSM-ELLNERKFWAGIVFMDMPEEETELPHHV-KYKIRMDIDNVERTN--KIKDGYWDPGPRADPFEDMRYIWGGFSYLQDVVEQAIIRVQTG-VEKRTGIYVQQMPYPCYVDDIFLRVMSRSMPLFMTLAWIYSVAVIIKGIVYEKEARLKETMRIMGLDNGILWLSWFISSLIPLLMSAALLVLILKTGNLLPYSDPSVVFVFLSVFAVVTISQCFLISTIFSRANLAAACGGIIYFTLYLPYVLCVAWQDYVGYTLKIFASFLSPVAFGFGCEVFALLEEQGVGVQWDNLLESPLEENGYNITTSGFMMLFDTLLYGIMTWYIEAVFPGQYGIPRPWYFPFTKSYWC-----GEECKEYNQPHTVQKGSSEVCMEEEPSHLPLGVSIQNLVKIYRNGKKVAVDGLTLNFYEGQITSFLGHNGAGKTTTMSILTGLFPPTTGTAYIMKKDIRTELNSIRQNLGVCPQHNVLFDALTVEEHIWFYARLKGLSEEKVKAEMEQMVNDVGLPHKKKYKTSQLSGGMQRKLSVALAFVGGSKVVILDEPTAGVDPYSRRGIWELLIKYRQ-GRTIILSTHHMDEADILGDRIAIISHGKLCCVGSSLFLKNQLGTGYYLTLVKRDNDSSLSSCRNSSSTMSYLKKEDSVSQSSSDAGLGSDHESDTMTIGLTDVSAISNLINKHVPEARLVEDIGHELTYVLPYEAAKEGAFVELFHEIDDRLSDLGISSYGIADTTLEEIFLKVADDTG---------------VDAETSDGTLPARRKRYAFGDHQSCLRPFTEDDAFDTNDSDMDPESRETDYLSGIDGKGSYQLKSWNLMRQQFTALLWKRLLYAKRSRKGFFAQIVLPAVFVLIALVFSLIVPPFGKYPSLELEPWMYDEQY------TFFSNDAPDDQGTQALLKALIDKPG-FGTACMEG--HSVMKVSC--SGEEEEWSTQFVSQSVMDLFLNGNWTMENPSPSCECSSDKRKKMLPIC-PPGAGGLPPFQRRQNTSDILQNLTGRNISDYLVKTYSQIIEKSLKNKIWVNEFRYGGF-----SLGASNSPALPPNE---EVVASINHIKKRLELPQNGAANRFLDSFGAFMKGLDTKDNV-KVWFNNKGWHAVGAFLNVMNNAILRSKLREGEDPASYGITAFNHPLNLTKEQLSEVALMTTSVDVLVSICVIFAMSFVPASFVVFLIQERVSKAKHMQCISGVKPVIYWLANFVWDMCNYVVPATLVIIIFICFQQDSYVSSSNLPVLALLLLLYGWSITPLMYPASFIFKIPSTAYVVLTSVNLFIGINGSVATFVLELFT--NNKLSNINEILKSVLLIFPHFCLGRGLIDMVKNQAMADALERFGENRFVSPMSWDLVGRNLFAMAVEGVVFFAITLMIQY-------RFFIKPRPVNAKLPP---VVDEDEDVARERQRI--NEGGRNDILELKGLTKIY--------------------RMKRKPAVDRLCVGIPPGECFGLLGVNGAGKTTTFKMLTGDTDVTAGEAFLKNHSILRNIHEVHQNMGYCPQFDAINELLTGREHLELYALLRGVPEKEVCKVAEWAIRKLGLVKYSEKHAGNYSGGNKRKLSTAIALIGGPPVVFLDEPTTGMDPKARRFLWNCALSVIKEGR-SVVLTSHSMEECEALCTRMAIMVNGRFKCLGSVQHLKNRFGDGYTIIVRI---AGSNPDLKPVEEFFSHAFPGSV-LKEKHRSMLQYQLRSSQSSLARIFSILSKNKKRLHIEDYSVSQTTLDQVFVNFA 2226          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Xenopus
Match: klf9 (Kruppel-like factor 9 [Source:Xenbase;Acc:XB-GENE-483889])

HSP 1 Score: 1106.28 bits (2860), Expect = 0.000e+0
Identity = 695/2016 (34.47%), Postives = 1074/2016 (53.27%), Query Frame = 1
Query:  499 LINSGNSNNVSRGINKLTTMICGSDKNDAAILIFNLNLLQRSKRSI-----QTCQEVYEKY-LSVDYFHRQLLE-------------MTAPIIFGKIYFTPDSEFTRQIIKKANITFEILDNLRLSAVEWR---LNFRDWLSNQVNNSSTLDNMSNNAKVCMETSQ------NYYTVCQLIYKSSDRNRIQNSIEIASR-IFDLIERG-------LNCTELNKFQPMKSKVDIDN-----LAQNKLINIFAGVVFNESFQYLTLNNATVLNYQIRMPTNRIDSTKNFKVLDTFWNPIPRRDTIYDLKYYTSGFLFLQEAFDQAFIELVTGNVTINIGTSMQIMPYPCFVDDRFIKFLSMIMPFILIIAWTPSVTIIIKSIVYEKENRLKEFMLLMGLTNFVHWCSWFISTIVVLIFPVIFMTLILKYNEIIQFSSPGIIFILILSYVISFICQSFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENIAIDG---FEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFE----------IQSETCHNNKASESGTK--------------LLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKV----ADDPSQISHKRQEKQITSEMLDTLTDGGNLPRPVSVLSFRKKTINTANINDPKVSFEFENNLVLLSGLSLIFQQISGLFIKRFHHTKRNIKGXXXXXXXXXXXXXXXXXXXXXXXXMDNQPSMTISPWLMMPKTRLVNLNTFYRKENTSDQISFKLNENYRSDIGQSGVRCMN----TSLYQLEN------FKCLYPYNTN-----KWSEKSPIEISLVTPECDCSTTGNQI----CSSPLSGGPESSNRIMASSDRLYDLSSYNISDYLMKNFKTFIM-----------KQYGGLQF--ILPSFFGQSCQVIGESQIWFDFRQSINSSRDNNSNPEQVKFLNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFS------YLRYNISGGDENYNAFEWDITGNKICSL---GILFVGWCLIIVFMESKHKKTLCIKLKDVKLKPYEIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLS-DRNEIETIINKEIWSSARMKEENAVIIEYRFDSSVKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKNDSVTRNI 6204
            L+  G     ++ IN L+ + CG  +   A  +F+ N  + +   +      T +E Y  Y  +   F   L++                P++ GK+ ++PDS   R+I+KKAN TFE L+ +R     W        ++  + V  +   D + N       T Q          V   +Y  +   R +  +    R IF++ +         + C  L+KF+    +  + +     L +NK    +AG+VF + F + T    + + Y+IRM  + ++ TK  K+ D +W+P PR D + D++Y   GF +LQ+  D   I+  T +  +  G  +Q MPYPCFVDD F+  L+   P  +++AW  S+++++K IV EKE RLKE M  MG+TN V W + FI +  V+    I +T+++    ++ +S+P I+F  ++++ I+ I Q+F++SVFF  +N+AA   G++YF  YLP ++   +QD ++ ++      L+ V+F     ++   E+   G Q+ N+  S +    +     + M+ +D+  Y  +AWY++ VFPG+YG+PKPWYF F   YW  F                E     DG   FE EP  +  G+ I++LVK +  +  PA+D +N+ FY+ QIT FLGHNGAGKTTT+SI+TG+  PTSGT ++   DI+  M+ IR  +G+CPQHNILF +LTVE+HI FY  LKG ++ + + Q   +++++G+  K    ++NLSGGM+RKLS+A+AFVG S+++ LDEPT+GVDP+SRR IWDL++KYRS  RTIIL+THHMDEAD L DRIAI+SQGKL C GS LFLK  FG G+YL L +             + + T H+        K              L E I   +P +KL++    +   +L         + SLF +L+ +L  L ++S+G+SDT LEEV   +     ++     ++  +  + S+      D  +           K   N  NIND +           + G  L+ QQ + L IKRF H  R+ K  F++++LP   +LL      I       PS+T+ PW+   +        F+  E   ++     +  + +  G  G RCM     +  YQ  N         + P  TN     +W+  +P      +P C CS+    +    C    +GG     RI  SS+ + DL+  NISD+L+K +   I            ++YGG+     LP    +   ++        F   +    +  +           Q F  +   + N+ ++W N+KG+ SM  + N+ +N +LR+ + A K  + +GI   N+PL  T+  L         ++V +AI VIF +SFIPASFV++LI+ERV+ +K  Q+VSGV P +YW++NF WD I Y+ISV +V++ F+AF+ ++Y  S N+ A I LLF Y  AVIP MYP S+  +  STA+V +S  NL +G  ++  TF LDL++ ++ SL   N+ LK + LIFP + LGRG+IDL+ +      Y R+   G +   N F+W+  G  I ++   G+++    L+I     +H+        +    P  ++  ED DV +ER+R+ +     ND+L++  LTK Y                      K+  AV+ +  GV+ GECFGLLGVNGAGKTTTFKML G+  +T G+A + GYSI+ D    H+N G+CPQFDA+  LLT  E L  Y R+RG+   +I +  D  ++ L L  + +  T   SGGNKRK+ TAIALIG P +V LDEPT GMD  +RRFLW  I ++  E + AV+LTSH+MEECEVLC RLAIMV G  K +G++QHLK KFG  Y V +++  ++  L+ D   +E  I      S + +E++  +++Y+  SS  L+ +F++    + +  ++EYSVSQ +LD+VF+NFAK  +   +I
Sbjct:  303 LVQDGGPTTFTQLINSLSDLFCGYPEGGGA-RVFSFNWYEDNNYKVFLGVNSTKKETYYLYDKTTTPFCNALIQSMESNPATKIAWSAMKPLLMGKVLYSPDSPAVREILKKANSTFEQLERVRQMGKAWEEVGPQLWNFFHSSVQMNLVRDTIKNPTVKEFLTRQLGDEGLTADDVINFLYNGNQDERPEGQVNYDWRNIFNITDHAIRLFNQYMGCLTLDKFEGHDDESHLTHHALYLLEENKF---WAGLVFLDMFPW-TNTLPSHVKYKIRMDIDAVEKTK--KIKDRYWDPGPRADPVEDMRYIWGGFAYLQDMIDHGIIKSQT-STEVPAGIYLQQMPYPCFVDDVFMITLNRCFPIFMVLAWIYSISMLVKDIVLEKELRLKETMKNMGVTNDVIWLTRFIDSFTVMTTSTILLTVVIVVGGVLHYSNPIILFCFLMAFTIATIMQAFLMSVFFSKANLAAACSGVIYFTLYLPHILCFAWQDRMTIKLKTLASFLSPVAFGFGTEYLSRYEEQGLGLQWGNIRKSPMEGDEYSFLFSIFMMLLDAFIYWTLAWYIDHVFPGEYGIPKPWYFPFLATYWCKF----------------EHEFGGDGNPFFEPEPPGMVPGVYIQDLVKVYENTYKPAVDRMNITFYEGQITAFLGHNGAGKTTTLSIITGLFPPTSGTVWVRGRDIQTHMDSIRQSLGMCPQHNILFRHLTVEEHILFYAQLKGKSRKQAERQAEVMLEDMGIPHKRNDEAQNLSGGMQRKLSVALAFVGESKVVVLDEPTSGVDPYSRRSIWDLLLKYRS-GRTIILSTHHMDEADLLGDRIAIVSQGKLFCSGSPLFLKNCFGTGFYLTLVRRMRNIKDTGKKDSVSNITSHSISVCTPKVKENLLEQELDGDVSGLTELIHHHVPEAKLLESIGQELIYLLPSKDFKFRAYASLFRELEETLGDLGLSSFGISDTPLEEVVYHIPVNSGNNIGPCMYRNSQLHLASQESSIRKDSHHC----------KAEKNPPNINDREADGRGSRQ---IKGTELLQQQFNALIIKRFKHATRSHKDFFAQIVLPASFVLLALVFTLIVPPFGEYPSLTLHPWIYGQQF------VFFSNEQPGNEQMATFSNAFLNSPGL-GTRCMKDQPLSKKYQCTNTSNEWTMPAVSPSVTNMLLSQEWTRDNP------SPSCTCSSRSKLMMLPECPEG-AGGRPPPQRIQPSSEIIQDLTERNISDFLLKTYPDLIRSSMKSKYWVNEQRYGGISVGGKLPVLHVKGGDIV-------SFFSQVGQMTNVTAGTTTKAISQELQTFLQNLETEDNI-KVWFNNKGWHSMVIFINVANNAILRANLGADKDPEEFGITTMNHPLNLTKDQLSEVTVLTTSVDVVVAICVIFAMSFIPASFVLYLIQERVSNAKHLQFVSGVTPAIYWLTNFAWDIINYAISVAMVVIIFIAFDKKAYTSSSNLPALIALLFFYGWAVIPMMYPASYLFNVPSTAYVALSCINLFIGINSSAITFILDLFE-NNRSLLKFNEKLKDLLLIFPHFCLGRGLIDLAMNQAVTDVYARF---GEEHVSNPFQWEFLGRNIFAMAVEGVVYFTLNLLI-----QHRFFFSTWFSE---PPKGLVEGEDEDVAQERQRV-IKGGGKNDILKLKELTKTY--------------------PGKQSPAVDRLCVGVRPGECFGLLGVNGAGKTTTFKMLTGDIQVTSGDASVAGYSILQDIADVHQNTGYCPQFDAIDDLLTGREHLQLYGRLRGVPEDEIDMVADWGIEKLGLGKYADNLTGTYSGGNKRKLSTAIALIGCPPVVLLDEPTTGMDPQSRRFLWNSIVSIIKEGR-AVVLTSHSMEECEVLCTRLAIMVKGTFKCLGTIQHLKYKFGDGYIVTMKVRASKPGLAPDPGPVEKFIQTNFPGSVQ-REKHYNMLQYQLSSS-SLARVFQLLISNKDSLNIEEYSVSQTTLDQVFVNFAKQQTEDEDI 2222          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Xenopus
Match: ABCA1 (ATP binding cassette subfamily A member 1 [Source:NCBI gene;Acc:100491942])

HSP 1 Score: 1103.97 bits (2854), Expect = 0.000e+0
Identity = 679/1920 (35.36%), Postives = 1040/1920 (54.17%), Query Frame = 1
Query:  682 FHRQLLEMTAPIIFGKIYFTPDSEFTRQIIKKANITFEILDNLRLSAVEWRLNFRDWLSNQVNNSSTLD-------NMSNNAKVCMETSQNYYT---VCQLIYKSSDRNRIQN--------SIEIASRIFDLIERGLNCTELNKFQPMKSKVDIDNLAQNKLIN---IFAGVVFNESFQYLTLNNATVLNYQIRMPTNRIDSTKNFKVLDTFWNPIPRRDTIYDLKYYTSGFLFLQEAFDQAFIELVTGNVTINIGTSMQIMPYPCFVDDRFIKFLSMIMPFILIIAWTPSVTIIIKSIVYEKENRLKEFMLLMGLTNFVHWCSWFISTIVVLIFPVIFMTLILKYNEIIQFSSPGIIFILILSYVISFICQSFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENIAIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFE----------------IQSETCHNNKASESG--------------TKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQITSEMLDTLTDGGNLPRPVSVLSF-------RKKTINTA-NINDPKVSFEFENNLVL----------LSGLSLIFQQISGLFIKRFHHTKRNIKGXXXXXXXXXXXXXXXXXXXXXXXXMDNQPSMTISPWLMMPKTRLVNLNTFYRKENTSDQISFKLNENYRSDIGQSGVRCMNTSLYQLENFKCLYPYNT-------NKWSEKSPIEISLVTPECDCSTTGNQ----ICSSPLSGGPESSNRIMASSDRLYDLSSYNISDYLMKNFKTFIMKQYGGLQF------ILPSFFGQSCQVIGESQIWFDFRQSINSSRDNNSNPEQVKFLNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFSYLRYNIS---GGDENYNAFEWDITGNKICSL---GILFVGWCLIIVFMESKHKKTLCIKLKDVKLKPYEIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFDSS-VKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEV 6162
             +R +     P++ GKI +TP +  T+ ++ + N TF+ L   R     W    R  + N + +S  +D       N  +   +  + +   +T   + + + K +     +N        ++    R+   + R + C  L+K +P+ ++  + + +  +L+N    +AG+VF +  +  T     V  Y+IRM  + ++ T   K+ D +W+P PR D   D++Y   GF +LQ+  +QA I + TG V    G  +Q MPYPC+VDD F++ +S  MP  + +AW  SV +IIK IVYEKE RLKE M +MGL N + W SWFIS+++ L+     + LILK   ++ +S P ++F+ +  + +  I Q F+IS  F  +N+AA  GGI+YF  YLP+++ + +QD +   +      L+ V+F         LE+   G Q+ NL  S + +  + +     M+  D++ Y ++ WY+EAVFPG+YG+P+PWYF FT+ YW       +  +  +     ++  +    E+EP  L +G+ I+NLVK +   K  A+D L L FY+ QIT FLGHNGAGKTTT+SILTG+  PT+GTA+I+  DIR ++  IR  +G+CPQHN+LF  LTVE+HI+FY  LKG+++ ++K ++  +V +VGL  K K  +  LSGGM+RKLS+A+AFVG S+++ LDEPTAGVDP+SRRGIW+L++KYR   RTIIL+THHMDEAD L DRIAIIS GKL C GSSLFLK   G GYYL L K                   ++ E   +  +S++G              + +   I K +P ++L+++   + T VL + +     F  LF ++D  L  L I+SYG++DT+LEE+FLKVADD                 +D  T  G LP      +F       R  T + A + ND  +  E      L          L   +L+ QQ + L  KR  + KR+ KG F++++LP + +L+      I       PS+ + PW+   +       TF+  +   DQ +  L    ++ I + G     +   + E +   +   +         W+ ++P      +P C+CS+   +    IC  P +GG     R   +SD L +L+  NISDYL+K +   I K+YGG          LPS  G                                K L  F  F      K N+ ++W N+KG+ ++ A+ N+ +N +LRS +   +   +YGI   N+PL  T+  L         ++V ++I VIF +SF+PASFV+FLI+ERV+ +K  Q +SGV P +YW++NF WD   Y +   +VI+ F+ F   SY+ S N+    +LL LY  ++ P MYP SF     STA+VV+++ NL +G   ++ TF L+L+   +  L + N+ LK + LIFP + LGRG+ID+  +    +     G +   +   WD+ G  + ++   G++F    L+I     +++  +  +  + KL P   + DED DV +ER+RI  N    ND+L++ GLTKIY                      KRK AV+ +  G+  GECFGLLGVNGAGKTTTFKML G+ ++T G A +  +SI+ +  + H+NMG+CPQFDA++ LLT  E L  Y  +RG+   ++    + +++ L L  +  K     SGGNKRK+ TAIALIG P +VFLDEPT GMD  ARRFLW    ++  E + +V+LTSH+MEECE LC R+AIMV+G  K +GSVQHLK++FG  Y + +R+     S  D   +E   +     S  +KE++  +++Y+  SS   L+ IF +    +    +++YSVSQ +LD+V
Sbjct:  334 LYRMIWRALKPLLVGKILYTPSTPATQMLMSEVNKTFQELSVFRDLGAMWE-EVRPQIKNFMESSQEMDLIRTLLTNKGSKTFLDQQLNSTGWTTENISRFLAKETADVETENGPFYSWREALNETDRVVLTLSRFMECVNLDKLEPVATEEMLIDKSM-ELLNERKFWAGIVFMDMPEEETELPHHV-KYKIRMDIDNVERTN--KIKDGYWDPGPRADPFEDMRYIWGGFSYLQDVVEQAIIRVQTG-VEKRTGIYVQQMPYPCYVDDIFLRVMSRSMPLFMTLAWIYSVAVIIKGIVYEKEARLKETMRIMGLDNGILWLSWFISSLIPLLMSAALLVLILKTGNLLPYSDPSVVFVFLSVFAVVTISQCFLISTIFSRANLAAACGGIIYFTLYLPYVLCVAWQDYVGYTLKIFASFLSPVAFGFGCEVFALLEEQGVGVQWDNLLESPLEENGYNITTSGFMMLFDTLLYGIMTWYIEAVFPGQYGIPRPWYFPFTKSYWC-----GEECKEYNQPHTVQKGSSEVCMEEEPSHLPLGVSIQNLVKIYRNGKKVAVDGLTLNFYEGQITSFLGHNGAGKTTTMSILTGLFPPTTGTAYIMKKDIRTELNSIRQNLGVCPQHNVLFDALTVEEHIWFYARLKGLSEEKVKAEMEQMVNDVGLPHKKKYKTSQLSGGMQRKLSVALAFVGGSKVVILDEPTAGVDPYSRRGIWELLIKYRQ-GRTIILSTHHMDEADILGDRIAIISHGKLCCVGSSLFLKNQLGTGYYLTLVKRDNDSSLSSCRNSSSTMSYLKKEDSVSQSSSDAGLGSDHESDTMTIDVSAISNLINKHVPEARLVEDIGHELTYVLPYEAAKEGAFVELFHEIDDRLSDLGISSYGIADTTLEEIFLKVADDTG---------------VDAETSDGTLPARRKRYAFGDHQSCLRPFTEDDAFDTNDSDMDPESRETDYLSGIDGKGSYQLKSWNLMRQQFTALLWKRLLYAKRSRKGFFAQIVLPAVFVLIALVFSLIVPPFGKYPSLELEPWMYDEQY------TFFSNDAPDDQGTQAL---LKALIDKPGFGTAFSCSGEEEEWSTQFVSQSVMDLFLNGNWTMENP------SPSCECSSDKRKKMLPICP-PGAGGLPPFQRRQNTSDILQNLTGRNISDYLVKTYSQIIEKRYGGFSLGASNSPALPSVVG--------------------------------KLLKIFGAFMKGLDTKDNV-KVWFNNKGWHAVGAFLNVMNNAILRSKLREGEDPASYGITAFNHPLNLTKEQLSEVALMTTSVDVLVSICVIFAMSFVPASFVVFLIQERVSKAKHMQCISGVKPVIYWLANFVWDMCNYVVPATLVIIIFICFQQDSYVSSSNLPVLALLLLLYGWSITPLMYPASFIFKIPSTAYVVLTSVNLFIGINGSVATFVLELFT--NNKLSNINEILKSVLLIFPHFCLGRGLIDMVKNQAMADALERFGENRFVSPMSWDLVGRNLFAMAVEGVVFFAITLMI-----QYRFFIKPRPVNAKLPP---VVDEDEDVARERQRI--NEGGRNDILELKGLTKIY--------------------RMKRKPAVDRLCVGIPPGECFGLLGVNGAGKTTTFKMLTGDTDVTAGEAFLKNHSILRNIHEVHQNMGYCPQFDAINELLTGREHLELYALLRGVPEKEVCKVAEWAIRKLGLVKYSEKHAGNYSGGNKRKLSTAIALIGGPPVVFLDEPTTGMDPKARRFLWNCALSVIKEGR-SVVLTSHSMEECEALCTRMAIMVNGRFKCLGSVQHLKNRFGDGYTIIVRI---AGSNPDLKPVEEFFSHAFPGSV-LKEKHRSMLQYQLRSSQSSLARIFSILSKNKKRLHIEDYSVSQTTLDQV 2140          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Xenopus
Match: klf9 (Kruppel-like factor 9 [Source:Xenbase;Acc:XB-GENE-483889])

HSP 1 Score: 1101.27 bits (2847), Expect = 0.000e+0
Identity = 694/2016 (34.42%), Postives = 1073/2016 (53.22%), Query Frame = 1
Query:  499 LINSGNSNNVSRGINKLTTMICGSDKNDAAILIFNLNLLQRSKRSI-----QTCQEVYEKY-LSVDYFHRQLLE-------------MTAPIIFGKIYFTPDSEFTRQIIKKANITFEILDNLRLSAVEWR---LNFRDWLSNQVNNSSTLDNMSNNAKVCMETSQ------NYYTVCQLIYKSSDRNRIQNSIEIASR-IFDLIERG-------LNCTELNKFQPMKSKVDIDN-----LAQNKLINIFAGVVFNESFQYLTLNNATVLNYQIRMPTNRIDSTKNFKVLDTFWNPIPRRDTIYDLKYYTSGFLFLQEAFDQAFIELVTGNVTINIGTSMQIMPYPCFVDDRFIKFLSMIMPFILIIAWTPSVTIIIKSIVYEKENRLKEFMLLMGLTNFVHWCSWFISTIVVLIFPVIFMTLILKYNEIIQFSSPGIIFILILSYVISFICQSFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENIAIDG---FEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASE-----------------SGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQITSEMLDTLTDGGNLPRPVSVLSFRKKTINTANI--------NDPKVSFEFENN---LVLLSGLSLIFQQISGLFIKRFHHTKRNIKGXXXXXXXXXXXXXXXXXXXXXXXXMDNQPSMTISPWLMMPKTRLVNLNTFYRKENTSDQISFKLNENYRSDIGQSGVRCMN----TSLYQLEN------FKCLYPYNTN-----KWSEKSPIEISLVTPECDCSTTGNQI----CSSPLSGGPESSNRIMASSDRLYDLSSYNISDYLMKNFKTFIM-----------KQYGGLQF--ILPSFFGQSCQVIGESQIWFDFRQSINSSRDNNSNPEQVKFLNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFS------YLRYNISGGDENYNAFEWDITGNKICSL---GILFVGWCLIIVFMESKHKKTLCIKLKDVKLKPYEIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLS-DRNEIETIINKEIWSSARMKEENAVIIEYRFDSSVKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKNDSVTRNI 6204
            L+  G     ++ IN L+ + CG  +   A  +F+ N  + +   +      T +E Y  Y  +   F   L++                P++ GK+ ++PDS   R+I+KKAN TFE L+ +R     W        ++  + V  +   D + N       T Q          V   +Y  +   R +  +    R IF++ +         + C  L+KF+    +  + +     L +NK    +AG+VF + F + T    + + Y+IRM  + ++ TK  K+ D +W+P PR D + D++Y   GF +LQ+  D   I+  T +  +  G  +Q MPYPCFVDD F+  L+   P  +++AW  S+++++K IV EKE RLKE M  MG+TN V W + FI +  V+    I +T+++    ++ +S+P I+F  ++++ I+ I Q+F++SVFF  +N+AA   G++YF  YLP ++   +QD ++ ++      L+ V+F     ++   E+   G Q+ N+  S +    +     + M+ +D+  Y  +AWY++ VFPG+YG+PKPWYF F   YW  F                E     DG   FE EP  +  G+ I++LVK +  +  PA+D +N+ FY+ QIT FLGHNGAGKTTT+SI+TG+  PTSGT ++   DI+  M+ IR  +G+CPQHNILF +LTVE+HI FY  LKG ++ + + Q   +++++G+  K    ++NLSGGM+RKLS+A+AFVG S+++ LDEPT+GVDP+SRR IWDL++KYRS  RTIIL+THHMDEAD L DRIAI+SQGKL C GS LFLK  FG G+YL L +      +T   +  S                    + L E I   +P +KL++    +   +L         + SLF +L+ +L  L ++S+G+SDT LEEV   +                       +  G N    +    +R   ++ A+I        + P+    FE +      + G  L+ QQ + L IKRF H  R+ K  F++++LP   +LL      I       PS+T+ PW+   +        F+  E   ++     +  + +  G  G RCM     +  YQ  N         + P  TN     +W+  +P      +P C CS+    +    C    +GG     RI  SS+ + DL+  NISD+L+K +   I            ++YGG+     LP    +   ++        F   +    +  +           Q F  +   + N+ ++W N+KG+ SM  + N+ +N +LR+ + A K  + +GI   N+PL  T+  L         ++V +AI VIF +SFIPASFV++LI+ERV+ +K  Q+VSGV P +YW++NF WD I Y+ISV +V++ F+AF+ ++Y  S N+ A I LLF Y  AVIP MYP S+  +  STA+V +S  NL +G  ++  TF LDL++ ++ SL   N+ LK + LIFP + LGRG+IDL+ +      Y R+   G +   N F+W+  G  I ++   G+++    L+I     +H+        +    P  ++  ED DV +ER+R+ +     ND+L++  LTK Y                      K+  AV+ +  GV+ GECFGLLGVNGAGKTTTFKML G+  +T G+A + GYSI+ D    H+N G+CPQFDA+  LLT  E L  Y R+RG+   +I +  D  ++ L L  + +  T   SGGNKRK+ TAIALIG P +V LDEPT GMD  +RRFLW  I ++  E + AV+LTSH+MEECEVLC RLAIMV G  K +G++QHLK KFG  Y V +++  ++  L+ D   +E  I      S + +E++  +++Y+  SS  L+ +F++    + +  ++EYSVSQ +LD+VF+NFAK  +   +I
Sbjct:  284 LVQDGGPTTFTQLINSLSDLFCGYPEGGGA-RVFSFNWYEDNNYKVFLGVNSTKKETYYLYDKTTTPFCNALIQSMESNPATKIAWSAMKPLLMGKVLYSPDSPAVREILKKANSTFEQLERVRQMGKAWEEVGPQLWNFFHSSVQMNLVRDTIKNPTVKEFLTRQLGDEGLTADDVINFLYNGNQDERPEGQVNYDWRNIFNITDHAIRLFNQYMGCLTLDKFEGHDDESHLTHHALYLLEENKF---WAGLVFLDMFPW-TNTLPSHVKYKIRMDIDAVEKTK--KIKDRYWDPGPRADPVEDMRYIWGGFAYLQDMIDHGIIKSQT-STEVPAGIYLQQMPYPCFVDDVFMITLNRCFPIFMVLAWIYSISMLVKDIVLEKELRLKETMKNMGVTNDVIWLTRFIDSFTVMTTSTILLTVVIVVGGVLHYSNPIILFCFLMAFTIATIMQAFLMSVFFSKANLAAACSGVIYFTLYLPHILCFAWQDRMTIKLKTLASFLSPVAFGFGTEYLSRYEEQGLGLQWGNIRKSPMEGDEYSFLFSIFMMLLDAFIYWTLAWYIDHVFPGEYGIPKPWYFPFLATYWCKF----------------EHEFGGDGNPFFEPEPPGMVPGVYIQDLVKVYENTYKPAVDRMNITFYEGQITAFLGHNGAGKTTTLSIITGLFPPTSGTVWVRGRDIQTHMDSIRQSLGMCPQHNILFRHLTVEEHILFYAQLKGKSRKQAERQAEVMLEDMGIPHKRNDEAQNLSGGMQRKLSVALAFVGESKVVVLDEPTSGVDPYSRRSIWDLLLKYRS-GRTIILSTHHMDEADLLGDRIAIVSQGKLFCSGSPLFLKNCFGTGFYLTLVRRMRNIKDTGKKDSVSNITSHSISENLLEQELDGDVSGLTELIHHHVPEAKLLESIGQELIYLLPSKDFKFRAYASLFRELEETLGDLGLSSFGISDTPLEEVVYHIP----------------------VNSGNN----IGPCMYRNSQLHLASIIMSGVFLLDFPESYSRFEADGRGSRQIKGTELLQQQFNALIIKRFKHATRSHKDFFAQIVLPASFVLLALVFTLIVPPFGEYPSLTLHPWIYGQQF------VFFSNEQPGNEQMATFSNAFLNSPGL-GTRCMKDQPLSKKYQCTNTSNEWTMPAVSPSVTNMLLSQEWTRDNP------SPSCTCSSRSKLMMLPECPEG-AGGRPPPQRIQPSSEIIQDLTERNISDFLLKTYPDLIRSSMKSKYWVNEQRYGGISVGGKLPVLHVKGGDIV-------SFFSQVGQMTNVTAGTTTKAISQELQTFLQNLETEDNI-KVWFNNKGWHSMVIFINVANNAILRANLGADKDPEEFGITTMNHPLNLTKDQLSEVTVLTTSVDVVVAICVIFAMSFIPASFVLYLIQERVSNAKHLQFVSGVTPAIYWLTNFAWDIINYAISVAMVVIIFIAFDKKAYTSSSNLPALIALLFFYGWAVIPMMYPASYLFNVPSTAYVALSCINLFIGINSSAITFILDLFE-NNRSLLKFNEKLKDLLLIFPHFCLGRGLIDLAMNQAVTDVYARF---GEEHVSNPFQWEFLGRNIFAMAVEGVVYFTLNLLI-----QHRFFFSTWFSE---PPKGLVEGEDEDVAQERQRV-IKGGGKNDILKLKELTKTY--------------------PGKQSPAVDRLCVGVRPGECFGLLGVNGAGKTTTFKMLTGDIQVTSGDASVAGYSILQDIADVHQNTGYCPQFDAIDDLLTGREHLQLYGRLRGVPEDEIDMVADWGIEKLGLGKYADNLTGTYSGGNKRKLSTAIALIGCPPVVLLDEPTTGMDPQSRRFLWNSIVSIIKEGR-AVVLTSHSMEECEVLCTRLAIMVKGTFKCLGTIQHLKYKFGDGYIVTMKVRASKPGLAPDPGPVEKFIQTNFPGSVQ-REKHYNMLQYQLSSS-SLARVFQLLISNKDSLNIEEYSVSQTTLDQVFVNFAKQQTEDEDI 2190          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Mouse
Match: Abca1 (ATP-binding cassette, sub-family A (ABC1), member 1 [Source:MGI Symbol;Acc:MGI:99607])

HSP 1 Score: 1105.12 bits (2857), Expect = 0.000e+0
Identity = 690/1951 (35.37%), Postives = 1060/1951 (54.33%), Query Frame = 1
Query:  661 KYLSVDYFHRQLLEMTAPIIFGKIYFTPDSEFTRQIIKKANITFEILDNLR-LSAVEWRLNFRDWL----SNQVNNSSTLDNMSNNAKVCMETSQNYYTVCQ-----LIYKSSDRNRIQNSIEIASRIFD-------LIERGLNCTELNKFQPMKSKVDIDNLAQNKL--INIFAGVVFNESFQYLTLNNATV---LNYQIRMPTNRIDSTKNFKVLDTFWNPIPRRDTIYDLKYYTSGFLFLQEAFDQAFIELVTGNVTINIGTSMQIMPYPCFVDDRFIKFLSMIMPFILIIAWTPSVTIIIKSIVYEKENRLKEFMLLMGLTNFVHWCSWFISTIVVLIFPVIFMTLILKYNEIIQFSSPGIIFILILSYVISFICQSFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENIAIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGL-SKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFL-EKSFE---------------IQSETCHNNKASESG--------------TKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQITSEMLDTLTDGGNLPRPVSVLSFRKKTI--------NTANINDPKVSFEFENNLVL----------LSGLSLIFQQISGLFIKRFHHTKRNIKGXXXXXXXXXXXXXXXXXXXXXXXXMDNQPSMTISPWLMMPKTRLVNLNTFYRKENTSDQISFKLNENYRSDIGQSGVRCM------NTSLYQLENFKCLYP--------YNTNKWSEKSPIEISLVTPECDCSTTGNQ----ICSSPLSGGPESSNRIMASSDRLYDLSSYNISDYLMKNFKTFIMK-----------QYGGLQFILPSFFGQSCQVIGESQIWFD----FRQSINSSRDNNSNPEQVKFLNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFSYLRYNIS---GGDENYNAFEWDITGNKICSLGILFVGWCLIIVFMESKHKKTLCIKLKDVKLKPYEIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFDSSV-KLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKNDS 6189
            K L      R + +   P++ GKI +TPD+  TRQ++ + N TF+ L     L  +   L+ + W     S +++   TL +   N +   +         Q     L     D      S+      F+        I R + C  LNK +P+ ++V + N +   L     +AG+VF      +T ++  +   + Y+IRM  + ++ T   K+ D +W+P PR D   D++Y   GF +LQ+  +QA I ++TG+     G  +Q MPYPC+VDD F++ +S  MP  + +AW  SV +IIKSIVYEKE RLKE M +MGL N + W SWF+S+++ L+     + +ILK   ++ +S P ++F+ +  + +  I Q F+IS  F  +N+AA  GGI+YF  YLP+++ + +QD +   +     LL+ V+F     +    E+   G Q+ NLF S + +  F +   + M+  D+  Y ++ WY+EAVFPG+YG+P+PWYF  T+ YW       + I+   +    ++ ++    E+EP  L +G+ I+NLVK +      A+D L L FY+ QIT FLGHNGAGKTTT+SILTG+  PTSGTA+IL  DIR +M  IR  +G+CPQHN+LF  LTVE+HI+FY  LKG+++  +K ++  +  +VGL   KLK  +  LSGGM+RKLS+A+AFVG S+++ LDEPTAGVDP+SRRGIW+L++KYR   RTIIL+THHMDEAD L DRIAIIS GKL C GSSLFLK   G GYYL L +K  E               ++ E   +  +S++G              + +   I+K +  ++L+++   + T VL + +     F  LF ++D  L  L I+SYG+S+T+LEE+FLKVA++                 +D  T  G LP   +  +F  K          +  + ND  +  E     +L          L G  L  QQ   L  KR    +R+ KG F++++LP + + +      I       PS+ + PW+   +       TF   +   D  + +L      D G  G RCM      +T     E    + P        +    W+ K+P      +P C CS+   +    +C    +GG     R   ++D L +L+  NISDYL+K +   I K           +YGG      S    + Q +  S    D     ++ +  ++D++++    +FL+    F      K N+ ++W N+KG+ ++ ++ N+ +N +LR+ +   +    YGI   N+PL  T+  L         ++V ++I VIF +SF+PASFV+FLI+ERV+ +K  Q++SGV P +YW+SNF WD   Y +   +VI+ F+ F  +SY+ S N+    +LL LY  ++ P MYP SF     STA+VV+++ NL +G   ++ TF L+L+   +  L   ND LK +FLIFP + LGRG+ID+  +    +     G +   +   WD+ G  + ++ +  V + LI V ++ +      I+ + VK K    + DED DV +ER+RI L+    ND+L++  LTKIY                      KRK AV+ I  G+  GECFGLLGVNGAGK+TTFKML G+  +T G+A +N  SI+ +  + H+NMG+CPQFDA+  LLT  E + F+  +RG+   ++    + +++ L L  +  K     SGGNKRK+ TA+ALIG P +VFLDEPT GMD  ARRFLW    ++  E + +V+LTSH+MEECE LC R+AIMV+G  + +GSVQHLK++FG  Y + +R+  +   L    E   +     +  + +KE++  +++Y+  SS+  L+ IF +    +    +++YSVSQ +LD+VF+NFAK+ S
Sbjct:  360 KNLESSPLSRIIWKALKPLLVGKILYTPDTPATRQVMAEVNKTFQELAVFHDLEGMWEELSPQIWTFMENSQEMDLVRTLLDSRGNDQFWEQKLDGLDWTAQDIMAFLAKNPEDVQSPNGSVYTWREAFNETNQAIQTISRFMECVNLNKLEPIPTEVRLINKSMELLDERKFWAGIVFTG----ITPDSVELPHHVKYKIRMDIDNVERTN--KIKDGYWDPGPRADPFEDMRYVWGGFAYLQDVVEQAIIRVLTGSEK-KTGVYVQQMPYPCYVDDIFLRVMSRSMPLFMTLAWIYSVAVIIKSIVYEKEARLKETMRIMGLDNGILWFSWFVSSLIPLLVSAGLLVVILKLGNLLPYSDPSVVFVFLSVFAMVTILQCFLISTLFSRANLAAACGGIIYFTLYLPYVLCVAWQDYVGFSIKIFASLLSPVAFGFGCEYFALFEEQGIGVQWDNLFESPVEEDGFNLTTAVSMMLFDTFLYGVMTWYIEAVFPGQYGIPRPWYFPCTKSYWF-----GEEIDEKSHPGSSQKGVSEICMEEEPTHLRLGVSIQNLVKVYRDGMKVAVDGLALNFYEGQITSFLGHNGAGKTTTMSILTGLFPPTSGTAYILGKDIRSEMSSIRQNLGVCPQHNVLFDMLTVEEHIWFYARLKGLSEKHVKAEMEQMALDVGLPPSKLKSKTSQLSGGMQRKLSVALAFVGGSKVVILDEPTAGVDPYSRRGIWELLLKYRQ-GRTIILSTHHMDEADILGDRIAIISHGKLCCVGSSLFLKNQLGTGYYLTLVKKDVESSLSSCRNSSSTVSCLKKEDSVSQSSSDAGLGSDHESDTLTIDVSAISNLIRKHVSEARLVEDIGHELTYVLPYEAAKEGAFVELFHEIDDRLSDLGISSYGISETTLEEIFLKVAEESG---------------VDAETSDGTLPARRNRRAFGDKQSCLHPFTEDDAVDPNDSDIDPESRETDLLSGMDGKGSYQLKGWKLTQQQFVALLWKRLLIARRSRKGFFAQIVLPAVFVCIALVFSLIVPPFGKYPSLELQPWMYNEQY------TFVSNDAPEDMGTQELLNALTKDPG-FGTRCMEGNPIPDTPCLAGEEDWTISPVPQSIVDLFQNGNWTMKNP------SPACQCSSDKIKKMLPVCPP-GAGGLPPPQRKQKTADILQNLTGRNISDYLVKTYVQIIAKSLKNKIWVNEFRYGGF-----SLGVSNSQALPPSHEVNDAIKQMKKLLKLTKDSSAD----RFLSSLGRFMAGLDTKNNV-KVWFNNKGWHAISSFLNVINNAILRANLQKGENPSQYGITAFNHPLNLTKQQLSEVALMTTSVDVLVSICVIFAMSFVPASFVVFLIQERVSKAKHLQFISGVKPVIYWLSNFVWDMCNYVVPATLVIIIFICFQQKSYVSSTNLPVLALLLLLYGWSITPLMYPASFVFKIPSTAYVVLTSVNLFIGINGSVATFVLELFT--NNKLNDINDILKSVFLIFPHFCLGRGLIDMVKNQAMADALERFGENRFVSPLSWDLVGRNLFAMAVEGVVFFLITVLIQYR----FFIRPRPVKAK-LPPLNDEDEDVRRERQRI-LDGGGQNDILEIKELTKIY--------------------RRKRKPAVDRICIGIPPGECFGLLGVNGAGKSTTFKMLTGDTPVTRGDAFLNKNSILSNIHEVHQNMGYCPQFDAITELLTGREHVEFFALLRGVPEKEVGKVGEWAIRKLGLVKYGEKYASNYSGGNKRKLSTAMALIGGPPVVFLDEPTTGMDPKARRFLWNCALSIVKEGR-SVVLTSHSMEECEALCTRMAIMVNGRFRCLGSVQHLKNRFGDGYTIVVRIAGSNPDLKPVQEFFGL----AFPGSVLKEKHRNMLQYQLPSSLSSLARIFSILSQSKKRLHIEDYSVSQTTLDQVFVNFAKDQS 2225          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Mouse
Match: Abca4 (ATP-binding cassette, sub-family A (ABC1), member 4 [Source:MGI Symbol;Acc:MGI:109424])

HSP 1 Score: 1082.4 bits (2798), Expect = 0.000e+0
Identity = 684/2033 (33.64%), Postives = 1091/2033 (53.66%), Query Frame = 1
Query:  475 DYVVESIDLINSGNSNNVSRGINKLTTMICGSDKNDAAILIFNLNLLQRS--------------------KRSIQTCQEVYEKYLSVDYFHRQLLEMTAPIIFGKIYFTPDSEFTRQIIKKANITFEILDNLRLSAVEWR-LNFRDWL----SNQVN------NSSTLDNMSN----NAKVCMETSQNYYTVCQLIYKSSDRNRI--QNSIEIASRIFDLIERGLNCTELNKFQPMKSKVDIDNLAQNKLIN--IFAGVVFNESFQYLTLNNATVLNYQIRMPTNRIDSTKNFKVLDTFWNPIPRRDTIYDLKYYTSGFLFLQEAFDQAFIELVTGNVTINIGTSMQIMPYPCFVDDRFIKFLSMIMPFILIIAWTPSVTIIIKSIVYEKENRLKEFMLLMGLTNFVHWCSWFISTIVVLIFPVIFMTLILKYNEIIQFSSPGIIFILILSYVISFICQSFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIP----FSKNNDNIEISDNFRQREENIA-IDG-----FEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFE-IQSE--------TCHNNKASESGT-----------------KLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQIS-------HKRQE---KQITSEMLDTLTDGGNLPRPVSVLSF-RKKTINTANINDPKVSFEFENNLVLLSGLSLIFQQISGLFIKRFHHTKRNIKGXXXXXXXXXXXXXXXXXXXXXXXXMDNQPSMTISPWLMMPKTRLVNLNTFYRKENTSDQISFKLNENYRSDIGQSGVRCMNTSLYQLENFKCL---------------YPYNTNKWSEKSPIEISLVTPECDCSTTG--NQICSSPL-SGGPESSNRIMASSDRLYDLSSYNISDYLMKNFKTFIM-----------KQYGGLQF--ILPSFFGQSCQVIGESQIWF--DFRQSINSSRDNNSNPEQVKFLNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFSYLRYNIS---GGDENYNAFEWDITGNKICSLGILFVGWCLIIVFMESKHKKTLCIKLKDVKLKPYEIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLH-PNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFDSSVKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKNDSVTRNI 6204
            D +  S  L+ +G     ++ ++ L+ ++CG  +   +  +F+ N  + +                    KR+   C  + +  L  +   +       P++ GKI FTPDS   R+I+K AN TFE LD +R     W  +  + W     S Q+          T+ +  N       +  E   N+++      ++ D      ++   I  R   L  + L C  L+KF+    +V +   A + L     +AGVVF   + + +     V  Y+IRM  + ++ T   K+ D +W+  PR D + D +Y   GF +LQ+  +Q  ++         IG  +Q MPYPCFVDD F+  L+   P  +++AW  SV++ +K IV EKE RLKE +   G++N V WC+WF+ +  ++   +  +TL + +  I+ +S P I+F+ +L++  + I QSF++S  F  +++AA   G++YF  YLP ++   +QD ++ ++   V LL+ V+F     ++   E+   G Q+SN+  S +    F     + M+ +D+  Y L+AWY++ VFPG YG P PWYFL    YW+      ++    +E ++   +  E+    +G     FE+E   L  G+ ++NLVK F  S  PA+D LN+ FY++QIT FLGHNGAGKTTT+SILTG+L PTSGT  I   DI  +++++R  +G+CPQHNILF +LTV +HI FY  LKG +  E + ++  ++++ GL  K    +++LSGGM+RKLS+A+AFVG+S+++ LDEPT+GVDP+SRR IWDL++KYRS  RTII++THHMDEAD L DRIAIISQG+L C G+ LFLK  FG G+YL L +  + IQS+        +C +   S                     +L++ +   +P +KL++    +   +L + +  +  + SLF +L+ +L  L ++S+G+SDT LEE+FLKV +D    S        KR++   +   S   + L      P   S       K   +    DP V F         +G  LI Q +  L +KRFHHT R+ K   ++++LP   + L   L  I       P++T+ PW+        +  TF+  +  +++    L +   +  G  G RC+      L  + C+               + +   KW+   P      +P C CST      +   P  +GG     R   S++ L DL++ NISDYL+K +   I            ++YGG+     LP+       + GE+ + F     Q +N S    +     + L++ +    +  IK     +W N+KG+ ++ ++ N+  N +LR+++   +  + YGI V + PL  T+  L         ++  +AI VIF +SF+PASFV++LI+ERVT +K  Q++SGV+P  YW++NF WD + Y++S  +V+  F+ F  ++Y    N+ A + LL LY  AVIP MYP SF     STA+V +S  NL +G  ++  TF L+L++ ++ +L   N  L+K+ ++FP + LGRG+IDL+ S    ++    G + + N F+WD+ G  + ++ I  V + L+ + ++  H   L   + +   +P   + DED DV +ER+R+ ++     D+L++  LTK+Y+ S                       AV+ +  GV+ GECFGLLGVNGAGKTTTFKML G+  +T G+A + G SI+      H+NMG+CPQFDA+  LLT  E LY Y R+RG+   +I    +  +++L L+ + ++     SGGNKRK+ TAIAL G P ++ LDEPT GMD  ARR LW  I ++  E + AV+LTSH+MEECE LC RLAIMV G  + +G++QHLK KFG  Y V +++  P  + L D N +E         S + +E +  +++++  SS  L+ IF++    + + +++EYSV+Q +LD+VF+NFAK  + T ++
Sbjct:  295 DLLWVSRPLLQNGGPETFTQLMSILSDLLCGYPEGGGS-RVFSFNWYEDNNYKAFLGIDSTRKDPAYSYDKRTTSFCNSLIQS-LESNPLTKIAWRAAKPLLMGKILFTPDSPAARRIMKNANSTFEELDRVRKLVKAWEEVGPQIWYFFEKSTQMTVIRDTLQHPTVKDFINRQLGEEGITTEAVLNFFSNGPQEKQADDMTSFDWRDIFNITDRFLRLANQYLECLVLDKFESYDDEVQLTQRALSLLEENRFWAGVVFPGMYPWASSLPPHV-KYKIRMDIDVVEKTN--KIKDRYWDSGPRADPVEDFRYIWGGFAYLQDMVEQGIVK-SQMQAEPPIGVYLQQMPYPCFVDDSFMIILNRCFPIFMVLAWIYSVSMTVKGIVLEKELRLKETLKNQGVSNAVIWCTWFLDSFSIMALSIFLLTLFIMHGRILHYSDPFILFLFLLAFATATIMQSFLLSTLFSKASLAAACSGVIYFTLYLPHVLCFAWQDRMTADLKTTVSLLSSVAFGFGTEYLVRFEEQGLGLQWSNIGKSPLEGDEFSFLLSMKMMLLDAALYGLLAWYLDQVFPGDYGTPLPWYFLLQESYWLGGEGCSTREERALEKTEPLTEEMEDPEHPEGMNDSFFERELPGLVPGVCVKNLVKVFEPSGRPAVDRLNITFYENQITAFLGHNGAGKTTTLSILTGLLPPTSGTVLIGGKDIETNLDVVRQSLGMCPQHNILFHHLTVAEHILFYAQLKGRSWEEAQLEMEAMLEDTGLHHKRNEEAQDLSGGMQRKLSVAIAFVGDSKVVVLDEPTSGVDPYSRRSIWDLLLKYRS-GRTIIMSTHHMDEADLLGDRIAIISQGRLYCSGTPLFLKNCFGTGFYLTLVRKMKNIQSQRGGCEGVCSCTSKGFSTRCPTRVDEITEEQVLDGDVQELMDLVYHHVPEAKLVECIGQELIFLLPNKNFKQRAYASLFRELEETLADLGLSSFGISDTPLEEIFLKVTEDAGAGSMFVGGAQQKREQAGLRHPCSAPTEKLRQYAQAPHTCSPGQVDPPKGQPSPEPEDPGVPFN--------TGARLILQHVQALLVKRFHHTIRSRKDFVAQIVLPATFVFLALMLSIIVPPFGEFPALTLHPWMYG------HQYTFFSMDEPNNEHLEVLADVLLNRPG-FGNRCLKEEW--LPEYPCINATSWKTPSVSPNITHLFQKQKWTAAHP------SPSCKCSTREKLTMLPECPEGAGGLPPPQRTQRSTEVLQDLTNRNISDYLVKTYPALIRSSLKSKFWVNEQRYGGISIGGKLPAI-----PISGEALVGFLSGLGQMMNVSGGPVTREASKEMLDFLKHLETTDNIK-----VWFNNKGWHALVSFLNVAHNAILRASLPRDRDPEEYGITVISQPLNLTKEQLSDITVLTTSVDAVVAICVIFAMSFVPASFVLYLIQERVTKAKHLQFISGVSPTTYWLTNFLWDIMNYAVSAGLVVGIFIGFQKKAYTSPDNLPALVSLLMLYGWAVIPMMYPASFLFEVPSTAYVALSCANLFIGINSSAITFVLELFE-NNRTLLRFNAMLRKLLIVFPHFCLGRGLIDLALSQAVTDVYAQFGEEYSANPFQWDLIGKNLVAMAIEGVVYFLLTLLIQ--HHFFLTRWIAEPAREP---VFDEDDDVAEERQRV-MSGGNKTDILKLNELTKVYSGS--------------------SSPAVDRLCVGVRPGECFGLLGVNGAGKTTTFKMLTGDTTVTSGDATVAGKSILTSISDVHQNMGYCPQFDAIDDLLTGREHLYLYARLRGVPSKEIEKVANWGIQSLGLSLYADRLAGTYSGGNKRKLSTAIALTGCPPLLLLDEPTTGMDPQARRMLWNTIVSIIREGR-AVVLTSHSMEECEALCTRLAIMVKGTFQCLGTIQHLKYKFGDGYIVTMKIKSPKDDLLPDLNPVEQFFQGNFPGSVQ-RERHHSMLQFQVPSS-SLARIFQLLISHKDSLLIEEYSVTQTTLDQVFVNFAKQQTETYDL 2257          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Mouse
Match: Abca7 (ATP-binding cassette, sub-family A (ABC1), member 7 [Source:MGI Symbol;Acc:MGI:1351646])

HSP 1 Score: 1016.14 bits (2626), Expect = 0.000e+0
Identity = 642/1949 (32.94%), Postives = 1028/1949 (52.74%), Query Frame = 1
Query:  688 RQLLEMTAPIIFGKIYFTPDSEFTRQIIKKANITFEILDNLRLSAVEWRL------NFRDWLSNQVNNSSTLDNMSNNAKVCMETSQNYYTVCQLIYKSSDRNRIQNSIEIA----SRIFDLIERGLNCTELNKFQPMKSKVDIDNLAQNKL--INIFAGVVFNESFQYLTLNNATV-------LNYQIRMPTNRIDSTKNFKVLDTFWNPIPRRDTIYDLKYYTSGFLFLQEAFDQAFIELVTGNVTINIGTSMQIMPYPCFVDDRFIKFLSMIMPFILIIAWTPSVTIIIKSIVYEKENRLKEFMLLMGLTNFVHWCSWFISTIVVLIFPVIFMTLILKYNEIIQFSSPGIIFILILSYVISFICQSFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENIAIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKA-----------------------------------------SESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQITSEMLDTLTDGGNLPRPVSVLSFRKKTINTANINDPKVSFEFENNLVLLSGLSLIFQQISGLFIKRFHHTKRNIKGXXXXXXXXXXXXXXXXXXXXXXXXMDNQPSMTISPWLMMPKTRLVNLNTFYRKENTSDQISFKLNENYRSDIGQSGVRCMNTSLYQLENFKCLY-----------PYN------TNKWSEKSPIEISLVTPECDCSTTGNQI----CSSPLSGGPESSNRIMASSDRLYDLSSYNISDYLMKNFKTFIMK-----------QYGGLQFILPSFFGQSCQVIGESQIWFDFRQ--SINSSRDNNSNPEQVKFLNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDL--------SFSYLRYNISGGDENYNA-FEWDITGNKICSLGILFVGWCLIIVFMESKHKKTLCIKLKDVKLKPYEIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFDSSVK--LSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKNDSVTRNISNGNA 6219
            R L     P+I GKI F PD+ FTR+++ + N TFE L  LR     W +      NF +  +N       LD      +     +Q      + I    D +R   S   A     R+  ++ + + C  L+K + + S+  + + A   L    ++AG+VF      L  +  +        L ++IRM  +  D T+  K+ D FW+P P  D   DL+Y   GF++LQ+  +QA + ++ G  +   G  +Q MP+PC+VDD F++ LS  +P  L +AW  SV + +K++V EKE RL+E M  MGL+  V W  WF+S +   +     + L+LK   I+ +S P +IF+ + ++ ++ + QSF++S FF  +N+AA  GG+ YF  YLP+++ + +++ L         LL+ V+F      +  LE+  DGAQ+ NL      D+ F +      + +D+V Y L  WY+EAV PG+YG+P+PW F F R YW        ++        ++  + +   E+ P  L  G+ I  L K F     PAL  LNL FY+  IT FLGHNGAGKTTT+SIL+G+  P+SG+A IL +D++ +M  IR  +G+CPQ+N+LF  LTVE+H++FYG LKG++ + +  +   ++++VGL+ K    +++LSGGM+RKLS+A+AFVG SR++ +DEPTAGVDP SRRGIW+L++KYR   RT+IL+THH+DEA+ L DR+A+++ G L CCGS LFL+++ G GYYL L KS   QS   H+ K                                          + S  ++LE +++ +P ++L+++   +  +VL +       F  +F++LD  L+ L +  YG+SDT+LEE+FLKV +D    +H+          L T T         SVL   +       + DP+       N   + G +L  QQ+  L  KRF   +R+ +GLF++++LP L + L      I       P + +SP +  P+       +F+ ++   D    KL E     +G++G++  +         +C +           P +      +  W+ +SP      +P C CS  G +     C +  +GGP     +    + + +L+  N+SD+L+K + + + +           +YGG      S  G+   +    ++     +  ++ S +  N+    +  L  + L  ++     N  +IW N+KG+ +M A+ N  +N LL + + +      + I   N+PL  T+  L         ++V ++I V+F +SF+PASF + LIEER+T +K  Q VSG+   +YW+ NF WD   Y ++V IV+  FLAF  ++Y+  +N+ A ++LL LY  ++ P MYP SFF S  STA+VV++  NL +G  +++ TF L+L    D +L+  +  LK++FLIFP + LGRG+ID+        +F  L      GD+ + +   WDI G  +  L ++  G   +++ +  +H+  L  + K   L P   + +ED DV +ERER+        DVL +  LTK+Y                      +R  AV+ +  G+  GECFGLLGVNGAGKT+TF+M+ G+   + G A++ G+++  +   AH++MG+CPQ DA+  LLT  E L  + R+RG+  + +       L  L L  + ++P    SGGNKRK+ TA+AL+G P +VFLDEPT GMD  ARRFLW  + ++  E + +V+LTSH+MEECE LC RLAIMV+G  + +GS QHLK +FG  + + +R+ P      D+ E      +  +  A ++E +   + ++     +  L+ +FR          V+++SVSQ +L+EVF+ F+K+       S   A
Sbjct:  278 RLLWRRLKPLILGKILFAPDTNFTRKLMAQVNQTFEELALLRDLHELWGVLGPQIFNFMNDSTNVAMLQRLLDVGGTGQRQQTPRAQKKL---EAIKDFLDPSRGGYSWREAHADMGRLAGILGQMMECVSLDKLEAVPSEEALVSRALELLGERRLWAGIVFLSPEHPLDPSELSSPALSPGHLRFKIRMDID--DVTRTNKIRDKFWDPGPSADPFMDLRYVWGGFVYLQDLLEQAAVRVLGGGNS-RTGLYLQQMPHPCYVDDVFLRVLSRSLPLFLTLAWIYSVALTVKAVVREKETRLRETMRAMGLSRAVLWLGWFLSCLGPFLVSAALLVLVLKLGNILPYSHPVVIFLFLAAFAVATVAQSFLLSAFFSRANLAAACGGLAYFALYLPYVLCVAWRERLHLGGLLAASLLSPVAFGFGCESLALLEEQGDGAQWHNLGTGPAEDV-FSLAQVSAFLLLDAVIYGLALWYLEAVCPGQYGIPEPWNFPFRRSYWCGPGPPKSSVLAPA---PQDPKVLV---EEPPLGLVPGVSIRGLKKHFRGCPQPALQGLNLDFYEGHITAFLGHNGAGKTTTLSILSGLFPPSSGSASILGHDVQTNMAAIRPHLGICPQYNVLFDMLTVEEHVWFYGRLKGVSAAAMGPERERLIRDVGLTLKRDTQTRHLSGGMQRKLSVAIAFVGGSRVVIMDEPTAGVDPASRRGIWELLLKYRE-GRTLILSTHHLDEAELLGDRVAMVAGGSLCCCGSPLFLRRHLGCGYYLTLVKSS--QSLVTHDAKGDSEDPRREKKSDGNGRTSDTAFTRGTSDKSNQAPAPGAVPITPSTARILELVQQHVPGAQLVEDLPHELLLVLPYAGALDGSFAMVFQELDQQLELLGLTGYGISDTNLEEIFLKVVED----AHREGGDSRPQLHLRTCTPQPPTGPEASVL---ENGELAKLVLDPQAPQGLAPNAAQVQGWTLTCQQLRALLHKRFLLARRSRRGLFAQVVLPALFVGLALFFSLIVPPFGQYPPLQLSPAMYGPQV------SFFSEDAPGDPNRMKLLEAL---LGEAGLQEPSMQDKDARGSECTHSLACYFTVPEVPPDVASILASGNWTPESP------SPACQCSQPGARRLLPDCPA-GAGGPPPPQAVAGLGEVVQNLTGRNVSDFLVKTYPSLVRRGLKTKKWVDEVRYGGF-----SLGGRDPDLPTGHEVVRTLAEIRALLSPQPGNALDRILNNLTQWALGLDAR----NSLKIWFNNKGWHAMVAFVNRANNGLLHALLPSGPVRHAHSITTLNHPLNLTKEQLSEATLIASSVDVLVSICVVFAMSFVPASFTLVLIEERITRAKHLQLVSGLPQTLYWLGNFLWDMCNYLVAVCIVVFIFLAFQQRAYVAPENLPALLLLLLLYGWSITPLMYPASFFFSVPSTAYVVLTCINLFIGINSSMATFVLEL--LSDQNLQEVSRILKQVFLIFPHFCLGRGLIDMVRNQAMADAFERL------GDKQFQSPLRWDIIGKNL--LAMMAQGPLFLLITLLLQHRNRLLPQSKPRLLPP---LGEEDEDVAQERERVT-KGATQGDVLVLRDLTKVYR--------------------GQRNPAVDRLCLGIPPGECFGLLGVNGAGKTSTFRMVTGDTLPSSGEAVLAGHNVAQERSAAHRSMGYCPQSDAIFDLLTGREHLELFARLRGVPEAQVAQTALSGLVRLGLPSYADRPAGTYSGGNKRKLATALALVGDPAVVFLDEPTTGMDPSARRFLWNSLLSVVREGR-SVVLTSHSMEECEALCTRLAIMVNGRFRCLGSSQHLKGRFGAGHTLTLRVPP------DQPEPAIAFIRITFPGAELREVHGSRLRFQLPPGGRCTLTRVFRELAAQGRAHGVEDFSVSQTTLEEVFLYFSKDQGEEEESSRQEA 2137          

HSP 2 Score: 170.629 bits (431), Expect = 1.104e-41
Identity = 104/339 (30.68%), Postives = 176/339 (51.92%), Query Frame = 1
Query: 2248 ILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISH-KRQEKQ 3261
            +++ +L K +   + PA+D L L     +  G LG NGAGKT+T  ++TG   P+SG A +  +++  +       +G CPQ + +F  LT  +H+  +  L+G+ ++++       +  +GL       +   SGG KRKL+ A+A VG+  ++FLDEPT G+DP +RR +W+ ++      R+++LT+H M+E + LC R+AI+  G+ +C GSS  LK  FG G+ L L    + Q E              + FI+   P ++L +   ++    L      R   T +F +L +      +  + +S T+LEEVFL  + D  +     RQE +
Sbjct: 1815 LVLRDLTKVYRGQRNPAVDRLCLGIPPGECFGLLGVNGAGKTSTFRMVTGDTLPSSGEAVLAGHNVAQERSAAHRSMGYCPQSDAIFDLLTGREHLELFARLRGVPEAQVAQTALSGLVRLGLPSYADRPAGTYSGGNKRKLATALALVGDPAVVFLDEPTTGMDPSARRFLWNSLLSVVREGRSVVLTSHSMEECEALCTRLAIMVNGRFRCLGSSQHLKGRFGAGHTLTLRVPPD-QPEPA------------IAFIRITFPGAELREVHGSRLRFQLPPG--GRCTLTRVFRELAAQGRAHGVEDFSVSQTTLEEVFLYFSKDQGEEEESSRQEAE 2138          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Mouse
Match: Abca7 (ATP-binding cassette, sub-family A (ABC1), member 7 [Source:MGI Symbol;Acc:MGI:1351646])

HSP 1 Score: 1011.13 bits (2613), Expect = 0.000e+0
Identity = 642/1951 (32.91%), Postives = 1028/1951 (52.69%), Query Frame = 1
Query:  688 RQLLEMTAPIIFGKIYFTPDSEFTRQIIKKANITFEILDNLRLSAVEWRL------NFRDWLSNQVNNSSTLDNMSNNAKVCMETSQNYYTVCQLIYKSSDRNRIQNSIEIA----SRIFDLIERGLNCTELNKFQPMKSKVDIDNLAQNKL--INIFAGVVFNESFQYLTLNNATV-------LNYQIRMPTNRIDSTKNFKVLDTFWNPIPRRDTIYDLKYYTSGFLFLQEAFDQAFIELVTGNVTINIGTSMQIMPYPCFVDDRFIKFLSMIMPFILIIAWTPSVTIIIKSIVYEKENRLKEFMLLMGLTNFVHWCSWFISTIVVLIFPVIFMTLILKYNEIIQFSSPGIIFILILSYVISFICQSFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENIAIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKA-----------------------------------------SESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQITSEMLDTLTDGGNLPRPVSVLSFRKKTINTANI--NDPKVSFEFENNLVLLSGLSLIFQQISGLFIKRFHHTKRNIKGXXXXXXXXXXXXXXXXXXXXXXXXMDNQPSMTISPWLMMPKTRLVNLNTFYRKENTSDQISFKLNENYRSDIGQSGVRCMNTSLYQLENFKCLY-----------PYN------TNKWSEKSPIEISLVTPECDCSTTGNQI----CSSPLSGGPESSNRIMASSDRLYDLSSYNISDYLMKNFKTFIMK-----------QYGGLQFILPSFFGQSCQVIGESQIWFDFRQ--SINSSRDNNSNPEQVKFLNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDL--------SFSYLRYNISGGDENYNA-FEWDITGNKICSLGILFVGWCLIIVFMESKHKKTLCIKLKDVKLKPYEIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFDSSVK--LSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKNDSVTRNISNGNA 6219
            R L     P+I GKI F PD+ FTR+++ + N TFE L  LR     W +      NF +  +N       LD      +     +Q      + I    D +R   S   A     R+  ++ + + C  L+K + + S+  + + A   L    ++AG+VF      L  +  +        L ++IRM  +  D T+  K+ D FW+P P  D   DL+Y   GF++LQ+  +QA + ++ G  +   G  +Q MP+PC+VDD F++ LS  +P  L +AW  SV + +K++V EKE RL+E M  MGL+  V W  WF+S +   +     + L+LK   I+ +S P +IF+ + ++ ++ + QSF++S FF  +N+AA  GG+ YF  YLP+++ + +++ L         LL+ V+F      +  LE+  DGAQ+ NL      D+ F +      + +D+V Y L  WY+EAV PG+YG+P+PW F F R YW        ++        ++  + +   E+ P  L  G+ I  L K F     PAL  LNL FY+  IT FLGHNGAGKTTT+SIL+G+  P+SG+A IL +D++ +M  IR  +G+CPQ+N+LF  LTVE+H++FYG LKG++ + +  +   ++++VGL+ K    +++LSGGM+RKLS+A+AFVG SR++ +DEPTAGVDP SRRGIW+L++KYR   RT+IL+THH+DEA+ L DR+A+++ G L CCGS LFL+++ G GYYL L KS   QS   H+ K                                          + S  ++LE +++ +P ++L+++   +  +VL +       F  +F++LD  L+ L +  YG+SDT+LEE+FLKV +D    +H+          L T T     P+P         T   A++  N          N   + G +L  QQ+  L  KRF   +R+ +GLF++++LP L + L      I       P + +SP +  P+       +F+ ++   D    KL E     +G++G++  +         +C +           P +      +  W+ +SP      +P C CS  G +     C +  +GGP     +    + + +L+  N+SD+L+K + + + +           +YGG      S  G+   +    ++     +  ++ S +  N+    +  L  + L  ++     N  +IW N+KG+ +M A+ N  +N LL + + +      + I   N+PL  T+  L         ++V ++I V+F +SF+PASF + LIEER+T +K  Q VSG+   +YW+ NF WD   Y ++V IV+  FLAF  ++Y+  +N+ A ++LL LY  ++ P MYP SFF S  STA+VV++  NL +G  +++ TF L+L    D +L+  +  LK++FLIFP + LGRG+ID+        +F  L      GD+ + +   WDI G  +  L ++  G   +++ +  +H+  L  + K   L P   + +ED DV +ERER+        DVL +  LTK+Y                      +R  AV+ +  G+  GECFGLLGVNGAGKT+TF+M+ G+   + G A++ G+++  +   AH++MG+CPQ DA+  LLT  E L  + R+RG+  + +       L  L L  + ++P    SGGNKRK+ TA+AL+G P +VFLDEPT GMD  ARRFLW  + ++  E + +V+LTSH+MEECE LC RLAIMV+G  + +GS QHLK +FG  + + +R+ P      D+ E      +  +  A ++E +   + ++     +  L+ +FR          V+++SVSQ +L+EVF+ F+K+       S   A
Sbjct:  278 RLLWRRLKPLILGKILFAPDTNFTRKLMAQVNQTFEELALLRDLHELWGVLGPQIFNFMNDSTNVAMLQRLLDVGGTGQRQQTPRAQKKL---EAIKDFLDPSRGGYSWREAHADMGRLAGILGQMMECVSLDKLEAVPSEEALVSRALELLGERRLWAGIVFLSPEHPLDPSELSSPALSPGHLRFKIRMDID--DVTRTNKIRDKFWDPGPSADPFMDLRYVWGGFVYLQDLLEQAAVRVLGGGNS-RTGLYLQQMPHPCYVDDVFLRVLSRSLPLFLTLAWIYSVALTVKAVVREKETRLRETMRAMGLSRAVLWLGWFLSCLGPFLVSAALLVLVLKLGNILPYSHPVVIFLFLAAFAVATVAQSFLLSAFFSRANLAAACGGLAYFALYLPYVLCVAWRERLHLGGLLAASLLSPVAFGFGCESLALLEEQGDGAQWHNLGTGPAEDV-FSLAQVSAFLLLDAVIYGLALWYLEAVCPGQYGIPEPWNFPFRRSYWCGPGPPKSSVLAPA---PQDPKVLV---EEPPLGLVPGVSIRGLKKHFRGCPQPALQGLNLDFYEGHITAFLGHNGAGKTTTLSILSGLFPPSSGSASILGHDVQTNMAAIRPHLGICPQYNVLFDMLTVEEHVWFYGRLKGVSAAAMGPERERLIRDVGLTLKRDTQTRHLSGGMQRKLSVAIAFVGGSRVVIMDEPTAGVDPASRRGIWELLLKYRE-GRTLILSTHHLDEAELLGDRVAMVAGGSLCCCGSPLFLRRHLGCGYYLTLVKSS--QSLVTHDAKGDSEDPRREKKSDGNGRTSDTAFTRGTSDKSNQAPAPGAVPITPSTARILELVQQHVPGAQLVEDLPHELLLVLPYAGALDGSFAMVFQELDQQLELLGLTGYGISDTNLEEIFLKVVED----AHREGGDSRPQLHLRTCT-----PQP--------PTGPEASVLENGELAPQGLAPNAAQVQGWTLTCQQLRALLHKRFLLARRSRRGLFAQVVLPALFVGLALFFSLIVPPFGQYPPLQLSPAMYGPQV------SFFSEDAPGDPNRMKLLEAL---LGEAGLQEPSMQDKDARGSECTHSLACYFTVPEVPPDVASILASGNWTPESP------SPACQCSQPGARRLLPDCPA-GAGGPPPPQAVAGLGEVVQNLTGRNVSDFLVKTYPSLVRRGLKTKKWVDEVRYGGF-----SLGGRDPDLPTGHEVVRTLAEIRALLSPQPGNALDRILNNLTQWALGLDAR----NSLKIWFNNKGWHAMVAFVNRANNGLLHALLPSGPVRHAHSITTLNHPLNLTKEQLSEATLIASSVDVLVSICVVFAMSFVPASFTLVLIEERITRAKHLQLVSGLPQTLYWLGNFLWDMCNYLVAVCIVVFIFLAFQQRAYVAPENLPALLLLLLLYGWSITPLMYPASFFFSVPSTAYVVLTCINLFIGINSSMATFVLEL--LSDQNLQEVSRILKQVFLIFPHFCLGRGLIDMVRNQAMADAFERL------GDKQFQSPLRWDIIGKNL--LAMMAQGPLFLLITLLLQHRNRLLPQSKPRLLPP---LGEEDEDVAQERERVT-KGATQGDVLVLRDLTKVYR--------------------GQRNPAVDRLCLGIPPGECFGLLGVNGAGKTSTFRMVTGDTLPSSGEAVLAGHNVAQERSAAHRSMGYCPQSDAIFDLLTGREHLELFARLRGVPEAQVAQTALSGLVRLGLPSYADRPAGTYSGGNKRKLATALALVGDPAVVFLDEPTTGMDPSARRFLWNSLLSVVREGR-SVVLTSHSMEECEALCTRLAIMVNGRFRCLGSSQHLKGRFGAGHTLTLRVPP------DQPEPAIAFIRITFPGAELREVHGSRLRFQLPPGGRCTLTRVFRELAAQGRAHGVEDFSVSQTTLEEVFLYFSKDQGEEEESSRQEA 2129          

HSP 2 Score: 170.629 bits (431), Expect = 1.189e-41
Identity = 104/339 (30.68%), Postives = 176/339 (51.92%), Query Frame = 1
Query: 2248 ILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISH-KRQEKQ 3261
            +++ +L K +   + PA+D L L     +  G LG NGAGKT+T  ++TG   P+SG A +  +++  +       +G CPQ + +F  LT  +H+  +  L+G+ ++++       +  +GL       +   SGG KRKL+ A+A VG+  ++FLDEPT G+DP +RR +W+ ++      R+++LT+H M+E + LC R+AI+  G+ +C GSS  LK  FG G+ L L    + Q E              + FI+   P ++L +   ++    L      R   T +F +L +      +  + +S T+LEEVFL  + D  +     RQE +
Sbjct: 1807 LVLRDLTKVYRGQRNPAVDRLCLGIPPGECFGLLGVNGAGKTSTFRMVTGDTLPSSGEAVLAGHNVAQERSAAHRSMGYCPQSDAIFDLLTGREHLELFARLRGVPEAQVAQTALSGLVRLGLPSYADRPAGTYSGGNKRKLATALALVGDPAVVFLDEPTTGMDPSARRFLWNSLLSVVREGRSVVLTSHSMEECEALCTRLAIMVNGRFRCLGSSQHLKGRFGAGHTLTLRVPPD-QPEPA------------IAFIRITFPGAELREVHGSRLRFQLPPG--GRCTLTRVFRELAAQGRAHGVEDFSVSQTTLEEVFLYFSKDQGEEEESSRQEAE 2130          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Mouse
Match: Abca7 (ATP-binding cassette, sub-family A (ABC1), member 7 [Source:MGI Symbol;Acc:MGI:1351646])

HSP 1 Score: 1011.13 bits (2613), Expect = 0.000e+0
Identity = 642/1951 (32.91%), Postives = 1028/1951 (52.69%), Query Frame = 1
Query:  688 RQLLEMTAPIIFGKIYFTPDSEFTRQIIKKANITFEILDNLRLSAVEWRL------NFRDWLSNQVNNSSTLDNMSNNAKVCMETSQNYYTVCQLIYKSSDRNRIQNSIEIA----SRIFDLIERGLNCTELNKFQPMKSKVDIDNLAQNKL--INIFAGVVFNESFQYLTLNNATV-------LNYQIRMPTNRIDSTKNFKVLDTFWNPIPRRDTIYDLKYYTSGFLFLQEAFDQAFIELVTGNVTINIGTSMQIMPYPCFVDDRFIKFLSMIMPFILIIAWTPSVTIIIKSIVYEKENRLKEFMLLMGLTNFVHWCSWFISTIVVLIFPVIFMTLILKYNEIIQFSSPGIIFILILSYVISFICQSFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENIAIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKA-----------------------------------------SESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQITSEMLDTLTDGGNLPRPVSVLSFRKKTINTANI--NDPKVSFEFENNLVLLSGLSLIFQQISGLFIKRFHHTKRNIKGXXXXXXXXXXXXXXXXXXXXXXXXMDNQPSMTISPWLMMPKTRLVNLNTFYRKENTSDQISFKLNENYRSDIGQSGVRCMNTSLYQLENFKCLY-----------PYN------TNKWSEKSPIEISLVTPECDCSTTGNQI----CSSPLSGGPESSNRIMASSDRLYDLSSYNISDYLMKNFKTFIMK-----------QYGGLQFILPSFFGQSCQVIGESQIWFDFRQ--SINSSRDNNSNPEQVKFLNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDL--------SFSYLRYNISGGDENYNA-FEWDITGNKICSLGILFVGWCLIIVFMESKHKKTLCIKLKDVKLKPYEIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFDSSVK--LSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKNDSVTRNISNGNA 6219
            R L     P+I GKI F PD+ FTR+++ + N TFE L  LR     W +      NF +  +N       LD      +     +Q      + I    D +R   S   A     R+  ++ + + C  L+K + + S+  + + A   L    ++AG+VF      L  +  +        L ++IRM  +  D T+  K+ D FW+P P  D   DL+Y   GF++LQ+  +QA + ++ G  +   G  +Q MP+PC+VDD F++ LS  +P  L +AW  SV + +K++V EKE RL+E M  MGL+  V W  WF+S +   +     + L+LK   I+ +S P +IF+ + ++ ++ + QSF++S FF  +N+AA  GG+ YF  YLP+++ + +++ L         LL+ V+F      +  LE+  DGAQ+ NL      D+ F +      + +D+V Y L  WY+EAV PG+YG+P+PW F F R YW        ++        ++  + +   E+ P  L  G+ I  L K F     PAL  LNL FY+  IT FLGHNGAGKTTT+SIL+G+  P+SG+A IL +D++ +M  IR  +G+CPQ+N+LF  LTVE+H++FYG LKG++ + +  +   ++++VGL+ K    +++LSGGM+RKLS+A+AFVG SR++ +DEPTAGVDP SRRGIW+L++KYR   RT+IL+THH+DEA+ L DR+A+++ G L CCGS LFL+++ G GYYL L KS   QS   H+ K                                          + S  ++LE +++ +P ++L+++   +  +VL +       F  +F++LD  L+ L +  YG+SDT+LEE+FLKV +D    +H+          L T T     P+P         T   A++  N          N   + G +L  QQ+  L  KRF   +R+ +GLF++++LP L + L      I       P + +SP +  P+       +F+ ++   D    KL E     +G++G++  +         +C +           P +      +  W+ +SP      +P C CS  G +     C +  +GGP     +    + + +L+  N+SD+L+K + + + +           +YGG      S  G+   +    ++     +  ++ S +  N+    +  L  + L  ++     N  +IW N+KG+ +M A+ N  +N LL + + +      + I   N+PL  T+  L         ++V ++I V+F +SF+PASF + LIEER+T +K  Q VSG+   +YW+ NF WD   Y ++V IV+  FLAF  ++Y+  +N+ A ++LL LY  ++ P MYP SFF S  STA+VV++  NL +G  +++ TF L+L    D +L+  +  LK++FLIFP + LGRG+ID+        +F  L      GD+ + +   WDI G  +  L ++  G   +++ +  +H+  L  + K   L P   + +ED DV +ERER+        DVL +  LTK+Y                      +R  AV+ +  G+  GECFGLLGVNGAGKT+TF+M+ G+   + G A++ G+++  +   AH++MG+CPQ DA+  LLT  E L  + R+RG+  + +       L  L L  + ++P    SGGNKRK+ TA+AL+G P +VFLDEPT GMD  ARRFLW  + ++  E + +V+LTSH+MEECE LC RLAIMV+G  + +GS QHLK +FG  + + +R+ P      D+ E      +  +  A ++E +   + ++     +  L+ +FR          V+++SVSQ +L+EVF+ F+K+       S   A
Sbjct:  278 RLLWRRLKPLILGKILFAPDTNFTRKLMAQVNQTFEELALLRDLHELWGVLGPQIFNFMNDSTNVAMLQRLLDVGGTGQRQQTPRAQKKL---EAIKDFLDPSRGGYSWREAHADMGRLAGILGQMMECVSLDKLEAVPSEEALVSRALELLGERRLWAGIVFLSPEHPLDPSELSSPALSPGHLRFKIRMDID--DVTRTNKIRDKFWDPGPSADPFMDLRYVWGGFVYLQDLLEQAAVRVLGGGNS-RTGLYLQQMPHPCYVDDVFLRVLSRSLPLFLTLAWIYSVALTVKAVVREKETRLRETMRAMGLSRAVLWLGWFLSCLGPFLVSAALLVLVLKLGNILPYSHPVVIFLFLAAFAVATVAQSFLLSAFFSRANLAAACGGLAYFALYLPYVLCVAWRERLHLGGLLAASLLSPVAFGFGCESLALLEEQGDGAQWHNLGTGPAEDV-FSLAQVSAFLLLDAVIYGLALWYLEAVCPGQYGIPEPWNFPFRRSYWCGPGPPKSSVLAPA---PQDPKVLV---EEPPLGLVPGVSIRGLKKHFRGCPQPALQGLNLDFYEGHITAFLGHNGAGKTTTLSILSGLFPPSSGSASILGHDVQTNMAAIRPHLGICPQYNVLFDMLTVEEHVWFYGRLKGVSAAAMGPERERLIRDVGLTLKRDTQTRHLSGGMQRKLSVAIAFVGGSRVVIMDEPTAGVDPASRRGIWELLLKYRE-GRTLILSTHHLDEAELLGDRVAMVAGGSLCCCGSPLFLRRHLGCGYYLTLVKSS--QSLVTHDAKGDSEDPRREKKSDGNGRTSDTAFTRGTSDKSNQAPAPGAVPITPSTARILELVQQHVPGAQLVEDLPHELLLVLPYAGALDGSFAMVFQELDQQLELLGLTGYGISDTNLEEIFLKVVED----AHREGGDSRPQLHLRTCT-----PQP--------PTGPEASVLENGELAPQGLAPNAAQVQGWTLTCQQLRALLHKRFLLARRSRRGLFAQVVLPALFVGLALFFSLIVPPFGQYPPLQLSPAMYGPQV------SFFSEDAPGDPNRMKLLEAL---LGEAGLQEPSMQDKDARGSECTHSLACYFTVPEVPPDVASILASGNWTPESP------SPACQCSQPGARRLLPDCPA-GAGGPPPPQAVAGLGEVVQNLTGRNVSDFLVKTYPSLVRRGLKTKKWVDEVRYGGF-----SLGGRDPDLPTGHEVVRTLAEIRALLSPQPGNALDRILNNLTQWALGLDAR----NSLKIWFNNKGWHAMVAFVNRANNGLLHALLPSGPVRHAHSITTLNHPLNLTKEQLSEATLIASSVDVLVSICVVFAMSFVPASFTLVLIEERITRAKHLQLVSGLPQTLYWLGNFLWDMCNYLVAVCIVVFIFLAFQQRAYVAPENLPALLLLLLLYGWSITPLMYPASFFFSVPSTAYVVLTCINLFIGINSSMATFVLEL--LSDQNLQEVSRILKQVFLIFPHFCLGRGLIDMVRNQAMADAFERL------GDKQFQSPLRWDIIGKNL--LAMMAQGPLFLLITLLLQHRNRLLPQSKPRLLPP---LGEEDEDVAQERERVT-KGATQGDVLVLRDLTKVYR--------------------GQRNPAVDRLCLGIPPGECFGLLGVNGAGKTSTFRMVTGDTLPSSGEAVLAGHNVAQERSAAHRSMGYCPQSDAIFDLLTGREHLELFARLRGVPEAQVAQTALSGLVRLGLPSYADRPAGTYSGGNKRKLATALALVGDPAVVFLDEPTTGMDPSARRFLWNSLLSVVREGR-SVVLTSHSMEECEALCTRLAIMVNGRFRCLGSSQHLKGRFGAGHTLTLRVPP------DQPEPAIAFIRITFPGAELREVHGSRLRFQLPPGGRCTLTRVFRELAAQGRAHGVEDFSVSQTTLEEVFLYFSKDQGEEEESSRQEA 2129          

HSP 2 Score: 170.629 bits (431), Expect = 1.189e-41
Identity = 104/339 (30.68%), Postives = 176/339 (51.92%), Query Frame = 1
Query: 2248 ILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISH-KRQEKQ 3261
            +++ +L K +   + PA+D L L     +  G LG NGAGKT+T  ++TG   P+SG A +  +++  +       +G CPQ + +F  LT  +H+  +  L+G+ ++++       +  +GL       +   SGG KRKL+ A+A VG+  ++FLDEPT G+DP +RR +W+ ++      R+++LT+H M+E + LC R+AI+  G+ +C GSS  LK  FG G+ L L    + Q E              + FI+   P ++L +   ++    L      R   T +F +L +      +  + +S T+LEEVFL  + D  +     RQE +
Sbjct: 1807 LVLRDLTKVYRGQRNPAVDRLCLGIPPGECFGLLGVNGAGKTSTFRMVTGDTLPSSGEAVLAGHNVAQERSAAHRSMGYCPQSDAIFDLLTGREHLELFARLRGVPEAQVAQTALSGLVRLGLPSYADRPAGTYSGGNKRKLATALALVGDPAVVFLDEPTTGMDPSARRFLWNSLLSVVREGRSVVLTSHSMEECEALCTRLAIMVNGRFRCLGSSQHLKGRFGAGHTLTLRVPPD-QPEPA------------IAFIRITFPGAELREVHGSRLRFQLPPG--GRCTLTRVFRELAAQGRAHGVEDFSVSQTTLEEVFLYFSKDQGEEEESSRQEAE 2130          
BLAST of ATP-binding cassette sub-family A member 1 vs. UniProt/SwissProt
Match: sp|O95477|ABCA1_HUMAN (Phospholipid-transporting ATPase ABCA1 OS=Homo sapiens OX=9606 GN=ABCA1 PE=1 SV=3)

HSP 1 Score: 1114.37 bits (2881), Expect = 0.000e+0
Identity = 695/1950 (35.64%), Postives = 1066/1950 (54.67%), Query Frame = 1
Query:  661 KYLSVDYFHRQLLEMTAPIIFGKIYFTPDSEFTRQIIKKANITFEILDNLR-LSAVEWRLNFRDWL----SNQVNNSSTLDNMSNNAKVCME-------TSQNYYTVCQLIYKSSDRNRIQNSIEIASRIFD-------LIERGLNCTELNKFQPMKSKVDIDNLAQNKL--INIFAGVVFNESFQYLTLNNATVLNYQIRMPTNRIDSTKNFKVLDTFWNPIPRRDTIYDLKYYTSGFLFLQEAFDQAFIELVTGNVTINIGTSMQIMPYPCFVDDRFIKFLSMIMPFILIIAWTPSVTIIIKSIVYEKENRLKEFMLLMGLTNFVHWCSWFISTIVVLIFPVIFMTLILKYNEIIQFSSPGIIFILILSYVISFICQSFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENIAIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGL-SKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFL-EKSFE---------------IQSETCHNNKASESG--------------TKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQITSEMLDTLTDGGNLPRPVSVLSFRKKTI--------NTANINDPKVSFEFENNLVL----------LSGLSLIFQQISGLFIKRFHHTKRNIKGXXXXXXXXXXXXXXXXXXXXXXXXMDNQPSMTISPWLMMPKTRLVNLNTFYRKENTSDQISFKLNENYRSDIGQSGVRCM------NTSLYQLENFKCLYP--------YNTNKWSEKSPIEISLVTPECDCSTTGNQ----ICSSPLSGGPESSNRIMASSDRLYDLSSYNISDYLMKNFKTFIMK-----------QYGGLQFILPSFFGQSCQVIGESQIWFD----FRQSINSSRDNNSNPEQVKFLNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFSYLRYNIS---GGDENYNAFEWDITGNKICSLGILFVGWCLIIVFMESKHKKTLCIKLKDVKLKPYEIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFDSSV-KLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKNDS 6189
            K L      R + +   P++ GKI +TPD+  TRQ++ + N TF+ L     L  +   L+ + W     S +++    L +  +N     +       T+Q+   V  L     D      S+      F+        I R + C  LNK +P+ ++V + N +   L     +AG+VF       ++     + Y+IRM  + ++ T   K+ D +W+P PR D   D++Y   GF +LQ+  +QA I ++TG      G  MQ MPYPC+VDD F++ +S  MP  + +AW  SV +IIK IVYEKE RLKE M +MGL N + W SWFIS+++ L+     + +ILK   ++ +S P ++F+ +  + +  I Q F+IS  F  +N+AA  GGI+YF  YLP+++ + +QD +   +     LL+ V+F     +    E+   G Q+ NLF S + +  F +   + M+  D+  Y ++ WY+EAVFPG+YG+P+PWYF  T+ YW  F + +D      + ++R   I +   E+EP  L++G+ I+NLVK +      A+D L L FY+ QIT FLGHNGAGKTTT+SILTG+  PTSGTA+IL  DIR +M  IR  +G+CPQHN+LF  LTVE+HI+FY  LKG+++  +K ++  +  +VGL S KLK  +  LSGGM+RKLS+A+AFVG S+++ LDEPTAGVDP+SRRGIW+L++KYR   RTIIL+THHMDEAD L DRIAIIS GKL C GSSLFLK   G GYYL L +K  E               ++ E   +  +S++G              + +   I+K +  ++L+++   + T VL + +     F  LF ++D  L  L I+SYG+S+T+LEE+FLKVA++                 +D  T  G LP   +  +F  K          + A+ ND  +  E     +L          + G  L  QQ   L  KR    +R+ KG F++++LP + + +      I       PS+ + PW+   +       TF   +   D  + +L      D G  G RCM      +T     E      P        +    W+ ++P      +P C CS+   +    +C    +GG     R   ++D L DL+  NISDYL+K +   I K           +YGG      S    + Q +  SQ   D     ++ +  ++D++++    +FLN    F      K N+ ++W N+KG+ ++ ++ N+ +N +LR+ +   +   +YGI   N+PL  T+  L         ++V ++I VIF +SF+PASFV+FLI+ERV+ +K  Q++SGV P +YW+SNF WD   Y +   +VI+ F+ F  +SY+ S N+    +LL LY  ++ P MYP SF     STA+VV+++ NL +G   ++ TF L+L+   D  L + ND LK +FLIFP + LGRG+ID+  +    +     G +   +   WD+ G  + ++ +  V + LI V ++  ++  +  +  + KL P   + DED DV +ER+RI L+    ND+L++  LTKIY                      KRK AV+ I  G+  GECFGLLGVNGAGK++TFKML G+  +T G+A +N  SI+ +  + H+NMG+CPQFDA+  LLT  E + F+  +RG+   ++    + +++ L L  +  K     SGGNKRK+ TA+ALIG P +VFLDEPT GMD  ARRFLW    ++  E + +V+LTSH+MEECE LC R+AIMV+G  + +GSVQHLK++FG  Y + +R+  +   L    +   +     +  + +KE++  +++Y+  SS+  L+ IF +    +    +++YSVSQ +LD+VF+NFAK+ S
Sbjct:  360 KNLESSPLSRIIWKALKPLLVGKILYTPDTPATRQVMAEVNKTFQELAVFHDLEGMWEELSPKIWTFMENSQEMDLVRMLLDSRDNDHFWEQQLDGLDWTAQD--IVAFLAKHPEDVQSSNGSVYTWREAFNETNQAIRTISRFMECVNLNKLEPIATEVWLINKSMELLDERKFWAGIVFT-GITPGSIELPHHVKYKIRMDIDNVERTN--KIKDGYWDPGPRADPFEDMRYVWGGFAYLQDVVEQAIIRVLTGTEK-KTGVYMQQMPYPCYVDDIFLRVMSRSMPLFMTLAWIYSVAVIIKGIVYEKEARLKETMRIMGLDNSILWFSWFISSLIPLLVSAGLLVVILKLGNLLPYSDPSVVFVFLSVFAVVTILQCFLISTLFSRANLAAACGGIIYFTLYLPYVLCVAWQDYVGFTLKIFASLLSPVAFGFGCEYFALFEEQGIGVQWDNLFESPVEEDGFNLTTSVSMMLFDTFLYGVMTWYIEAVFPGQYGIPRPWYFPCTKSYW--FGEESDEKSHPGSNQKRISEICM---EEEPTHLKLGVSIQNLVKVYRDGMKVAVDGLALNFYEGQITSFLGHNGAGKTTTMSILTGLFPPTSGTAYILGKDIRSEMSTIRQNLGVCPQHNVLFDMLTVEEHIWFYARLKGLSEKHVKAEMEQMALDVGLPSSKLKSKTSQLSGGMQRKLSVALAFVGGSKVVILDEPTAGVDPYSRRGIWELLLKYRQ-GRTIILSTHHMDEADVLGDRIAIISHGKLCCVGSSLFLKNQLGTGYYLTLVKKDVESSLSSCRNSSSTVSYLKKEDSVSQSSSDAGLGSDHESDTLTIDVSAISNLIRKHVSEARLVEDIGHELTYVLPYEAAKEGAFVELFHEIDDRLSDLGISSYGISETTLEEIFLKVAEESG---------------VDAETSDGTLPARRNRRAFGDKQSCLRPFTEDDAADPNDSDIDPESRETDLLSGMDGKGSYQVKGWKLTQQQFVALLWKRLLIARRSRKGFFAQIVLPAVFVCIALVFSLIVPPFGKYPSLELQPWMYNEQY------TFVSNDAPEDTGTLELLNALTKDPG-FGTRCMEGNPIPDTPCQAGEEEWTTAPVPQTIMDLFQNGNWTMQNP------SPACQCSSDKIKKMLPVCPP-GAGGLPPPQRKQNTADILQDLTGRNISDYLVKTYVQIIAKSLKNKIWVNEFRYGGF-----SLGVSNTQALPPSQEVNDAIKQMKKHLKLAKDSSAD----RFLNSLGRFMTGLDTKNNV-KVWFNNKGWHAISSFLNVINNAILRANLQKGENPSHYGITAFNHPLNLTKQQLSEVALMTTSVDVLVSICVIFAMSFVPASFVVFLIQERVSKAKHLQFISGVKPVIYWLSNFVWDMCNYVVPATLVIIIFICFQQKSYVSSTNLPVLALLLLLYGWSITPLMYPASFVFKIPSTAYVVLTSVNLFIGINGSVATFVLELFT--DNKLNNINDILKSVFLIFPHFCLGRGLIDMVKNQAMADALERFGENRFVSPLSWDLVGRNLFAMAVEGVVFFLITVLIQ--YRFFIRPRPVNAKLSP---LNDEDEDVRRERQRI-LDGGGQNDILEIKELTKIY--------------------RRKRKPAVDRICVGIPPGECFGLLGVNGAGKSSTFKMLTGDTTVTRGDAFLNKNSILSNIHEVHQNMGYCPQFDAITELLTGREHVEFFALLRGVPEKEVGKVGEWAIRKLGLVKYGEKYAGNYSGGNKRKLSTAMALIGGPPVVFLDEPTTGMDPKARRFLWNCALSVVKEGR-SVVLTSHSMEECEALCTRMAIMVNGRFRCLGSVQHLKNRFGDGYTIVVRIAGSNPDLKPVQDFFGL----AFPGSVLKEKHRNMLQYQLPSSLSSLARIFSILSQSKKRLHIEDYSVSQTTLDQVFVNFAKDQS 2225          
BLAST of ATP-binding cassette sub-family A member 1 vs. UniProt/SwissProt
Match: sp|P41233|ABCA1_MOUSE (Phospholipid-transporting ATPase ABCA1 OS=Mus musculus OX=10090 GN=Abca1 PE=1 SV=4)

HSP 1 Score: 1105.12 bits (2857), Expect = 0.000e+0
Identity = 690/1951 (35.37%), Postives = 1060/1951 (54.33%), Query Frame = 1
Query:  661 KYLSVDYFHRQLLEMTAPIIFGKIYFTPDSEFTRQIIKKANITFEILDNLR-LSAVEWRLNFRDWL----SNQVNNSSTLDNMSNNAKVCMETSQNYYTVCQ-----LIYKSSDRNRIQNSIEIASRIFD-------LIERGLNCTELNKFQPMKSKVDIDNLAQNKL--INIFAGVVFNESFQYLTLNNATV---LNYQIRMPTNRIDSTKNFKVLDTFWNPIPRRDTIYDLKYYTSGFLFLQEAFDQAFIELVTGNVTINIGTSMQIMPYPCFVDDRFIKFLSMIMPFILIIAWTPSVTIIIKSIVYEKENRLKEFMLLMGLTNFVHWCSWFISTIVVLIFPVIFMTLILKYNEIIQFSSPGIIFILILSYVISFICQSFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENIAIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGL-SKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFL-EKSFE---------------IQSETCHNNKASESG--------------TKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQITSEMLDTLTDGGNLPRPVSVLSFRKKTI--------NTANINDPKVSFEFENNLVL----------LSGLSLIFQQISGLFIKRFHHTKRNIKGXXXXXXXXXXXXXXXXXXXXXXXXMDNQPSMTISPWLMMPKTRLVNLNTFYRKENTSDQISFKLNENYRSDIGQSGVRCM------NTSLYQLENFKCLYP--------YNTNKWSEKSPIEISLVTPECDCSTTGNQ----ICSSPLSGGPESSNRIMASSDRLYDLSSYNISDYLMKNFKTFIMK-----------QYGGLQFILPSFFGQSCQVIGESQIWFD----FRQSINSSRDNNSNPEQVKFLNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFSYLRYNIS---GGDENYNAFEWDITGNKICSLGILFVGWCLIIVFMESKHKKTLCIKLKDVKLKPYEIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFDSSV-KLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKNDS 6189
            K L      R + +   P++ GKI +TPD+  TRQ++ + N TF+ L     L  +   L+ + W     S +++   TL +   N +   +         Q     L     D      S+      F+        I R + C  LNK +P+ ++V + N +   L     +AG+VF      +T ++  +   + Y+IRM  + ++ T   K+ D +W+P PR D   D++Y   GF +LQ+  +QA I ++TG+     G  +Q MPYPC+VDD F++ +S  MP  + +AW  SV +IIKSIVYEKE RLKE M +MGL N + W SWF+S+++ L+     + +ILK   ++ +S P ++F+ +  + +  I Q F+IS  F  +N+AA  GGI+YF  YLP+++ + +QD +   +     LL+ V+F     +    E+   G Q+ NLF S + +  F +   + M+  D+  Y ++ WY+EAVFPG+YG+P+PWYF  T+ YW       + I+   +    ++ ++    E+EP  L +G+ I+NLVK +      A+D L L FY+ QIT FLGHNGAGKTTT+SILTG+  PTSGTA+IL  DIR +M  IR  +G+CPQHN+LF  LTVE+HI+FY  LKG+++  +K ++  +  +VGL   KLK  +  LSGGM+RKLS+A+AFVG S+++ LDEPTAGVDP+SRRGIW+L++KYR   RTIIL+THHMDEAD L DRIAIIS GKL C GSSLFLK   G GYYL L +K  E               ++ E   +  +S++G              + +   I+K +  ++L+++   + T VL + +     F  LF ++D  L  L I+SYG+S+T+LEE+FLKVA++                 +D  T  G LP   +  +F  K          +  + ND  +  E     +L          L G  L  QQ   L  KR    +R+ KG F++++LP + + +      I       PS+ + PW+   +       TF   +   D  + +L      D G  G RCM      +T     E    + P        +    W+ K+P      +P C CS+   +    +C    +GG     R   ++D L +L+  NISDYL+K +   I K           +YGG      S    + Q +  S    D     ++ +  ++D++++    +FL+    F      K N+ ++W N+KG+ ++ ++ N+ +N +LR+ +   +    YGI   N+PL  T+  L         ++V ++I VIF +SF+PASFV+FLI+ERV+ +K  Q++SGV P +YW+SNF WD   Y +   +VI+ F+ F  +SY+ S N+    +LL LY  ++ P MYP SF     STA+VV+++ NL +G   ++ TF L+L+   +  L   ND LK +FLIFP + LGRG+ID+  +    +     G +   +   WD+ G  + ++ +  V + LI V ++ +      I+ + VK K    + DED DV +ER+RI L+    ND+L++  LTKIY                      KRK AV+ I  G+  GECFGLLGVNGAGK+TTFKML G+  +T G+A +N  SI+ +  + H+NMG+CPQFDA+  LLT  E + F+  +RG+   ++    + +++ L L  +  K     SGGNKRK+ TA+ALIG P +VFLDEPT GMD  ARRFLW    ++  E + +V+LTSH+MEECE LC R+AIMV+G  + +GSVQHLK++FG  Y + +R+  +   L    E   +     +  + +KE++  +++Y+  SS+  L+ IF +    +    +++YSVSQ +LD+VF+NFAK+ S
Sbjct:  360 KNLESSPLSRIIWKALKPLLVGKILYTPDTPATRQVMAEVNKTFQELAVFHDLEGMWEELSPQIWTFMENSQEMDLVRTLLDSRGNDQFWEQKLDGLDWTAQDIMAFLAKNPEDVQSPNGSVYTWREAFNETNQAIQTISRFMECVNLNKLEPIPTEVRLINKSMELLDERKFWAGIVFTG----ITPDSVELPHHVKYKIRMDIDNVERTN--KIKDGYWDPGPRADPFEDMRYVWGGFAYLQDVVEQAIIRVLTGSEK-KTGVYVQQMPYPCYVDDIFLRVMSRSMPLFMTLAWIYSVAVIIKSIVYEKEARLKETMRIMGLDNGILWFSWFVSSLIPLLVSAGLLVVILKLGNLLPYSDPSVVFVFLSVFAMVTILQCFLISTLFSRANLAAACGGIIYFTLYLPYVLCVAWQDYVGFSIKIFASLLSPVAFGFGCEYFALFEEQGIGVQWDNLFESPVEEDGFNLTTAVSMMLFDTFLYGVMTWYIEAVFPGQYGIPRPWYFPCTKSYWF-----GEEIDEKSHPGSSQKGVSEICMEEEPTHLRLGVSIQNLVKVYRDGMKVAVDGLALNFYEGQITSFLGHNGAGKTTTMSILTGLFPPTSGTAYILGKDIRSEMSSIRQNLGVCPQHNVLFDMLTVEEHIWFYARLKGLSEKHVKAEMEQMALDVGLPPSKLKSKTSQLSGGMQRKLSVALAFVGGSKVVILDEPTAGVDPYSRRGIWELLLKYRQ-GRTIILSTHHMDEADILGDRIAIISHGKLCCVGSSLFLKNQLGTGYYLTLVKKDVESSLSSCRNSSSTVSCLKKEDSVSQSSSDAGLGSDHESDTLTIDVSAISNLIRKHVSEARLVEDIGHELTYVLPYEAAKEGAFVELFHEIDDRLSDLGISSYGISETTLEEIFLKVAEESG---------------VDAETSDGTLPARRNRRAFGDKQSCLHPFTEDDAVDPNDSDIDPESRETDLLSGMDGKGSYQLKGWKLTQQQFVALLWKRLLIARRSRKGFFAQIVLPAVFVCIALVFSLIVPPFGKYPSLELQPWMYNEQY------TFVSNDAPEDMGTQELLNALTKDPG-FGTRCMEGNPIPDTPCLAGEEDWTISPVPQSIVDLFQNGNWTMKNP------SPACQCSSDKIKKMLPVCPP-GAGGLPPPQRKQKTADILQNLTGRNISDYLVKTYVQIIAKSLKNKIWVNEFRYGGF-----SLGVSNSQALPPSHEVNDAIKQMKKLLKLTKDSSAD----RFLSSLGRFMAGLDTKNNV-KVWFNNKGWHAISSFLNVINNAILRANLQKGENPSQYGITAFNHPLNLTKQQLSEVALMTTSVDVLVSICVIFAMSFVPASFVVFLIQERVSKAKHLQFISGVKPVIYWLSNFVWDMCNYVVPATLVIIIFICFQQKSYVSSTNLPVLALLLLLYGWSITPLMYPASFVFKIPSTAYVVLTSVNLFIGINGSVATFVLELFT--NNKLNDINDILKSVFLIFPHFCLGRGLIDMVKNQAMADALERFGENRFVSPLSWDLVGRNLFAMAVEGVVFFLITVLIQYR----FFIRPRPVKAK-LPPLNDEDEDVRRERQRI-LDGGGQNDILEIKELTKIY--------------------RRKRKPAVDRICIGIPPGECFGLLGVNGAGKSTTFKMLTGDTPVTRGDAFLNKNSILSNIHEVHQNMGYCPQFDAITELLTGREHVEFFALLRGVPEKEVGKVGEWAIRKLGLVKYGEKYASNYSGGNKRKLSTAMALIGGPPVVFLDEPTTGMDPKARRFLWNCALSIVKEGR-SVVLTSHSMEECEALCTRMAIMVNGRFRCLGSVQHLKNRFGDGYTIVVRIAGSNPDLKPVQEFFGL----AFPGSVLKEKHRNMLQYQLPSSLSSLARIFSILSQSKKRLHIEDYSVSQTTLDQVFVNFAKDQS 2225          
BLAST of ATP-binding cassette sub-family A member 1 vs. UniProt/SwissProt
Match: sp|O35600|ABCA4_MOUSE (Retinal-specific phospholipid-transporting ATPase ABCA4 OS=Mus musculus OX=10090 GN=Abca4 PE=2 SV=1)

HSP 1 Score: 1082.4 bits (2798), Expect = 0.000e+0
Identity = 684/2033 (33.64%), Postives = 1091/2033 (53.66%), Query Frame = 1
Query:  475 DYVVESIDLINSGNSNNVSRGINKLTTMICGSDKNDAAILIFNLNLLQRS--------------------KRSIQTCQEVYEKYLSVDYFHRQLLEMTAPIIFGKIYFTPDSEFTRQIIKKANITFEILDNLRLSAVEWR-LNFRDWL----SNQVN------NSSTLDNMSN----NAKVCMETSQNYYTVCQLIYKSSDRNRI--QNSIEIASRIFDLIERGLNCTELNKFQPMKSKVDIDNLAQNKLIN--IFAGVVFNESFQYLTLNNATVLNYQIRMPTNRIDSTKNFKVLDTFWNPIPRRDTIYDLKYYTSGFLFLQEAFDQAFIELVTGNVTINIGTSMQIMPYPCFVDDRFIKFLSMIMPFILIIAWTPSVTIIIKSIVYEKENRLKEFMLLMGLTNFVHWCSWFISTIVVLIFPVIFMTLILKYNEIIQFSSPGIIFILILSYVISFICQSFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIP----FSKNNDNIEISDNFRQREENIA-IDG-----FEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFE-IQSE--------TCHNNKASESGT-----------------KLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQIS-------HKRQE---KQITSEMLDTLTDGGNLPRPVSVLSF-RKKTINTANINDPKVSFEFENNLVLLSGLSLIFQQISGLFIKRFHHTKRNIKGXXXXXXXXXXXXXXXXXXXXXXXXMDNQPSMTISPWLMMPKTRLVNLNTFYRKENTSDQISFKLNENYRSDIGQSGVRCMNTSLYQLENFKCL---------------YPYNTNKWSEKSPIEISLVTPECDCSTTG--NQICSSPL-SGGPESSNRIMASSDRLYDLSSYNISDYLMKNFKTFIM-----------KQYGGLQF--ILPSFFGQSCQVIGESQIWF--DFRQSINSSRDNNSNPEQVKFLNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFSYLRYNIS---GGDENYNAFEWDITGNKICSLGILFVGWCLIIVFMESKHKKTLCIKLKDVKLKPYEIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLH-PNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFDSSVKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKNDSVTRNI 6204
            D +  S  L+ +G     ++ ++ L+ ++CG  +   +  +F+ N  + +                    KR+   C  + +  L  +   +       P++ GKI FTPDS   R+I+K AN TFE LD +R     W  +  + W     S Q+          T+ +  N       +  E   N+++      ++ D      ++   I  R   L  + L C  L+KF+    +V +   A + L     +AGVVF   + + +     V  Y+IRM  + ++ T   K+ D +W+  PR D + D +Y   GF +LQ+  +Q  ++         IG  +Q MPYPCFVDD F+  L+   P  +++AW  SV++ +K IV EKE RLKE +   G++N V WC+WF+ +  ++   +  +TL + +  I+ +S P I+F+ +L++  + I QSF++S  F  +++AA   G++YF  YLP ++   +QD ++ ++   V LL+ V+F     ++   E+   G Q+SN+  S +    F     + M+ +D+  Y L+AWY++ VFPG YG P PWYFL    YW+      ++    +E ++   +  E+    +G     FE+E   L  G+ ++NLVK F  S  PA+D LN+ FY++QIT FLGHNGAGKTTT+SILTG+L PTSGT  I   DI  +++++R  +G+CPQHNILF +LTV +HI FY  LKG +  E + ++  ++++ GL  K    +++LSGGM+RKLS+A+AFVG+S+++ LDEPT+GVDP+SRR IWDL++KYRS  RTII++THHMDEAD L DRIAIISQG+L C G+ LFLK  FG G+YL L +  + IQS+        +C +   S                     +L++ +   +P +KL++    +   +L + +  +  + SLF +L+ +L  L ++S+G+SDT LEE+FLKV +D    S        KR++   +   S   + L      P   S       K   +    DP V F         +G  LI Q +  L +KRFHHT R+ K   ++++LP   + L   L  I       P++T+ PW+        +  TF+  +  +++    L +   +  G  G RC+      L  + C+               + +   KW+   P      +P C CST      +   P  +GG     R   S++ L DL++ NISDYL+K +   I            ++YGG+     LP+       + GE+ + F     Q +N S    +     + L++ +    +  IK     +W N+KG+ ++ ++ N+  N +LR+++   +  + YGI V + PL  T+  L         ++  +AI VIF +SF+PASFV++LI+ERVT +K  Q++SGV+P  YW++NF WD + Y++S  +V+  F+ F  ++Y    N+ A + LL LY  AVIP MYP SF     STA+V +S  NL +G  ++  TF L+L++ ++ +L   N  L+K+ ++FP + LGRG+IDL+ S    ++    G + + N F+WD+ G  + ++ I  V + L+ + ++  H   L   + +   +P   + DED DV +ER+R+ ++     D+L++  LTK+Y+ S                       AV+ +  GV+ GECFGLLGVNGAGKTTTFKML G+  +T G+A + G SI+      H+NMG+CPQFDA+  LLT  E LY Y R+RG+   +I    +  +++L L+ + ++     SGGNKRK+ TAIAL G P ++ LDEPT GMD  ARR LW  I ++  E + AV+LTSH+MEECE LC RLAIMV G  + +G++QHLK KFG  Y V +++  P  + L D N +E         S + +E +  +++++  SS  L+ IF++    + + +++EYSV+Q +LD+VF+NFAK  + T ++
Sbjct:  295 DLLWVSRPLLQNGGPETFTQLMSILSDLLCGYPEGGGS-RVFSFNWYEDNNYKAFLGIDSTRKDPAYSYDKRTTSFCNSLIQS-LESNPLTKIAWRAAKPLLMGKILFTPDSPAARRIMKNANSTFEELDRVRKLVKAWEEVGPQIWYFFEKSTQMTVIRDTLQHPTVKDFINRQLGEEGITTEAVLNFFSNGPQEKQADDMTSFDWRDIFNITDRFLRLANQYLECLVLDKFESYDDEVQLTQRALSLLEENRFWAGVVFPGMYPWASSLPPHV-KYKIRMDIDVVEKTN--KIKDRYWDSGPRADPVEDFRYIWGGFAYLQDMVEQGIVK-SQMQAEPPIGVYLQQMPYPCFVDDSFMIILNRCFPIFMVLAWIYSVSMTVKGIVLEKELRLKETLKNQGVSNAVIWCTWFLDSFSIMALSIFLLTLFIMHGRILHYSDPFILFLFLLAFATATIMQSFLLSTLFSKASLAAACSGVIYFTLYLPHVLCFAWQDRMTADLKTTVSLLSSVAFGFGTEYLVRFEEQGLGLQWSNIGKSPLEGDEFSFLLSMKMMLLDAALYGLLAWYLDQVFPGDYGTPLPWYFLLQESYWLGGEGCSTREERALEKTEPLTEEMEDPEHPEGMNDSFFERELPGLVPGVCVKNLVKVFEPSGRPAVDRLNITFYENQITAFLGHNGAGKTTTLSILTGLLPPTSGTVLIGGKDIETNLDVVRQSLGMCPQHNILFHHLTVAEHILFYAQLKGRSWEEAQLEMEAMLEDTGLHHKRNEEAQDLSGGMQRKLSVAIAFVGDSKVVVLDEPTSGVDPYSRRSIWDLLLKYRS-GRTIIMSTHHMDEADLLGDRIAIISQGRLYCSGTPLFLKNCFGTGFYLTLVRKMKNIQSQRGGCEGVCSCTSKGFSTRCPTRVDEITEEQVLDGDVQELMDLVYHHVPEAKLVECIGQELIFLLPNKNFKQRAYASLFRELEETLADLGLSSFGISDTPLEEIFLKVTEDAGAGSMFVGGAQQKREQAGLRHPCSAPTEKLRQYAQAPHTCSPGQVDPPKGQPSPEPEDPGVPFN--------TGARLILQHVQALLVKRFHHTIRSRKDFVAQIVLPATFVFLALMLSIIVPPFGEFPALTLHPWMYG------HQYTFFSMDEPNNEHLEVLADVLLNRPG-FGNRCLKEEW--LPEYPCINATSWKTPSVSPNITHLFQKQKWTAAHP------SPSCKCSTREKLTMLPECPEGAGGLPPPQRTQRSTEVLQDLTNRNISDYLVKTYPALIRSSLKSKFWVNEQRYGGISIGGKLPAI-----PISGEALVGFLSGLGQMMNVSGGPVTREASKEMLDFLKHLETTDNIK-----VWFNNKGWHALVSFLNVAHNAILRASLPRDRDPEEYGITVISQPLNLTKEQLSDITVLTTSVDAVVAICVIFAMSFVPASFVLYLIQERVTKAKHLQFISGVSPTTYWLTNFLWDIMNYAVSAGLVVGIFIGFQKKAYTSPDNLPALVSLLMLYGWAVIPMMYPASFLFEVPSTAYVALSCANLFIGINSSAITFVLELFE-NNRTLLRFNAMLRKLLIVFPHFCLGRGLIDLALSQAVTDVYAQFGEEYSANPFQWDLIGKNLVAMAIEGVVYFLLTLLIQ--HHFFLTRWIAEPAREP---VFDEDDDVAEERQRV-MSGGNKTDILKLNELTKVYSGS--------------------SSPAVDRLCVGVRPGECFGLLGVNGAGKTTTFKMLTGDTTVTSGDATVAGKSILTSISDVHQNMGYCPQFDAIDDLLTGREHLYLYARLRGVPSKEIEKVANWGIQSLGLSLYADRLAGTYSGGNKRKLSTAIALTGCPPLLLLDEPTTGMDPQARRMLWNTIVSIIREGR-AVVLTSHSMEECEALCTRLAIMVKGTFQCLGTIQHLKYKFGDGYIVTMKIKSPKDDLLPDLNPVEQFFQGNFPGSVQ-RERHHSMLQFQVPSS-SLARIFQLLISHKDSLLIEEYSVTQTTLDQVFVNFAKQQTETYDL 2257          
BLAST of ATP-binding cassette sub-family A member 1 vs. UniProt/SwissProt
Match: sp|P78363|ABCA4_HUMAN (Retinal-specific phospholipid-transporting ATPase ABCA4 OS=Homo sapiens OX=9606 GN=ABCA4 PE=1 SV=3)

HSP 1 Score: 1066.99 bits (2758), Expect = 0.000e+0
Identity = 672/1934 (34.75%), Postives = 1054/1934 (54.50%), Query Frame = 1
Query:  712 PIIFGKIYFTPDSEFTRQIIKKANITFEILDNLRLSAVEWR-LNFRDW--LSNQVNNSSTLDNMSNNA------KVCMETSQNYYTVCQLIYKSSDRNRI--------QNSIEIASRIFDLIERGLNCTELNKFQPMKSKVDIDNLAQNKLI-NIF-AGVVFNESFQYLTLNNATVLNYQIRMPTNRIDSTKNFKVLDTFWNPIPRRDTIYDLKYYTSGFLFLQEAFDQAFIELVTGNVTINIGTSMQIMPYPCFVDDRFIKFLSMIMPFILIIAWTPSVTIIIKSIVYEKENRLKEFMLLMGLTNFVHWCSWFISTIVVLIFPVIFMTLILKYNEIIQFSSPGIIFILILSYVISFICQSFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIP----FSKNNDNIEISDNFRQREEN------IAIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFE-IQSE------TCHNNKASESGT-------------------KLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADD-------PSQISHKRQEKQITSEMLDTLTDGGNLPRPVSVLSFRKKTINTANINDPKVSFEFENNLVLLSGLSLIFQQISGLFIKRFHHTKRNIKGXXXXXXXXXXXXXXXXXXXXXXXXMDNQPSMTISPWLMMPKTRLVNLNTFYRKENTSDQISFKLNENYRSDIGQSGVRCMNTSLYQLENFKC--LYPYNT-------------NKWSEKSPIEISLVTPECDCSTTG--NQICSSPL-SGGPESSNRIMASSDRLYDLSSYNISDYLMKNFKTFIM-----------KQYGGLQFILPSFFGQ--SCQVIGESQIWF--DFRQSINSSRDNNSNPEQVKFLNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFS------YLRYNISGGDENYNAFEWDITGNKICSLGILFVGWCLIIVFMESKHKKTLCIKLKDVKLKPY-EIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLH-PNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFDSSVKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKNDSVTRNI 6204
            P++ GKI +TPDS   R+I+K AN TFE L+++R     W  +  + W    N    +   D + N        +   E       +   +YK    ++         ++   I  R   L+ + L C  L+KF+    +  +   A + L  N+F AGVVF + + + T +    + Y+IRM  + ++ T   K+ D +W+  PR D + D +Y   GF +LQ+  +Q  I          +G  +Q MPYPCFVDD F+  L+   P  +++AW  SV++ +KSIV EKE RLKE +   G++N V WC+WF+ +  ++   +  +T+ + +  I+ +S P I+F+ +L++  + I   F++S FF  +++AA   G++YF  YLP ++   +QD ++ E+   V LL+ V+F     ++   E+   G Q+SN+ NS      F     + M+ +D+  Y L+AWY++ VFPG YG P PWYFL    YW+      ++    +E ++   +  E+      I    FE+E      G+ ++NLVK F     PA+D LN+ FY++QIT FLGHNGAGKTTT+SILTG+L PTSGT  +   DI   ++ +R  +G+CPQHNILF +LTV +H+ FY  LKG ++ E + ++  ++++ GL  K    +++LSGGM+RKLS+A+AFVG+++++ LDEPT+GVDP+SRR IWDL++KYRS  RTII++THHMDEAD L DRIAII+QG+L C G+ LFLK  FG G YL L +  + IQS+      TC  +    S T                   +L++ +   +P +KL++    +   +L + +     + SLF +L+ +L  L ++S+G+SDT LEE+FLKV +D             KR+        L      G  P+  +V S        A+               L +G  L+ Q +  L +KRF HT R+ K   ++++LP   + L   L  +       P++T+ PW+   +    +++     E  S+Q  F +  +   +    G RC+      L  + C    P+ T              KW++ +P      +P C CST      +   P  +GG     R   S++ L DL+  NISD+L+K +   I            ++YGG+     S  G+     + GE+ + F  D  + +N S    +     +  ++ +       IK     +W N+KG+ ++ ++ N+  N +LR+++   ++ + YGI V + PL  T+  L         ++  +AI VIF +SF+PASFV++LI+ERV  SK  Q++SGV+P  YW++NF WD + YS+S  +V+  F+ F  ++Y   +N+ A + LL LY  AVIP MYP SF     STA+V +S  NL +G  ++  TF L+L++ ++ +L   N  L+K+ ++FP + LGRG+IDL+ S      Y R+   G + + N F WD+ G  + ++ +  V + L+ + ++ +H       L     +P  E I DED DV +ER+RI +      D+L+++ LTKIY                  SS      AV+ +  GV+ GECFGLLGVNGAGKTTTFKML G+  +T G+A + G SI+ +  + H+NMG+CPQFDA+  LLT  E LY Y R+RG+   +I    + S+K+L LT + +      SGGNKRK+ TAIALIG P +V LDEPT GMD  ARR LW +I ++  E + AV+LTSH+MEECE LC RLAIMV G  + +G++QHLKSKFG  Y V +++  P  + L D N +E         S + +E +  +++++  SS  L+ IF++    + + +++EYSV+Q +LD+VF+NFAK  + + ++
Sbjct:  392 PLLMGKILYTPDSPAARRILKNANSTFEELEHVRKLVKAWEEVGPQIWYFFDNSTQMNMIRDTLGNPTVKDFLNRQLGEEGITAEAILNFLYKGPRESQADDMANFDWRDIFNITDRTLRLVNQYLECLVLDKFESYNDETQLTQRALSLLEENMFWAGVVFPDMYPW-TSSLPPHVKYKIRMDIDVVEKTN--KIKDRYWDSGPRADPVEDFRYIWGGFAYLQDMVEQG-ITRSQVQAEAPVGIYLQQMPYPCFVDDSFMIILNRCFPIFMVLAWIYSVSMTVKSIVLEKELRLKETLKNQGVSNAVIWCTWFLDSFSIMSMSIFLLTIFIMHGRILHYSDPFILFLFLLAFSTATIMLCFLLSTFFSKASLAAACSGVIYFTLYLPHILCFAWQDRMTAELKKAVSLLSPVAFGFGTEYLVRFEEQGLGLQWSNIGNSPTEGDEFSFLLSMQMMLLDAAVYGLLAWYLDQVFPGDYGTPLPWYFLLQESYWLGGEGCSTREERALEKTEPLTEETEDPEHPEGIHDSFFEREHPGWVPGVCVKNLVKIFEPCGRPAVDRLNITFYENQITAFLGHNGAGKTTTLSILTGLLPPTSGTVLVGGRDIETSLDAVRQSLGMCPQHNILFHHLTVAEHMLFYAQLKGKSQEEAQLEMEAMLEDTGLHHKRNEEAQDLSGGMQRKLSVAIAFVGDAKVVILDEPTSGVDPYSRRSIWDLLLKYRS-GRTIIMSTHHMDEADLLGDRIAIIAQGRLYCSGTPLFLKNCFGTGLYLTLVRKMKNIQSQRKGSEGTCSCSSKGFSTTCPAHVDDLTPEQVLDGDVNELMDVVLHHVPEAKLVECIGQELIFLLPNKNFKHRAYASLFRELEETLADLGLSSFGISDTPLEEIFLKVTEDSDSGPLFAGGAQQKRENVNPRHPCLGPREKAGQTPQDSNVCS---PGAPAAHPEGQPPPEPECPGPQLNTGTQLVLQHVQALLVKRFQHTIRSHKDFLAQIVLPATFVFLALMLSIVIPPFGEYPALTLHPWIYGQQYTFFSMD-----EPGSEQ--FTVLADVLLNKPGFGNRCLKEGW--LPEYPCGNSTPWKTPSVSPNITQLFQKQKWTQVNP------SPSCRCSTREKLTMLPECPEGAGGLPPPQRTQRSTEILQDLTDRNISDFLVKTYPALIRSSLKSKFWVNEQRYGGI-----SIGGKLPVVPITGEALVGFLSDLGRIMNVSGGPITREASKEIPDFLKHLETEDNIK-----VWFNNKGWHALVSFLNVAHNAILRASLPKDRSPEEYGITVISQPLNLTKEQLSEITVLTTSVDAVVAICVIFSMSFVPASFVLYLIQERVNKSKHLQFISGVSPTTYWVTNFLWDIMNYSVSAGLVVGIFIGFQKKAYTSPENLPALVALLLLYGWAVIPMMYPASFLFDVPSTAYVALSCANLFIGINSSAITFILELFE-NNRTLLRFNAVLRKLLIVFPHFCLGRGLIDLALSQAVTDVYARF---GEEHSANPFHWDLIGKNLFAMVVEGVVYFLLTLLVQ-RH-----FFLSQWIAEPTKEPIVDEDDDVAEERQRI-ITGGNKTDILRLHELTKIYP---------------GTSSP-----AVDRLCVGVRPGECFGLLGVNGAGKTTTFKMLTGDTTVTSGDATVAGKSILTNISEVHQNMGYCPQFDAIDELLTGREHLYLYARLRGVPAEEIEKVANWSIKSLGLTVYADCLAGTYSGGNKRKLSTAIALIGCPPLVLLDEPTTGMDPQARRMLWNVIVSIIREGR-AVVLTSHSMEECEALCTRLAIMVKGAFRCMGTIQHLKSKFGDGYIVTMKIKSPKDDLLPDLNPVEQFFQGNFPGSVQ-RERHYNMLQFQVSSS-SLARIFQLLLSHKDSLLIEEYSVTQTTLDQVFVNFAKQQTESHDL 2258          
BLAST of ATP-binding cassette sub-family A member 1 vs. UniProt/SwissProt
Match: sp|Q8IZY2|ABCA7_HUMAN (Phospholipid-transporting ATPase ABCA7 OS=Homo sapiens OX=9606 GN=ABCA7 PE=1 SV=3)

HSP 1 Score: 1034.63 bits (2674), Expect = 0.000e+0
Identity = 633/1926 (32.87%), Postives = 1021/1926 (53.01%), Query Frame = 1
Query:  640 TCQEVYEKYLSVDYFHRQLLEMTAPIIFGKIYFTPDSEFTRQIIKKANITFEILDNLRLSAVEWRL------NFRDWLSNQVNNSSTLDNMSNNAKVCMETSQNYYTVCQ-LIYKSSDRNRIQNSIEIASRIFDLIERGLNCTELNKFQPMKSKVDIDNLAQNKLI--NIFAGVVF------NESFQYLTLN-NATVLNYQIRMPTNRIDSTKNFKVLDTFWNPIPRRDTIYDLKYYTSGFLFLQEAFDQAFIELVTGNVTINIGTSMQIMPYPCFVDDRFIKFLSMIMPFILIIAWTPSVTIIIKSIVYEKENRLKEFMLLMGLTNFVHWCSWFISTIVVLIFPVIFMTLILKYNEIIQFSSPGIIFILILSYVISFICQSFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENIAIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFL-----------------EKSFEIQSETCHNNKASESGT-KLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQITSEMLDTLTDGGNLPRPVSVLSFRKKTINTANINDPKVSFEFENN-------LVLLSGLSLIFQQISGLFIKRFHHTKRNIKGXXXXXXXXXXXXXXXXXXXXXXXXMDNQPSMTISPWLMMPKTRLVNLNTFYRKENTSDQISFKLNENYRSDIG------QSGVRCMNTSLYQLENFKCLYPYNTNKWSEKSPIEISLVTPECDCSTTGNQI----CSSPLSGGPESSNRIMASSDRLYDLSSYNISDYLMKNFKTFIMK-----------QYGGLQFILPSFFGQSCQVIGES--QIWFDFRQSINSSRDNNSNPEQVKFLNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDL--------SFSYLRYNISGGDENYNA-FEWDITGNKICSLGILFVGWCLIIVFMESKHKKTLCIKLKDVKLKPYEIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFDSSVKLSDIFRVFEDLRTN---EMVKEYSVSQMSLDEVFINFAKNDS 6189
             C E+    L      R L     P+I GK+ F PD+ FTR+++ + N TFE L  LR     W +       F +  SN       L       +      +++    +  +   S     Q++      +   + R   C  L+K +   S+  + + A   L     +AGVVF      ++  ++ T +     +  +IRM  + +  T+  K+ D FW+P P  D + DL+Y   GF++LQ+  ++A + +++G      G  +Q MPYPC+VDD F++ LS  +P  L +AW  SVT+ +K++V EKE RL++ M  MGL+  V W  WF+S +   +     + L+LK  +I+ +S PG++F+ + ++ ++ + QSF++S FF  +N+AA  GG+ YF  YLP+++ + ++D L         LL+ V+F      +  LE+  +GAQ+ N+      D+ F +     ++ +D+  Y L  WY+EAV PG+YG+P+PW F F R YW                   +  + +   E+ P  L  G+ + +L K+FP S  PAL  L+L FYQ  IT FLGHNGAGKTTT+SIL+G+  P+ G+AFIL +D+R  M  IR  +G+CPQ+N+LF  LTV++H++FYG LKG++ + +  +   ++++VGL  K    +++LSGGM+RKLS+A+AFVG S+++ LDEPTAGVDP SRRGIW+L++KYR   RT+IL+THH+DEA+ L DR+A+++ G+L CCGS LFL+++ G GYYL L                 E S + + E  + ++ S  GT +LL  ++  +P ++L++E   +  +VL +   +   F +LF +LD+ L  L++  YG+SDTSLEE+FLKV ++ +  +    E     + L T   G ++      L  +     TA  N        E +       +  + G +L  QQ+  L +KRF   +R+ +GLF++++LP L + L      I     + P++ +SP +   +       +F+ ++   D    +L E    + G      Q      +      E  K L    +  W+ +SP      +P C CS  G +     C +   G       +  S + + +L+  N+SD+L+K +   + +           +YGG           S Q +G S  ++W         + D        + L     + +S   + +L +IW N+KG+ SM A+ N  SN +LR+ +    A   + I   N+PL  T+  L         ++V ++I V+F +SF+PASF + LIEERVT +K  Q + G++P +YW+ NF WD   Y +   IV+L FLAF  ++Y+   N+ A ++LL LY  ++ P MYP SFF S  STA+VV++  NL +G   ++ TF L+L  + D  L+  +  LK++FLIFP + LGRG+ID+        +F  L      GD  + +   W++ G  +  L ++  G   ++  +  +H+  L   L   +++   ++ +ED DV +ERER+ +      DVL +  LTK+Y                      +R  AV+ +  G+  GECFGLLGVNGAGKT+TF+M+ G+   + G A++ G+S+  +   AH +MG+CPQ DA+  LLT  E L    R+RG+  + +       L  L L+ + ++P    SGGNKRK+ TA+AL+G P +VFLDEPT GMD  ARRFLW  +  +  E + +V+LTSH+MEECE LC RLAIMV+G  + +GS QHLK +F   + + +R+       + R++         +  A ++E +   + ++     + + + RVF +L  +     V+++SVSQ  L+EVF+ F+K+  
Sbjct:  266 ACSELI-GALDSHPLSRLLWRRLKPLILGKLLFAPDTPFTRKLMAQVNRTFEELTLLRDVREVWEMLGPRIFTFMNDSSNVAMLQRLLQMQDEGRRQPRPGGRDHMEALRSFLDPGSGGYSWQDAHADVGHLVGTLGRVTECLSLDKLEAAPSEAALVSRALQLLAEHRFWAGVVFLGPEDSSDPTEHPTPDLGPGHVRIKIRMDIDVV--TRTNKIRDRFWDPGPAADPLTDLRYVWGGFVYLQDLVERAAVRVLSG-ANPRAGLYLQQMPYPCYVDDVFLRVLSRSLPLFLTLAWIYSVTLTVKAVVREKETRLRDTMRAMGLSRAVLWLGWFLSCLGPFLLSAALLVLVLKLGDILPYSHPGVVFLFLAAFAVATVTQSFLLSAFFSRANLAAACGGLAYFSLYLPYVLCVAWRDRLPAGGRVAASLLSPVAFGFGCESLALLEEQGEGAQWHNVGTRPTADV-FSLAQVSGLLLLDAALYGLATWYLEAVCPGQYGIPEPWNFPFRRSYWCGPRPPKSPAPCPTPL---DPKVLV---EEAPPGLSPGVSVRSLEKRFPGSPQPALRGLSLDFYQGHITAFLGHNGAGKTTTLSILSGLFPPSGGSAFILGHDVRSSMAAIRPHLGVCPQYNVLFDMLTVDEHVWFYGRLKGLSAAVVGPEQDRLLQDVGLVSKQSVQTRHLSGGMQRKLSVAIAFVGGSQVVILDEPTAGVDPASRRGIWELLLKYRE-GRTLILSTHHLDEAELLGDRVAVVAGGRLCCCGSPLFLRRHLGSGYYLTLVKARLPLTTNEKADTDMEGSVDTRQEKKNGSQGSRVGTPQLLALVQHWVPGARLVEELPHELVLVLPYTGAHDGSFATLFRELDTRLAELRLTGYGISDTSLEEIFLKVVEECA--ADTDMEDGSCGQHLCTGIAGLDV-----TLRLKMPPQETALENGEPAGSAPETDQGSGPDAVGRVQGWALTRQQLQALLLKRFLLARRSRRGLFAQIVLPALFVGLALVFSLIVPPFGHYPALRLSPTMYGAQV------SFFSEDAPGDPGRARLLEALLQEAGLEEPPVQHSSHRFSAPEVPAEVAKVL---ASGNWTPESP------SPACQCSRPGARRLLPDCPAAAGGP-PPPQAVTGSGEVVQNLTGRNLSDFLVKTYPRLVRQGLKTKKWVNEVRYGGFSLGGRDPGLPSGQELGRSVEELWALLSPLPGGALD--------RVLKNLTAWAHSLDAQDSL-KIWFNNKGWHSMVAFVNRASNAILRAHLPPGPARHAHSITTLNHPLNLTKEQLSEGALMASSVDVLVSICVVFAMSFVPASFTLVLIEERVTRAKHLQLMGGLSPTLYWLGNFLWDMCNYLVPACIVVLIFLAFQQRAYVAPANLPALLLLLLLYGWSITPLMYPASFFFSVPSTAYVVLTCINLFIGINGSMATFVLEL--FSDQKLQEVSRILKQVFLIFPHFCLGRGLIDMVRNQAMADAFERL------GDRQFQSPLRWEVVGKNL--LAMVIQGPLFLLFTLLLQHRSQL---LPQPRVRSLPLLGEEDEDVARERERV-VQGATQGDVLVLRNLTKVYR--------------------GQRMPAVDRLCLGIPPGECFGLLGVNGAGKTSTFRMVTGDTLASRGEAVLAGHSVAREPSAAHLSMGYCPQSDAIFELLTGREHLELLARLRGVPEAQVAQTAGSGLARLGLSWYADRPAGTYSGGNKRKLATALALVGDPAVVFLDEPTTGMDPSARRFLWNSLLAVVREGR-SVMLTSHSMEECEALCSRLAIMVNGRFRCLGSPQHLKGRFAAGHTLTLRVP------AARSQPAAAFVAAEFPGAELREAHGGRLRFQLPPGGRCA-LARVFGELAVHGAEHGVEDFSVSQTMLEEVFLYFSKDQG 2105          

HSP 2 Score: 152.91 bits (385), Expect = 1.955e-35
Identity = 102/357 (28.57%), Postives = 175/357 (49.02%), Query Frame = 1
Query: 5251 INVSSEDKR-----KLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYY---VKIRLHPNRNSLSD---RNEIETIINK------------------EIW-SSARMKEENA----VIIEYRFDSSVKLSDIFRVFEDLRTNEM-VKEYSVSQMSLDEVFINFAKNDSVTRNISNGN 6216
            ++V S +KR     + A+  +S    +G     LG NGAGKTTT  +L G    + G+A I G+ +         ++G CPQ++ L  +LT +E ++FY R++G+  + +    D  L+++ L    +  T  +SGG +RK+  AIA +G  ++V LDEPT G+D  +RR +W L+  L       +IL++H+++E E+L  R+A++  G +   GS   L+   G  YY   VK RL    N  +D      ++T   K                  + W   AR+ EE      +++ Y        + +FR   D R  E+ +  Y +S  SL+E+F+   +  +   ++ +G+
Sbjct:  807 VSVRSLEKRFPGSPQPALRGLSLDFYQGHITAFLGHNGAGKTTTLSILSGLFPPSGGSAFILGHDVRSSMAAIRPHLGVCPQYNVLFDMLTVDEHVWFYGRLKGLSAAVVGPEQDRLLQDVGLVSKQSVQTRHLSGGMQRKLSVAIAFVGGSQVVILDEPTAGVDPASRRGIWELL--LKYREGRTLILSTHHLDEAELLGDRVAVVAGGRLCCCGSPLFLRRHLGSGYYLTLVKARLPLTTNEKADTDMEGSVDTRQEKKNGSQGSRVGTPQLLALVQHWVPGARLVEELPHELVLVLPYTGAHDGSFATLFREL-DTRLAELRLTGYGISDTSLEEIFLKVVEECAADTDMEDGS 1160          
BLAST of ATP-binding cassette sub-family A member 1 vs. TrEMBL
Match: N1PB02 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_226736 PE=4 SV=1)

HSP 1 Score: 1265.37 bits (3273), Expect = 0.000e+0
Identity = 730/1909 (38.24%), Postives = 1118/1909 (58.56%), Query Frame = 1
Query:  643 CQEVYEKYLS---VDYFHRQLLEMTAPIIFGKIYFTPDSEFTRQIIKKANITFEILDNLRLSAVEWRLNFRDWLSNQVNNSSTLDN---------MSNNAKVCMETSQNYYTVCQLIYKSSDRNRI--QNSIEIASRIFDLIERGLNCTELNKFQPMKSKVDIDN-----LAQNKLINIFAGVVFN-ESFQYLTLNNATVLNYQIRMPTNRIDSTKNFKVLDTFWNPIPRRDTIYDLKYYTSGFLFLQEAFDQAFIELVTGN-VTINIGTSMQIMPYPCFVDDRFIKFLSMIMPFILIIAWTPSVTIIIKSIVYEKENRLKEFMLLMGLTNFVHWCSWFISTIVVLIFPVIFMTLILKYNEIIQFSSPGIIFILILSYVISFICQSFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENIAIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEK-----------SFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQITSEMLDTLTDGGNLPRPVSVLSFRKKTINTANINDPKVSFEFENNL----------------VLLSGLSLIFQQISGLFIKRFHHTKRNIKGXXXXXXXXXXXXXXXXXXXXXXXXMDNQPSMTISPWLMMP-KTRLVNLNTFYRKENTSDQISFKLNENYRSDIGQSGVRCMNTSLYQLENFKCLYPYNTNKWSEKSPIEISLVTP-ECDCSTTGNQICSSPLSGGPESSNRIMASSDRLYDLSSYNISDYLMKNFKTFIMKQYGGLQFILPSFFGQSCQVIGESQIWFD--FRQ-SINSSRDNNSNPEQVKFLNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFSYLRYNI--SGGDENYNA-FEWDITGNKICSLGILFVGWCLIIVFMESKH--KKTLCIK-LKDVKLKPYEIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIIN--KEIWSSARMKEENAVIIEYRFDSSV--KLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAK 6180
            C +++E+  S      F RQ+     P++ GKI + PD+   R++I++AN TF  L  ++  A +W L     +S  ++NS    N         MSN     +   Q +     L     D++    ++SIE    +  +I + +NC E +KF+P K++ D+ N     +  NKL   +AG++F+ +S +    N  T + Y+IRM T+R+DST   +VLD FW P PR   + D+KY   GF ++Q+  + A I   TG+ +  +IG ++Q  PYPC+++D+F   +S  +P  +I++W  +V+I++K+IVYEKE RLKE M  MGLTN VHWC+WFI+  V+++  V  + ++LK   +++ S   +IF+ +L++ I+ I Q FMISVFF  +N+AA   GI+YFI ++P+     +++ + T       LL+ VSF    ++I   E+   G Q+SN+  S + + +F +  C+ M+ +D++ Y++IAWYVEAVFPG++G+P+ WYF  T+ YW  +    D   + +     E +    G E EP  L +G+ I+ L K + + +  A+D LNL FY+ QIT FLGHNGAGKTTT+SILTG+  PT GTA I   DIR D+  IR  +G+CPQHN+LF +LTVE+HI+FY  LKGM + +I+ ++  ++ ++GL  K    S  LSGGMKRKLS+A+AF   S+++ LDEPTAGVDP++RR IWDL++KYR+  RTIIL+TH MDEAD L DRIAII+QGKL C GSSLFLK NFG GYYL L K             ++++ T   N    S T    FI + +P + L++    + T  L ++ ++   F  LF  LD+ L  L + SYG+SDT+LEEVFLKVA++  + +H  +E     +  + LTDGG   RPV+ LSFRK+    +   +     + + N                   ++GLSLI +Q   +FIKRF++ +R+ K                         +  +P+M I PWLM P K +  +L TF+  +  S+  +  + +      G  GVRCM+  +Y L+ F+C+   ++ +WS    +E     P EC C  +G Q C    + G E+S  ++ ++D +Y+++  NISD+++K  + +I ++YGGL       FG+   ++  +    D  F Q +  ++ D+ +N      +   +    +   K N ++IW N+KGY+SM AY NI +NL+LR+ +        YGI++ N+P+  T S L+++      ++V +++ VIF +  IPASFV+FLIEERV+GSK  Q+VSGVNP VYW++NF WD + Y +S ++ IL F+AF   +Y+   N    + LL LY  A  P MYP S F +  S+AFV++   N+ +G ++T++TF L+ +   +  L   N  + K+FL+ P Y LGRG+ID++ + L  +I  + G+  + + F WDI G  + SL IL V +  + + +E K       CI   K+      E   +ED+DV +ERER+ L      D+L + GLTK+Y   +                ++K   AV+ +S GV  GECFGLLGVNGAGKTTTFKML G    T G+A + G+SI  +    H+N+G+CPQFDAL  LLT  E L  Y R+RG+   D+    +  ++ L L  H  K ++ +SGGNKRK+ TAIAL+G P ++FLDEPT GMD  ARRFLW  I  +  + + +V+LTSH+MEECE LC+R+ IMV+G+ K IGS+QHLK++FG  Y + +++    +S + + +I+ + +  +  +    +KE++  +++Y+  SSV   L+DIF   E +R    +++YSVSQ +LD+VFINFAK
Sbjct:  358 CNDLFEQIESQQLTRIFWRQI----KPMVRGKIPYAPDTPVVRRLIREANQTFVTLVQVKQLAEDW-LKASPGISEFLSNSDQARNIRDFIDLYMMSNPGDAQIALVQRW-----LFNGPRDQSAYDWRDSIEYTDYVMTMIVQYMNCFEFDKFEPHKTEEDVVNTGLTYIGDNKL---WAGLIFDIDSSE----NLPTHIKYKIRMDTDRVDSTSKSRVLDRFWTPGPRAKPLPDMKYVVYGFSYIQDMVEHAIIREHTGDSLDEDIGMTVQQFPYPCYINDKFTMAISRSLPLFMILSWIYAVSILVKAIVYEKEQRLKEVMKTMGLTNAVHWCAWFITAFVMMLLSVFLLLIVLKVGTVLEHSDGSVIFVFLLAFTIATIMQCFMISVFFQRANLAAACAGILYFIGHIPYTFCTQWEEYMRTWQKALASLLSSVSFGFGCSYIARYEEQGIGIQWSNIHQSVLQEDDFSMLACIFMMLVDALIYMIIAWYVEAVFPGQFGMPRSWYFFVTKSYWCGYEPGTDG--MPNGRAGYEMDSGQQGQEDEPKHLPLGVSIQKLCKVYKRGQKVAVDGLNLNFYEGQITSFLGHNGAGKTTTMSILTGLFPPTEGTAVIYGQDIRTDINEIRKSLGMCPQHNVLFDHLTVEEHIWFYSSLKGMPEEDIRKEMNAMIMDIGLPHKRNEYSAKLSGGMKRKLSVAIAFTAGSKVVILDEPTAGVDPYARRSIWDLLLKYRA-GRTIILSTHFMDEADILGDRIAIINQGKLCCVGSSLFLKSNFGGGYYLTLVKDERKGDSASTSDVKVENATEDGNAGEISTTA---FIMERVPEAVLVESIGIEMTYQLPNDKSHTASFEKLFRDLDAHLSSLGLLSYGVSDTTLEEVFLKVANESEEANHLSEED--VRQGTERLTDGGMYARPVTRLSFRKRNFFASKDRESNELLDADGNPDSAVSTASISCNGTGSYKVTGLSLIPRQFLAIFIKRFNYLRRSKKA-----------------------FISQEPAMEIHPWLMSPSKLQDSHLFTFFSNDLPSEAWTQAIEDLLTQKPGL-GVRCMDPDVYSLKGFRCVDAEDS-QWSN---VEEDFDEPEECSCE-SGYQRCPKG-AAGAEASKYLLPTTDEMYNMTGRNISDWILKTSQEYIKRRYGGLT------FGERNDLLRANDTEVDSIFAQLATAAAGDDTNNVTLPGLILDLENLIKNIATKRN-AKIWFNNKGYVSMVAYMNIMNNLVLRAHLPPDTDPSRYGISLINHPMNRTSSQLYAYTLKASIVDVMISVSVIFAMCLIPASFVLFLIEERVSGSKHLQFVSGVNPVVYWVANFTWDMLNYLVSGILCILIFVAFQQNAYVSQTNAPCLVSLLLLYGWAATPMMYPASHFFNVPSSAFVILGCMNIFLGIISTLSTFILEAFM--EQELDEINAIIMKVFLVLPHYCLGRGLIDMTRNQLVADIFENLGETFFQSPFTWDIVGRNLLSLSILGVFFFFLNICIEYKFWIYSMKCISPCKEQIPVNVEETDEEDIDVVRERERVTLGA-ASGDILTLEGLTKVYKSPL----------------KNKGHRAVDRLSVGVHSGECFGLLGVNGAGKTTTFKMLTGNIKSTDGDAHLAGHSIRSEMTAIHQNLGYCPQFDALCPLLTPREHLQMYARLRGVPAEDVDTVAEWGIEKLGLVNHAAKLSHQLSGGNKRKLSTAIALVGNPPVIFLDEPTTGMDPKARRFLWNCISGIIKDGR-SVVLTSHSMEECEALCNRIVIMVNGQFKCIGSIQHLKNRFGDGYMITLKV--TSSSDASQCQIQAVASNMESTFPGIVLKEQHHNMLQYQVPSSVHTSLADIFGHIERVREEMSIEDYSVSQTTLDQVFINFAK 2182          
BLAST of ATP-binding cassette sub-family A member 1 vs. TrEMBL
Match: A0A1S3JVH4 (LOW QUALITY PROTEIN: ATP-binding cassette sub-family A member 1-like OS=Lingula unguis OX=7574 GN=LOC106176500 PE=4 SV=2)

HSP 1 Score: 1258.05 bits (3254), Expect = 0.000e+0
Identity = 727/1995 (36.44%), Postives = 1129/1995 (56.59%), Query Frame = 1
Query:  643 CQEVYEKYLSVDYFHRQLLEMTAPIIFGKIYFTPDSEFTRQIIKKANITFEILDNLRLSAVEW---RLNFRDWLSNQVN--------NSSTLDNMSNNAKVCMETSQ------------NYYTVCQLI--YKSSD-------RNRIQNSIEIASRIFDLIERGLNCTELNKFQPMKSKVDIDNLAQNKL-INIFAGVVFNESFQYLTLNNATVLNYQIRMPTNRIDSTKNFKVLDTFWNPIPRRDTIYDLKYYTSGFLFLQEAFDQAFIELVTGNVTINIGTSMQIMPYPCFVDDRFIKFLSMIMPFILIIAWTPSVTIIIKSIVYEKENRLKEFMLLMGLTNFVHWCSWFISTIVVLIFPVIFMTLILKYNEIIQFSSPGIIFILILSYVISFICQSFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIE---------------ISDNF--RQREENIAIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKS-----------FEIQSETCHNNKA-------------SESGTK----------------------------LLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQITSEMLDTLTDGGNLPRPVSVLSFRKKTINTANINDPKVSFEFENNLV----------------------------LLSGLSLIFQQISGLFIKRFHHTKRNIKGXXXXXXXXXXXXXXXXXXXXXXXXMDNQPSMTISPWLMMPKTRL-VNLNTFYRKENTSDQISFKLNENYRSDIGQSGVRCMNTSLYQLENFKCLYPYNTNKWSEKSPI--EISLVTPECDCSTTGNQICSSPLSGGPESSNRIMASSDRLYDLSSYNISDYLMKNFKTFIMKQYGGLQFILPSFFGQSCQVI--GESQIWFDFRQSIN--SSRDNNSNP---EQVKFLNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFSYLRYNISG----GDENYNAFEWDITGNKICSLGILFVGWCLIIVFMESKHKKTLCIKLKDVKLKPYEIITD--EDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIIN--KEIWSSARMKEENAVIIEYRFDS-SVKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAK 6180
            C +        + F + L +   P++ GKI FTPD+  T +++ +AN+ F  L  +R  A +W       +++LS   N        N+++ + ++    + +  SQ            N  T    +    SSD       R   ++S+     +   I +   C E  KF+   ++ +I   +   +  N F   +  ++    T    T +NY++R+   + D+T+  +++D +W P PR     DLKY   GF ++Q+  + A IE  T +    IG  +Q  PYPC++ D+F   +S  MP  +++AW  +V +++K +V+EKE RLKE M +MGL N +HW +WFI+++V++   VI + + L +  +++ S P ++F+ ++++ ++ I Q F+ SVFF  +N+AA  GG +YF+ YLP+ + I +++ +ST       LL+ V+F     +    E+ + G Q+SN+ +S   D  F +  C+ M+ +D+V Y ++ WY+EAVFPG+YG+P+PWYF  TR YW  F +   N E               +S N+  + R+E+ A    E EP +L +G+ + NL K + + +  A+D L L FY+ QIT FLGHNGAGKTTT+S+LTG+  PT GTA +   DIR DM+ IR+ +G+CPQ+N+LF  LTVE+H++FY  LKGM+++E+K ++  ++K+VGL  K   +SKNLSGGMKRKLS+A+AFVG S+ + LDEPTAGVDP++RR IWDL+VKYR   RTIIL+THHMDEAD L DRIAIIS GKL+CCGSSLFLK  +G GYYL + K+             + + T  + KA             S++G+K                            +  F++K IP++KL+++  T+    L    T+   F +LF  L+S+L  L I SYG+SDT+LEEVFLKVA++ S +    +E+  T   L+  T+GG + RPV+ LSFRKK ++    + P ++    N LV                             ++GL+    Q   LF+KRFHH +R+ KG   E++LP + + +     KI   +   P++ + PW+ +P T    +L  FY  +     ++  L    RS +G  G RCMN+S+Y +  + C    +  +W+    +    SL +P C C T G Q C  P +GGP  S+R+M ++DRL +++  N+SD+L+K  + +  ++YGG         G+  Q++    SQ++    Q ++  S   NN  P         +       +  ++ N+ ++W N+KG+ +M +Y N  +N++LRS +   K    YGI V+N+P+  T   +        ++ V +AI VIF +SFIPASFV++LIEERV+ SK  Q+VSGVN   YW+S+  WD + YS+S+++ IL FLAFN +SY+   N    ++LLFLY  A+IP M+PF++     STAFV ++  N+ +G  +T++T+ L+ +  DD  L   N  L+++FLI P Y LGRG+ID++ + L  +++G    G    + FEWD  G  + +L +    W    + +E K     C      +L   E   D  ED+DV +ER R  ++ +  +D+L+V  LTK+      F  +  GK +           AV+ + F V +GECFGLLGVNGAGKTTTFKML G+E +T GNA + G+SI+ +    H+N+G+CPQFDAL  L+T  E L FY R+RG+  S++       +K L L  + +KP    SGGN+RK+ TAIALIG P ++FLDEPT GMD  ARRFLW  I ++  + + +VILTSH+MEECE LC R+ IMV+G  + +GSVQHLK++FG  Y V +R+  +   L      + ++N  +  + +  +KE++  +++Y+  S  + LS +F   E +R    +++YSV+Q +LD+VFINFAK
Sbjct:   18 CNDELFAVFKTNQFTKALWQQLEPMVTGKILFTPDTPLTNKLMDRANMFFSDLGRIRNVAQDWLAYSPTLKNYLSTSSNIQLLRDILNTTSREQLARLPVLSIAVSQLNITDAMWEQWKNSSTRAYFLRYLDSSDYDANGLPRYNWKDSLNYTDVMMRAILKASQCFEFEKFEGHPNETEIIKRSHELIETNQFWAAIVIDNVDNETTVLPTHVNYRLRLNREKTDNTR--QIMDKYWRPGPRASPFPDLKYLVFGFSYIQDLLESAIIEEHTSSED-RIGVFVQQFPYPCYIYDKFTMAISRSMPLFMVLAWIYTVAMVVKGVVHEKERRLKEVMKIMGLGNGIHWLAWFINSLVMMTITVILLVITLHFGRVLEHSDPIVLFVFLMAFTVATISQCFLFSVFFSKANLAAACGGFLYFVLYLPYTLIIQWEEYMSTGDKAASALLSTVAFGLGCGYFAKYEEQAVGIQWSNIASSPQPDDGFSMAFCIFMMLVDAVIYWILTWYIEAVFPGEYGIPRPWYFPVTRSYWCGFQQKETNTEEGFNGHVGRVTGNYTVSHNYEMQGRQEDSA--DIESEPTNLPLGVGLRNLRKVYRRGQKVAVDGLTLNFYEGQITSFLGHNGAGKTTTMSVLTGLFPPTEGTAVVYGKDIRTDMDTIRNSLGVCPQYNVLFDGLTVEEHMWFYARLKGMSEAEVKQEMEGMIKDVGLPHKRDELSKNLSGGMKRKLSVAIAFVGGSKTVILDEPTAGVDPYARRAIWDLLVKYRK-GRTIILSTHHMDEADILGDRIAIISLGKLRCCGSSLFLKNKYGSGYYLTMVKANSDEKPADRPVTALSNRTVSDIKAQFVSEKDEGVADMSDTGSKSEHSDSDQSATPPPEYEDPVPCVKDSSDVAVFVQKFIPSAKLVEDMGTELCFQLPEEGTHTGAFEALFRALESNLTKLGITSYGISDTTLEEVFLKVAEE-SGVDDVNEEQ--TRNALERYTEGGKIARPVTRLSFRKKKLDFFKKSKPVLNISDTNELVDSDFEDADSVASMPVSEVSTAQGGAGSHKVTGLAHTKDQFLALFVKRFHHVRRSYKGFVCEILLPAIFVCIAMIFTKIIPVIKENPALELQPWMYVPITGTNPHLTVFYTNDAPGSMLADSLERQIRSPLG-IGTRCMNSSVYSIRGYPCTPASSAERWTPSPAVTGNTSLDSPSCSCDT-GYQTCP-PGAGGPLGSSRVMDNTDRLVNMTGRNVSDWLVKTMEDYKKRRYGGYSL------GERNQLVQLNSSQLY----QVVDRLSRAVNNGQPVLNGNESIWSDIDALIKNVAVQNNV-KVWFNNKGWAAMASYMNAMNNVILRSKLPPGKDPAQYGITVSNHPMAPTNKQIERDTLNSAWISVLVAIGVIFAMSFIPASFVLYLIEERVSNSKHLQFVSGVNRVTYWVSHLAWDIMNYSVSMVLCILLFLAFNERSYVSPTNAPCLVLLLFLYGWAMIPMMFPFNYLFKVPSTAFVALACVNVFLGVTSTLSTYVLEFFS-DDQELVQINTVLRQVFLILPHYCLGRGLIDMAANQLIADVAGIYVAGTAVKDPFEWDQVGRNLFALAVSGAAWFGFTLLIEYKF---FCTS----RLSSNENAVDDNEDIDVARERRR-AMSAEARSDILRVENLTKV------FHKRRKGKFV-----------AVDRLCFSVPKGECFGLLGVNGAGKTTTFKMLTGDETVTKGNAHLAGHSILSEMPSVHQNLGYCPQFDALDMLVTGREHLEFYARLRGVPSSEVKQVAQYCIKKLGLIRYADKPAGEYSGGNRRKLSTAIALIGNPPVIFLDEPTTGMDPKARRFLWNCITSILKDGR-SVILTSHSMEECEALCGRIGIMVNGRFRCMGSVQHLKNRFGDGYTVILRVKGHSPDL------QPVMNYIQHTFPNVMLKEKHHNMLQYQLPSQGLLLSYLFGKLESVRQELDIEDYSVNQTTLDQVFINFAK 1956          
BLAST of ATP-binding cassette sub-family A member 1 vs. TrEMBL
Match: V4ABB8 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_212836 PE=4 SV=1)

HSP 1 Score: 1212.21 bits (3135), Expect = 0.000e+0
Identity = 737/1942 (37.95%), Postives = 1096/1942 (56.44%), Query Frame = 1
Query:  643 CQEVYEKYLSVDYFHRQLLEMTAPIIFGKIYFTPDSEFTRQIIKKANITFEILDNLRLSAVEW--------------RLNF-RDWLSNQVNNSSTLDNMSNNAKVCMETSQNYYTVCQLIYKSSDRNRI--QNSIEIASRIFDLIERGLNCTELNKFQPMK--SKVDIDNLAQNKLINIFAGVVFNESFQYLTLNNATVLNYQIRMPTNRIDSTKNFKVLDTFWNPIPRRDTIYDLKYYTSGFLFLQEAFDQAFIELVTGNVTINIGTSMQIMPYPCFVDDRFIKFLSMIMPFILIIAWTPSVTIIIKSIVYEKENRLKEFMLLMGLTNFVHWCSWFISTIVVLIFPVIFMTLILKYNEIIQFSSPGIIFILILSYVISFICQSFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENIAIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSF----------------------------------EIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQITSEMLDTLTDGGNL-----PRPVSVLSFRKKTINTANI---NDPKVSFE---------FENNLVL-LSGLSLIFQQISGLFIKRFHHTKRNIKGXXXXXXXXXXXXXXXXXXXXXXXXMDNQPSMTISPWLMMPKTRLVNLNTFYRKENTSDQISFKLNENYRSDIGQSGVRCMNTSLYQLENFKCLYPYNTN--KWSEKSPI--EISLVTPECDCSTTGNQICSSPLSGGPESSNRIMASSDRLYDLSSYNISDYLMKN-------FKTFIMK-QYGGLQF--ILPSFFGQSCQVIGESQIWFDFRQSINSSRD--NNSNPEQVKFLNYFQLFFNSSGIKT-NLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFSYLRYNISG----GDENYNAFEWDITGNKICSLGILFVGWCLIIVFMESKHKKTLCIKLKDVKLKPYEIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFD-SSVKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKNDS 6189
            CQ+V+    S + F   +     PI+ G I +TPD+   ++II+ AN TF  +  L   A +W               ++F R  L     N S +  ++ + K+C         + + IY   D +    ++S+         +++ L C + +KF P K  + + ID++       + A +VFNE       +N T + Y+IRM ++ +DSTKN +  D +W P  R     DLKY   GF F+Q+  D A I++ TG  +  IG  +Q  PYPC+++D+F + +S  +P  ++I+W  +V +++K IVYEKE RLKE M +MGL+N VHW +WFI+  +++   V+ + LILKY  I+++S P +I + +L++  S I   F IS  F  +N++A+ G  +YF+ YLP+     +++ ++T     + L   V      ++I   E+ + G Q+SN+ +S ++D  F + +C+ M+ ID + Y ++ WY+EAVFPG++G+PK +YF   + YW     N D+          E  +       EP D  +G+ I NL K +   K  A+D L+L FY+ QIT FLGHNGAGKTTT+SILTG+  PT GTA+I   DIR DM+ IR+ IG+CPQHN+LF  LTVE+HI+FY  LKG TK +++ ++P I+++VGL  K K MS+NLSGGMKRKLS+A+AFVG S+ + LDEPTAGVDP++RR IW+L++K R   RTIIL+THHMDEAD L DRIAIIS GKL CCGSSLFLK  FG GYYL L K                                    E   E+  +   S S  ++  F++K + N++L+++  T+    L   + +   F +LF QL+ S   L I S+GLSDTSLEEVFL VAD+ +               +D LTD          +  + L  R+  I    +    D  VS           F N+ V  L G SLIF Q   LFIKRFHH +R+ KG   E+ILP   + L      I   +  +P + + PWL +PK    NL  FY  +N    ++  L +   S     G RCMN  +Y ++ + C    N+   KW+E+  +   +++ +P CDCS  G   C    +GGP  S   + ++D LY++++ NISD+L+ +       F  FI   +Y G+ F  I P     S Q++    I     ++ N  +   NNS    +  L        + G  T N++++W N+KG+ S  +Y N+ +N++LRS + A+K   +YGI   N+P+ Y Q    +       +++ +AI VIF +SFIPASF+IFLIEERV+ SK  Q+VSG+NP +YWIS F WD + Y +   + +L FLAF+ +SY+ + N    + LLFLY  A+IP MYPFS   S SS+AFV IS  N+ +G ++T++TF ++L +  D  L   N  LK +FL+ P Y LGRG+ID++ + L+Y+++       +  N   WD+ G  + SL +L + + ++   +E +      IK + VK       T+ED+DV +E++R+ L+ +  NDVL +  L+K++                   +  K+  AV+N+  GV  G+CFGLLGVNGAGKTTTFKML G+  IT G A I   S++ +     + MG+CPQFDAL SLLT  E L FY R+RGI  SD+    D +++ L L  + +K     SGGNKRK+ TAI+LIG P+I+FLDEPT GMD  ARRFLW  I  +  + + +VILTSH+MEECE LC RL IMV+G+ K IGS QHLK++FG  Y + IR+     ++     I+  I  E +S A + E++  +++Y+   SS+ L+ +F   +  +    +++YSV+Q +LD+VFINFAK  +
Sbjct:  362 CQDVFVSIESNNLFS-IVWRYLKPIVLGVIPYTPDTPRVQEIIRLANQTFLDISELINLADDWDRLLPQIYNYLNGPNIDFIRVRLMGDRFNLSGIPTLNRDFKIC-------EYIGRFIYNGEDESGYDWRDSLNYTDIQLQTLKKYLQCFKFDKFIPYKDETSLTIDSVKLTSNNTLLAALVFNE-----IDDNTTHIKYKIRMNSDNVDSTKNIQ--DRYWRPGARASPTQDLKYVMFGFAFIQDMVDHAIIQVQTGEPS-RIGVVLQQFPYPCYINDKFTRTISRTIPLFMVISWIYTVAMLVKGIVYEKEERLKEVMKIMGLSNGVHWLAWFINAFIMMFITVVILVLILKYGGILEYSDPTVILVFLLAFTFSTIMLCFFISTLFSKANLSAVCGAFIYFMLYLPYTFITRWEEIMTTSQKAALSLANCVPLGFGCSYISRYEEQAIGIQWSNIASSPMVDDGFNMQYCIGMMIIDGILYGILTWYIEAVFPGQFGIPKKFYFFIQKSYWFGAQYNVDS----------ESPVEAMQLGSEPRDKSVGVGIRNLRKVYSTGKKVAVDGLSLNFYEDQITSFLGHNGAGKTTTMSILTGLFPPTEGTAYIYGKDIRTDMDDIRNSIGMCPQHNVLFDRLTVEEHIWFYASLKGCTKQQVQTEMPKIIEDVGLVNKTKEMSRNLSGGMKRKLSVAIAFVGGSKTVILDEPTAGVDPYARRAIWELLLKLRK-GRTIILSTHHMDEADILGDRIAIISHGKLCCCGSSLFLKSKFGSGYYLTLVKQDGNGAVNVDDDDDEDGLKKALNDDDGLRPSTADVDEGFGESNGSTTGSLSVGRITGFVQKYVKNAQLVEDNSTELCYQLPTEAMSSGDFEALFTQLERSHHELGIDSFGLSDTSLEEVFLAVADETN---------------VDDLTDEATRNNFRKKKKFNFLRNRRSRIEHTELVEDTDDNVSIASSTLENRVGFANSGVQKLHGWSLIFNQFLALFIKRFHHVRRSKKGFVCEIILPAGFVALAIAFSLILPPLVTEPPLELHPWLYVPKKSEPNLYMFYSNDNPRSTLANSLEQALLSK-PWVGTRCMNPDVYSIDGYPCEGSSNSQYLKWTERPKMTGNLTIDSPSCDCSR-GFPDCPKG-AGGPTPSMSYLPTTDYLYNMTARNISDWLLAHIPSFSICFDMFIFHYRYAGISFGDINPLADVNSSQIV---DIINRLSEAANGGQPIVNNSFLTDIDTL--------ARGFLTRNVAKVWYNNKGWASSVSYMNVLNNMILRSKLPANKDPADYGITTINHPMAYNQKQFSAEAILTSVIDLIVAICVIFAMSFIPASFLIFLIEERVSDSKHMQFVSGINPTIYWISTFAWDMVNYLVPATLCVLIFLAFDQESYVSASNFPCLLALLFLYGWAIIPLMYPFSRLFSVSSSAFVTISCANVFLGVVSTLSTFIVELLEQSDKELADINTILKSVFLVLPHYCLGRGLIDMTRNQLQYDLTKQFFPDAKPSNILAWDLVGRNLFSLAMLGIFFFILNWLIEYR----FFIKPRYVKESED---TNEDIDVSREKQRV-LSGEADNDVLVLKNLSKVF-----------------YGARRKKLKAVDNLCVGVPRGQCFGLLGVNGAGKTTTFKMLTGDVPITGGAAHICQKSVLKEKNDVRQLMGYCPQFDALDSLLTGREHLEFYARVRGIDRSDVKQVADWAIRKLGLVQYADKSAGTYSGGNKRKLSTAISLIGNPQIIFLDEPTTGMDPKARRFLWNCITDIVKDGR-SVILTSHSMEECEALCGRLVIMVNGKFKCIGSTQHLKNRFGDGYTLTIRISGQTPNME---PIKQYI-MEHFSQAVLLEQHNNMVQYQLKTSSLSLAKLFSSLQSAKQEYHIEDYSVTQTTLDQVFINFAKKQT 2217          

HSP 2 Score: 191.045 bits (484), Expect = 1.481e-44
Identity = 205/785 (26.11%), Postives = 351/785 (44.71%), Query Frame = 1
Query: 1003 ASRIFDLIERGLNCTELNKFQPMKSK---VDIDNLAQNKLINIFAGVVFNESFQYLTLNNATVLNYQI---RMPTNRIDSTKNFKVLDTFWNPIPRRDTIYDLKYYTSGFLFLQEAFDQAFIELVTGNVTINIGTSMQIMPYPCFV--------DDRFIKFLSMIMPFILII---AW------TPSVTIIIKSIVYEKENRLKE--FMLLMGLTNFVHWCSWFISTIVVLIFPVIFMTLILKYNEIIQFSSPGIIFILILSYVISFIC--QSFMISVFFDNSNVAAIVGGIVYFIFY-LPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENIAIDGFEKEPDDLEIGILIENLVKKF---PKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTS-------LFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISH 3243
            +S+I D+I R       N  QP+ +     DID LA+  L    A V +N      +++   VLN  I   ++P N+  +      ++   +P+      Y+ K +++      EA   + I+L+   V I +  +M  +P    +        D + ++F+S I P I  I   AW       P+   ++  + +++E+ +    F  L+ L     W       I+ L++P         ++ +   SS   + I   +  +  +    +F++ +   +    A +  I+  +F  LP                 G GL+      N + +    +Q    A+ SN+    +      VG  L  + +  +F+ ++ W +E            + F    RY       N++I++S     RE+   + G E + D L    +++NL K F    + K  A+DNL +   + Q  G LG NGAGKTTT  +LTG +  T G A I    +  +   +R  +G CPQ + L + LT  +H+ FY  ++G+ +S++K      ++++GL +     +   SGG KRKLS A++ +GN +IIFLDEPT G+DP +RR +W+ I       R++ILT+H M+E + LC R+ I+  GK KC GS+  LK  FGDGY L +  S +               T  +E IK+ I       E  +Q  ++  HN+  + Q  +       LF  L S+     I  Y ++ T+L++VF+  A   + I  
Sbjct: 1536 SSQIVDIINRLSEAA--NGGQPIVNNSFLTDIDTLARGFLTRNVAKVWYNNKGWASSVSYMNVLNNMILRSKLPANKDPADYGITTIN---HPMA-----YNQKQFSA------EAILTSVIDLI---VAICVIFAMSFIPASFLIFLIEERVSDSKHMQFVSGINPTIYWISTFAWDMVNYLVPATLCVLIFLAFDQESYVSASNFPCLLALLFLYGW------AIIPLMYP---------FSRLFSVSSSAFVTISCANVFLGVVSTLSTFIVELLEQSDKELADINTILKSVFLVLPHYCL-------------GRGLIDMTR--NQLQY-DLTKQFFPDAKPSNILAWDL------VGRNLFSLAMLGIFFFILNWLIE------------YRFFIKPRYVKESEDTNEDIDVS-----REKQRVLSG-EADNDVL----VLKNLSKVFYGARRKKLKAVDNLCVGVPRGQCFGLLGVNGAGKTTTFKMLTGDVPITGGAAHICQKSVLKEKNDVRQLMGYCPQFDALDSLLTGREHLEFYARVRGIDRSDVKQVADWAIRKLGLVQYADKSAGTYSGGNKRKLSTAISLIGNPQIIFLDEPTTGMDPKARRFLWNCITDIVKDGRSVILTSHSMEECEALCGRLVIMVNGKFKCIGSTQHLKNRFGDGYTLTIRISGQ---------------TPNMEPIKQYIM------EHFSQAVLLEQHNNMVQYQLKTSSLSLAKLFSSLQSAKQEYHIEDYSVTQTTLDQVFINFAKKQTDIEE 2221          
BLAST of ATP-binding cassette sub-family A member 1 vs. TrEMBL
Match: A0A3Q1GH78 (Uncharacterized protein OS=Acanthochromis polyacanthus OX=80966 PE=4 SV=1)

HSP 1 Score: 1170.22 bits (3026), Expect = 0.000e+0
Identity = 752/2132 (35.27%), Postives = 1160/2132 (54.41%), Query Frame = 1
Query:   40 SVINQISLLLWKNFRLRKRRPFQLTFEXXXXXXXXXXXXXXRQAQLKFRIGRCELREKNMASLGPIPFLRDYLCTFNTTCYNETQIDWKDNKTNDYLTFLNNCTRIYNSYPKRQLTSTEFLQW-LILHPEESEMLRYSLIFLNAK-IDY---VVESIDLINSG-----NSNNVSRGINKLTTMICGSDKNDAAILIFNLNLLQRSKRSIQTCQEVYEKYLSVDYFHRQLLEMTAPIIFGKIYFTPDSEFTRQIIKKANITFEILDNLRLSAVEW------RLN----FRDWLSNQVNNSSTLDNMSNNAKVCMETSQNYYTVCQLIYKSSDRNRIQNSIEIASRIFDLIERGLNCTELNKFQPMKSKVDIDNLAQNKLIN--IFAGVVFNESFQYLTLNNATVLNYQIRMPTNRIDSTKNFKVLDTFWNPIPRRDTIYDLKYYTSGFLFLQEAFDQAFIELVTGNVTINIGTSMQIMPYPCFVDDRFIKFLSMIMPFILIIAWTPSVTIIIKSIVYEKENRLKEFMLLMGLTNFVHWCSWFISTIVVLIFPVIFMTLILKYNEIIQFSSPGIIFILILSYVISFICQSFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYW---IPFSKNNDNIEISDNFRQREENIAIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFL----------EKSFEIQSET------CHNNKASESG--------------TKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDP---SQISHKRQEKQITSEMLDTLTDGGNLPRPVSVLSFRKKTINTANINDPKVSFEFENNLVLLSGLSLIFQQISGLFIKRFHHTKRNIKGXXXXXXXXXXXXXXXXXXXXXXXXMDNQPSMTISPWLM-MPKTRLVNLNTFYRKENTSDQISFKLNENYRSDIGQSGVRCMNTSLYQLENFKCLYPYNTNKWSE--KSPIEISLV-------------TPECDCSTTGN--QICSSPL-SGGPESSNRIMASSDRLYDLSSYNISDYLMKNFKTFIMKQYGGLQFILPSFFGQSCQVIGE--SQIWFDFRQSINSSRDNNSNPEQVKFLNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFSYLR---YNISGGDENYNAFEWDITGNKICSLGIL-FVGWCLIIVFMESKHKKTLCIKLKDVKLKPYEIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFD-SSVKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKN 6183
             ++ Q +LLLWKNF LRKR+  +L  EI+  L   + L+ +R        G+C    K M S G +P+++  +C  +  C +         + N++     N   I++ + K       FL++ L+L   +   L+ S+IF  A  +D+   ++ SI ++  G     NS N++ G++    M      N+ +I I    +   S    QT  +  E   S+ Y    +     P++ G++ +TPD+   R ++ +AN TF+ L  ++     W      RLN      + L N + N    D                          SD     NSI   ++I     + L+C +LNKF+   ++  +   A + L N  ++AG VF E+ Q  + +    + Y+IRM  + ++ T   K+ +  W+P  R ++  DL+Y   GF +LQ+  D   I   T   T  +G   Q MPYPC+VDD FI+ +  ++P  L++A+  +V++ IKS+V EKE RLKE +  +G  N   W + F   IV+L  P   +++++KY  ++Q+S P +IF+ +L + ++ + + F ISVFF  +N+AA  GG++YF+ YLP ++   + D +       V LL+ V+F          E+   G Q+ N+  S      +     ++M+  D+V + L+ WY+E VFPG+YG+PKPWYF FT+ YW   +P +  N ++ + D+    E        EK P +++ G+ + NLVK +   K  A+D L++ F++SQIT FLGHNGAGKTTT+SILTG+  PTSGTAFI   DI  DM+ IR  +G+CPQHN+LF  LTVE+HIYFY  LKG ++ E+K ++  ++++VGL  K K ++KNLSGGM+RKLS+A+AFVG S+I+ LDEPTAGVDP++RRGIW+L++KY+   RTIIL+THHMDEAD L DRIAIIS GK++CCGSSLFLK+ FG GYYL L          ++S  IQ++       C +N + + G              T L E ++  +P +  ++    + T +L +       F  LF+ LD +++ L + SYG+SDT+LEE+FLKVA+D    ++IS K   K I            +L +  S LS R  T+                    ++G  LI +Q   LFIKRFHH +R+ KGL ++++LP + + L      I       PS+ + PW+  +P+T      TFY  +        ++ E   ++ G  G RCMN     + N  C     TN  S+    P++ S+              +P C CST      +   PL +GG     R+  ++D + +L+  N++D+L+K F+    ++YGG+              +GE  SQ+  +  +     RD        +     +      G + N+ ++W  ++ + SM ++  + +N +LR  + A + L+ YGI+++N+PL  T+  L +   A     V ++I VIF +SFIPASFV+FLI+ERV  +K  Q+VSGVNP VYW++NF WD   Y +  LIVI+ FL F  ++Y+   N+ A I+LL  Y  AV P MYP SF  S  STA+VV++  NL +G   +I TF ++L  +DD ++   ND +K++ LIFP + LGRG+ID++ +      Y+  G D   +   W++ G  +C++ I  FV + + I+       K  C K + V  KP     +ED+DV +ER+RI  +    ND+L++  LTK+Y                      K   AV+ +  GV   ECFGLLG+NGAGKTTTFKML G+  ++ G A +NGYSI  +    H+N+G+CPQFDA+  LLT  E L FY R+RG+   ++ +  +  ++ L L  +  K     SGGNKRK+ TA+ALIG P ++FLDEPT GMD  ARRFLW  I ++  E + +VILTSH+MEECE LC R+AIMV+G  K +GS+QHLKS+FG  Y V +R+  +R +L    E   +     +  + +KE++   ++Y+   +   L+ IF +F   +    +++YSVSQ +LD+VF+NFA+ 
Sbjct:    2 GLLTQFTLLLWKNFTLRKRQKVRLVVEIVWPLFLFIILVSVRSTNKPIYKGQCHYPNKAMPSAGMLPWIQGMMCNMDNPCMSYPTPGEAPGQVNNF----ENSVGIHSLFAKLM-----FLKYPLLLSCNQVSRLQNSMIFKAASSLDFQEDMIGSISMLLCGREADFNSTNMTLGLSSPRQM-----ANNKSISI----MRNSSGDFCQTLIDTLESSSSLRYVWSAI----KPLMLGRVVYTPDTPAARLLVTEANSTFDALAKIKELVDSWDELGPRRLNGTGLTAEMLRNFLYNGPPEDRPPGAPP-------------------SDWRDAYNSI---TQILQPSSKFLSCFDLNKFEAAPTEGLLVTRALDLLENDTLWAGFVF-ENLQENSSDIPPYVKYKIRMDIDEVERTN--KIKERLWSPGARDNSASDLRYIWGGFAYLQDMMDHGIIRAQTSK-TQPLGVFAQQMPYPCYVDDVFIQSIGTMLPMFLVLAFMYTVSMTIKSLVLEKELRLKEVLRAVGFQNGALWSARFAENIVLLTIPCALISVMVKYGNVLQYSDPSVIFVFLLVFCLATVTECFFISVFFSKANLAAACGGLIYFVLYLPHVLCYAWSDVMGFPAKVAVSLLSCVAFGYGCETFAKYEEQGIGIQWHNINQSPEEGERYTFVISIVMMLADAVIHWLLTWYIENVFPGQYGIPKPWYFPFTKSYWCGTVPVTDENPDL-LKDSTEYNEY------LEKPPPNMKAGVSVRNLVKIYKTGKKLAVDGLSVDFFESQITSFLGHNGAGKTTTMSILTGLFPPTSGTAFINGYDICTDMDRIRKYLGMCPQHNVLFNELTVEEHIYFYARLKGRSRDEVKMEMDQMIEDVGLPHKRKDLAKNLSGGMQRKLSVAIAFVGGSKIVILDEPTAGVDPYARRGIWELLLKYKQ-GRTIILSTHHMDEADILGDRIAIISHGKMRCCGSSLFLKKCFGSGYYLTLVRDGTEKMAAQRSGMIQAKKGRRERDCPSNSSLDEGISSQTWSNSDPSDLTALGELLRHHVPEAVFLESIGQEITYILPYGGARDGTFARLFQDLDRAMNNLGLTSYGISDTTLEEIFLKVAEDSGVDAEISCKISCKHIMGMNSSLFMSTPDLKKNGS-LSGRGSTV--------------------ITGWKLIRRQFLALFIKRFHHARRSRKGLIAQVVLPAVFVCLSLIFSLIVPPFTEYPSLELQPWMYDLPQT------TFYSNDLPESVEVSQVVETLLNNPG-FGTRCMNGD--PIPNLPC-----TNSRSDWFTPPVDQSVTDIFLNGNWNMSNPSPPCQCSTPQRTFMLPECPLGAGGLPPPQRVQNTTDTILNLTGRNMTDFLIKTFEDSGKRRYGGIS-------------VGEINSQVRLNDTEIEAVFRDLKDLFSSFRIFQKAETVLKRLGTRENV-KVWFYNEAWHSMVSFLGVANNGILRGNLPAGQDLREYGISISNHPLNLTKEQLSNAALATTSTNVVVSICVIFAMSFIPASFVLFLIQERVNKAKHLQFVSGVNPTVYWLANFAWDICNYIVPCLIVIVIFLCFQQKAYVSLPNLPALILLLVFYGWAVTPMMYPASFIFSVPSTAYVVLTCINLFIGINGSIATFVMEL--FDDDNVARINDIVKQVLLIFPHFCLGRGLIDMATNQAMADLYSSFGEDRFQDPLSWNMVGKNLCAMTIQGFVMFAITILI----QYKFFC-KPRLVSAKPLA-AEEEDIDVARERKRI-YDGKAQNDLLRICDLTKVY--------------------PRKSTPAVDRLCVGVPAAECFGLLGINGAGKTTTFKMLTGDIPVSSGEAFLNGYSIRTEMRDVHQNLGYCPQFDAIDELLTGREHLEFYARLRGVPEKEVAMVAEWGIQKLGLVKYSTKSAGTYSGGNKRKLSTAMALIGSPPVIFLDEPTTGMDPKARRFLWDCILSIIKEGR-SVILTSHSMEECEALCTRMAIMVNGRFKCLGSIQHLKSRFGDGYTVIVRVGGSRPALKPVEEFLRV----NFPGSVLKEKHHNTLQYQLPYAPGALTSIFNLFTSHQRRLRIEDYSVSQTTLDQVFVNFARQ 1994          
BLAST of ATP-binding cassette sub-family A member 1 vs. TrEMBL
Match: A0A3S2MJM9 (Uncharacterized protein OS=Oryzias javanicus OX=123683 GN=OJAV_G00183080 PE=4 SV=1)

HSP 1 Score: 1169.84 bits (3025), Expect = 0.000e+0
Identity = 747/2139 (34.92%), Postives = 1171/2139 (54.75%), Query Frame = 1
Query:   40 SVINQISLLLWKNFRLRKRRPFQLTFEXXXXXXXXXXXXXXRQAQLKFRIGRCELREKNMASLGPIPFLRDYLCTFNTTCYNETQIDWKDNKTNDYLTFLNNCTRIYNSYPKRQLTSTEFL----QWLILHPEESEMLRYS-LIFLNAKIDYVVESIDLINSGNSNNVSRGINKLTTMICGSDKNDAAILIF-------NLNL-LQRSKRSIQTCQEVYEKYLSVDYFHRQLLEMTAPIIFGKIYFTPDSEFTRQIIKKANITFEILDNLRLSAVEW-RLNFRDWLSNQVNNSSTLDNMSNNAKVCMETSQNYYTVCQLIYKSSDRNRIQNSIEI---ASRIFDLIERGLNCTELNKFQPMKSKVDIDNLAQNKLIN--IFAGVVFNESFQYLTLNNATVLNYQIRMPTNRIDSTKNFKVLDTFWNPIPRRDTIYDLKYYTSGFLFLQEAFDQAFIELVTGNVTINIGTSMQIMPYPCFVDDRFIKFLSMIMPFILIIAWTPSVTIIIKSIVYEKENRLKEFMLLMGLTNFVHWCSWFISTIVVLIFPVIFMTLILKYNEIIQFSSPGIIFILILSYVISFICQSFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQ-REENIAIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSF------------------EIQSETCHNNKASESG--------------TKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADD--------PSQISHKRQEKQITSEMLDTLTDG--GNLPRPVSVLSFRKKTINTANINDPKVSFEFENNLVLLSGLSLIFQQISGLFIKRFHHTKRNIKGXXXXXXXXXXXXXXXXXXXXXXXXMDNQPSMTISPWLMMPKTRLVNLNTFYRKENTSDQISFKLNENYRSDIGQSGVRCMNTSLYQLENFKC-------LYP---------YNTNKWSEKSPIEISLVTPECDCSTTGNQI----CSSPLSGGPESSNRIMASSDRLYDLSSYNISDYLMKNFKTFIMKQYGGLQFILPSFFGQSCQV-IGESQIWFDFRQSIN-SSRDNNSNPEQVKFLNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFSYLRYNI---SGGDENYNAFEWDITGNKICSL---GILFVGWCLIIVFMESKHKKTLCIKLKDVKLKPYEIITDEDLDVFKERERI-ELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFD-SSVKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAK 6180
             ++ Q SLLLWKNF LRKR+  +L  EI+  L   + L+ +R        G+C    K M S G +P+L+  +C  +  C N         + N++                 +   +E L    ++L+  PEE      S  +F+   ++   E+++ ++  N       IN  + ++CG + +  +   F       N+N   Q S+ S   C    +  ++     R L     P++ GKI +TPD+   R ++++AN TF  L  ++  A  W +     W  N V N + L+N         +T+ N+         +SD +    S ++    +++  LI + L C ELNKF+ + ++ D+   A + L N   +AG+VF E+ Q  +      L Y+IRM    +  T   KV    W+P    +   +L+Y   GF +L++  D A I L T   +  +G  +Q MPYPC+VDD FI+ +  I+P  LI+A+  SV++ IK +V EKE RLKE +  +G+ N   W + FI TI++L  P + M++++KY +++Q+S P +IF+ +L +  + I Q F+ISVFF  +N+AA  GG++YF+ YLP ++   ++D +  +   GV LL+ V+F      +   E+   G Q+ N+  S     ++     ++M+ +D+V Y ++ WY+E VFPG+YG+P+PWYF FT  YW    KN    +  DNF   +  ++  +  EK   +++ G+ I NLVK +   K  A+D L++ FY++QIT FLGHNGAGKTTT+SILTG+  PTSGTA I   DIR DM+ IR  +G+CPQHN+LF  LTVE+HIYFYG LKG+ ++E+K ++  ++K+VGL  K K ++KNLSGGM+RKLS+A+AFVG S+I+ LDEPTAGVDPF+RRGIWDL++KY+   RTIIL+THHMDEAD L DRIAIIS GK++CCGSS+FLK++FG GYYL L +S                   E     C ++ + + G                + +F+++ +P +  ++    + T +L +       F +LF++LD  +D L + SYG+SDT+LEE+FLKVA+D        P++    +  K+ + E       G  G   +       ++K  N         S     + V+++G  LI +Q   LFIKRFHH +R+ KGL ++++LP + + L      I  S    P++ + PW+           TFY  +   D  + ++ E    + G  G RCM      +    C         P         + T  WS  +P      +P C CST G  I    C    +GG     R+  ++D L +L+  N++D+L+K ++    K+YGG+     S  G + QV + E +I   FR+  N       S PE        ++     G + N+ ++W  +KG+ SM ++ ++ +N +LR  +     ++ YG++++N+PL  ++  L     A    +V ++I VIF +SFIPASFV+FLI+ERV+ +K  Q+VSGVNP VYW+++F WD   Y I   +V++ F+ F  ++Y+   N+ A I+LL +Y  A+ P MYP SF  +  STA+VV++  NL +G   ++ TF ++L  +DD ++   ND +K++ L+FP + LGRG++D++ +     I    G D   +   W++TG  + ++   G++   + L+I     ++K     +L   K++  E    ED+DV +ER+R+ E   D   DVL++  LTK+Y                      K   AV+ +  GV   ECFGLLG+NGAGKTTTFKML G+  ++ G A +NGYSI       H+NMG+CPQFDA++ LL   E L  Y R+RG+   ++ +  +  ++ L L  + NK     SGGNKRK+ TA+ALIG P ++FLDEPT GMD  ARRFLW  I ++  E + +VILTSH+MEECE LC R+AIMV+G  + +GS+QHLK++FG  Y + +R+     +L     +E  + +E +  + +KE++   ++Y+       L+ IF      +    +++YSVSQ +LD+VF+NFAK
Sbjct:    2 GLLTQFSLLLWKNFTLRKRQKVRLLVEIVWPLFLFVILVTVRTTTKPSNKGQCHYPNKAMPSAGVLPWLQSMMCNIDNPCSNYPTPGETPGQVNNF----------------NESIISEILINLQKFLLELPEEDPAGPLSKFLFMENLLNSTAEAVNSLDFQNDP-----INSFSMLLCGKEPSSNSTFKFPTSKQTDNINSSFQNSQDSDPFCTSFIDTLVNTPSM-RFLWNNFRPLLRGKILYTPDTPAARLLVEEANSTFSALAAIKELADSWGKQGPVVW--NFVENYTVLEN---------DTAANF--------NNSDGDPQPTSQDVYNTVTQMLSLISKILGCFELNKFEAVPTEYDLVTKALDHLNNDTFWAGIVF-ENLQPNSSRIPPYLKYKIRMQVEEVQRTD--KVESRLWSPGAGDNPYDNLRYIWGGFAYLEDMIDHAGIRLQTSK-SQPLGVFLQQMPYPCYVDDPFIQSIGAILPMFLILAFMSSVSMTIKGLVLEKELRLKEVLRAVGIQNGALWSATFIETIILLTVPCVLMSVMVKYGKVLQYSDPSVIFVFLLVFCFTTISQCFLISVFFSKANLAAACGGLIYFLLYLPHVLCYAWRDVMGFKAKVGVSLLSCVAFGYGCENLSKYEEQGVGIQWHNIAKSPEEGESYTFIVSILMMLLDAVIYWVLTWYIENVFPGQYGIPRPWYFPFTSSYWC--GKNAVPEDTPDNFDLLKGSSVQNECMEKPDPNMKAGVSIRNLVKVYKTGKKVAVDGLSVDFYENQITSFLGHNGAGKTTTMSILTGLFPPTSGTALINGYDIRTDMDTIRRCLGMCPQHNVLFNELTVEEHIYFYGRLKGLNRNELKTEMDQMIKDVGLLHKRKDLAKNLSGGMQRKLSVAIAFVGGSKIVILDEPTAGVDPFARRGIWDLLLKYKK-GRTIILSTHHMDEADILGDRIAIISHGKMRCCGSSIFLKKSFGSGYYLTLVRSGTEVMTAQRSGIIPGKAEEEPNESDCPSSSSLDEGFGSQSLDDSNPADLNPVTQFVRRHVPEAVFLESIGQEITFILPYARARDGTFATLFQELDRVMDKLGLTSYGVSDTTLEEIFLKVAEDTGVDKEATPTKEPAVKDYKKHSRESKRRTMSGFHGKAAKANGKAELKEKFCNKVEDCRKNASVNGRGS-VVITGWELIRRQFLALFIKRFHHARRSRKGLIAQVVLPAVFVCLALVFSLIVPSFTEYPNLELQPWMYGSSQ-----TTFYSDDTPDDANASRVVETLVDNPG-FGTRCMEGD--PIPRLPCSSGSSDWFSPSVDQSIADIFLTGNWSMSNP------SPPCQCSTPGRAIIMPDCPP-GAGGLPPPQRVQNTTDTLLNLTGMNMTDFLVKTYERSGKKRYGGI-----SVGGINSQVLLTEVEIKDAFRKLRNFLDWREESLPEDT--FQKVEMVLKKLGTRNNV-KVWFYNKGWHSMVSFLSVANNGILRGFLPEGLNVRQYGLSMSNHPLNLSKEQLSLTAMASTSSDVVVSICVIFAMSFIPASFVLFLIQERVSKAKHLQFVSGVNPAVYWVASFVWDICNYIIPCFLVVVIFICFQQKAYVSPPNLPALILLLVMYGWAITPMMYPASFIFTVPSTAYVVLTCVNLFIGINGSVATFVMEL--FDDENITYINDIVKQVLLVFPHFCLGRGLMDMARNQAMATIFSRFGEDRFEDPLSWNMTGKNLVAMAIQGLVMFAFTLLI-----QYKFFYKPRLASPKIQSDE---KEDVDVARERQRVYEGRAD--RDVLRIRDLTKVY--------------------PRKSTPAVHRLCVGVPAAECFGLLGINGAGKTTTFKMLTGDIPVSSGEAFLNGYSIRTQMSDVHQNMGYCPQFDAINDLLNGREHLELYARLRGVPEDEVAMVAEWGIQKLGLVKYANKSAGTYSGGNKRKLSTAMALIGCPPVIFLDEPTTGMDPKARRFLWDCILSVIKEGR-SVILTSHSMEECEALCTRMAIMVNGRFQCLGSIQHLKNRFGDGYTLIVRVGGFPPAL---KPVEDFV-EETFPGSVLKEKHHNTLQYQLPYEEGALAKIFNELTQQQQRLDLEDYSVSQTTLDQVFVNFAK 2031          

HSP 2 Score: 178.333 bits (451), Expect = 1.159e-40
Identity = 162/619 (26.17%), Postives = 274/619 (44.26%), Query Frame = 1
Query: 1465 ILIIAWTPSVTIIIKSIVYEKENRLKEFMLLMGLTNFVHWCSWFISTIVVLIFPVIFMTLI-LKYNEIIQFSSPGI--IFILILSYVISFICQSFMISVFFDNSNVAAIV-----------GGIVYFIFYLPFLVFINFQDELSTEMYYGVG--LLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIID-LNFGV-GHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENIAIDGFEKEPD-DLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLE-FIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQ 3261
            I  +++ P+  ++   ++ E+ ++ K    + G+   V+W + F+  I   I P   + +I + + +    S P +  + +L++ Y  +     +  S  F   + A +V           G +  F+  L       F DE  T +   V   LL    FC     +      +    FS        D L++ + G  L+ + I  +        ++            + F +  R   P    +D  E  D  R+R+       +E   D D+   + I +L K +P+  TPA+  L +    ++  G LG NGAGKTTT  +LTG +  +SG AF+    IR  M  +   +G CPQ + +   L   +H+  Y  L+G+ + E+       ++++GL K     +   SGG KRKLS AMA +G   +IFLDEPT G+DP +RR +WD I+      R++ILT+H M+E + LC R+AI+  G+ +C GS   LK  FGDGY L +                     K +E F+++  P S L ++        L +          +F +L      L +  Y +S T+L++VF+  A +     H+ ++ Q
Sbjct: 1471 IFAMSFIPASFVLF--LIQERVSKAKHLQFVSGVNPAVYWVASFVWDICNYIIPCFLVVVIFICFQQKAYVSPPNLPALILLLVMYGWAITPMMYPASFIFTVPSTAYVVLTCVNLFIGINGSVATFVMEL-------FDDENITYINDIVKQVLLVFPHFCLGRGLMDMARNQAMATIFSRFGEDRFEDPLSWNMTGKNLVAMAIQGLVMFAFTLLIQ------------YKFFYKPRLASP-KIQSDEKEDVDVARERQRV-----YEGRADRDV---LRIRDLTKVYPRKSTPAVHRLCVGVPAAECFGLLGINGAGKTTTFKMLTGDIPVSSGEAFLNGYSIRTQMSDVHQNMGYCPQFDAINDLLNGREHLELYARLRGVPEDEVAMVAEWGIQKLGLVKYANKSAGTYSGGNKRKLSTAMALIGCPPVIFLDEPTTGMDPKARRFLWDCILSVIKEGRSVILTSHSMEECEALCTRMAIMVNGRFQCLGSIQHLKNRFGDGYTLIVRVG------------GFPPALKPVEDFVEETFPGSVLKEKHHNTLQYQLPY---EEGALAKIFNELTQQQQRLDLEDYSVSQTTLDQVFVNFAKE----QHEEEDLQ 2040          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Cavefish
Match: ENSAMXT00000016919.2 (pep primary_assembly:Astyanax_mexicanus-2.0:8:9912642:9956080:1 gene:ENSAMXG00000016432.2 transcript:ENSAMXT00000016919.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 1150.58 bits (2975), Expect = 0.000e+0
Identity = 753/2189 (34.40%), Postives = 1160/2189 (52.99%), Query Frame = 1
Query:   61 LLLWKNFRLRKRRPFQLTFEXXXXXXXXXXXXXXRQAQLKFRIGRCELREKNMASLGPIPFLRDYLCTFNTTCY---------------NETQI-----DWK--------DNKTNDYLTFLNNCTRIYNSYPKRQLTSTEF--LQWLILHPEESEMLRYSLIFLNAKIDYVVESIDLINSGNSNNVSRGINKLTTMICGSDKNDAAILIFNLNLLQRSK---------RSIQTCQEVYE-----------KYLSVDYFHRQLLEMTAPIIFGKIYFTPDSEFTRQIIKKANITFEILDNLRLSAVEWRLNFRDWLSNQVNNSSTLDNM----SNNAKVCMETSQNYYT------VCQLIYKSSDRNRIQNSIEIASRIFD-------LIERGLNCTELNKFQPMKSKVDIDNLAQNKLIN--IFAGVVFNESFQYLTLNNATVLNYQIRMPTNRIDSTKNFKVLDTFWNPIPRRDTIYDLKYYTSGFLFLQEAFDQAFIELVTGNVTINIGTSMQIMPYPCFVDDRFIKFLSMIMPFILIIAWTPSVTIIIKSIVYEKENRLKEFMLLMGLTNFVHWCSWFISTIVVLIFPVIFMTLILKYNEIIQFSSPGIIFILILSYVISFICQSFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENIAIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKS------------FEIQSETCHNNKASESGTK-------------------LLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPS-----------QISHKRQEK--QITSEMLDTLTDGGNLPRPVSVLSFRKKTINTANINDPKVSFEFENNLVLLSGLSLIFQQISGLFIKRFHHTKRNIKGXXXXXXXXXXXXXXXXXXXXXXXXMDNQPSMTISPWLMMPKTRLVNLNTFYRKENTSDQISFKLNENYRSDIGQSGVRCMNTSLYQLENFKCLYPYNTNKWS----EKSPIEISL--------VTPECDCSTTGNQI----CSSPLSGGPESSNRIMASSDRLYDLSSYNISDYLMKNFKTFIMK-----------QYGGLQFILPSFFGQSCQVIGESQIWFDFRQSINSSRD--NNSNPEQVKFLNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFSYLRYNIS---GGDENYNAFEWDITGNKICSLGILFVGWCLIIVFMESKHKKTLCIKLKDVKLKPYEIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFDSSV-KLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKNDS 6189
            LLLWKNF  R+R+  QL  EI+  L     LI +R     +    C    K M S G +P+++  +C  N  C+               N++ I     D K        D   + +   ++    + N+   +Q     F  L  L+  P  S M    L  + +  D   E I  +    + + S+    ++ ++CG  +    + I +LN  + S           S +    VY+           K +  +   R +     P++ GKI +TP +  T +IIK+ N TF+ L  LR     W    R    N + +S  +D +     NN      ++Q   T      V   + K S+  R   +      +F+        I R + C  L+K +P+ ++  + N +   L N   +AG++F +  Q  +      +NY+IRM  + ++ T   K+ D +W+P PR D   DL+Y   GF +LQ+  +Q+ I  VTG      G  +Q MPYPC+VDD F++ +S  MP  + +AW  SV IIIK +VYEKE RLKE M +MGL N + W SWFIS+++ L+     + L+LK   ++ +S PG++F+ + S+ +  I Q F+IS  F  +N+AA  GGI+YF  YLP+++ + +QD +         LL+ V+F     +    E+   G Q+ NLF+S +   ++ +   +I++++D+  Y ++ WY+EAVFPG+YG+P+PWYF FT+ YW  F + +     +   + R+ N      E+EP  L++G+ IENLVK +   K  A+D+L L FY+ QIT FLGHNGAGKTTT+SILTG+  PTSGTA+I+  DIR ++  IR  +G+CPQHN+LF+ LTVE+H++FY  LKG+++ E+K ++  I+ + GL  K K  +  LSGGM+RKLS+A+AFVG S+++ LDEPTAGVDP++RRGIWDL++KYR+  RTIIL+THHMDEAD L DRIAIIS GKL C GSSLFLK + G GYYL L K                 S    +++ASES +                    +   I K +PN++++++   + T +L + S     F  LF  +D  L  L I+SYG+SDT+LEE+FLKVA+D              I  +R+          L  LT+        S +    +  +  + +D K S++ +       G SL  QQ   L  KRF + +R+ KG F++++LP + + +      I       PS+ + PW+   +       TF   +   D  + +L        G  G RCM      + +  C      + WS     +S +E+ +         +P C+CS+ G +     C +   G P    +I +  D L +L+  NISDYL+K +   I K           +YGG      S   +S QV+  ++   +   +I   R   N       +FL     F N    K N+ +IW N+KG+ S+ A+ N+ +N +LR+ +   K    YGI   N+PL  T+  L         ++V ++I VIF +SF+PASFV+FLI+ERV  +K  Q++SGV P++YW++NF WD   Y +   +VIL F+ F  ++Y+ + N+    +LL LY  ++ P MYP SF     STA+VV+++ N+L+G   +++TF L+L+  ++  +   ND LK + LIFP + LGRG+ID+  +    +     G +   + FEWD+ G  + ++ +  V + +I V ++ +          + KL P   I +ED DV +ER+RI ++     D+L++  LTK+Y                    + K+K AV+ +  G+  GECFGLLGVNGAGKTTTFKML G+  +T G A +   SI+ +  + H+NMG+CPQFDA++ LLT  E L FY  +RG+   ++    +  ++ L L  + +K     SGGN RK+ TA+ALIG P +VFLDEPT GMD  ARR LW  I ++  E + +V+LTSH+MEECE LC R+AIMV+G  + +GSVQHLK++FG  Y + +R+        D   +   I  E+  S  +KE++  +++Y+  SSV  L+ IF +    +    +++YSVSQ +LD+VF+NFAK+ S
Sbjct:    9 LLLWKNFTYRRRQTLQLLIEIVWPLFIFFILIAVRLNYPPYEQHECHFPNKAMPSAGTLPWIQGIVCNANNPCFRHPTPGESPGVVGNFNDSIISRLFSDAKKILLYSQNDKSLDGFKELIHAVKALQNNTSGKQAVGVTFKSLGKLLEMPLTSLMFP-QLASMRSWSDLRNE-ILFLTRNATGSPSQMYQAVSRIVCGHPEG-GGLKIKSLNWYEDSNYKALFGNYNSSDEEPVSVYDNTSTPFCNNLMKNMETNPISRMIWRALKPLLMGKILYTPHTPATHKIIKEVNRTFQELGVLRDLGGMWE-ETRPKAWNFMEHSEEMDLLRTLLQNNVTAAFFSAQLTGTQWSVQDVISFLTKQSEDTRPHGTAFTWRDVFNETDQAIMSISRFMECVNLDKLEPVSTEEKLINDSLGLLDNRKFWAGIIFPD-IQSNSSELPPHVNYKIRMDIDNVERTN--KIKDAYWDPGPRADPFEDLRYVWGGFSYLQDVIEQSIIRAVTGTKE-KTGVYIQQMPYPCYVDDIFLRVMSRSMPLFMTLAWMYSVAIIIKGVVYEKEARLKETMRIMGLDNGILWFSWFISSLIPLLMSAGLLVLLLKMGNLLPYSDPGVVFLFLGSFAVVTIMQCFLISTVFARANLAAACGGIIYFTLYLPYVLCVAWQDYIGLPAKVIASLLSPVAFGFGCEYFALFEEQGVGIQWKNLFSSPMEKDDYSLTTSIIIMYVDAFIYGVMTWYIEAVFPGQYGIPRPWYFPFTKSYW--FGEGDQ--RPTPILKGRKANSGAVCIEEEPTHLDMGVYIENLVKVYRHGKKLAVDDLTLGFYEGQITSFLGHNGAGKTTTMSILTGLFPPTSGTAYIMGKDIRSELSAIRQSLGVCPQHNVLFSMLTVEEHVWFYARLKGLSEEEVKAEIDQILYDTGLPHKRKSRTCELSGGMQRKLSVALAFVGGSKVVILDEPTAGVDPYARRGIWDLLLKYRT-GRTIILSTHHMDEADILGDRIAIISHGKLCCVGSSLFLKTHLGTGYYLTLVKKEPEASLSSCRNSSSTVSYVKKDDEASESSSDAGLGSDHESDAATAIDISLISGLIIKHVPNARMVEDLGHEITYILPYESAKDGAFVELFHDMDDHLADLGISSYGVSDTTLEEIFLKVAEDSGVDTEILSDGTFPIRRRRRHAFGADHQSCLKPLTEDDRYDGNESEVDPESRETDYLSGSDGKGSYQIQ-------GWSLKRQQFLALLWKRFLYARRSRKGFFAQIVLPAVFVCIALVFSLIVPPFGKYPSLALQPWMYEDQV------TFISDDAPEDASTQRLLAALMEGPG-FGTRCMEGE--PIPDAPCTI--GDDDWSIPEVPESVLEVLMSQNWTMDNPSPACECSSDGKKKMLPECPASAGGLPPPQIKI-SERDTLQNLTGRNISDYLVKTYAQIIGKSLKNKVWVNEFRYGGF-----SLGARSTQVLPPAE---EIDDAIARVRVIFNLEKVTADRFLKSLSAFINGLDTKNNV-KIWFNNKGWHSIGAFLNVMNNGILRANLPPEKDPSKYGITAFNHPLNLTKEQLSQVALVTTSVDVLVSICVIFAMSFVPASFVVFLIQERVNKAKHMQFISGVQPFLYWLANFIWDMCNYVVPATLVILIFVCFQQKAYVSATNLPVLALLLLLYGWSITPLMYPASFLFEIPSTAYVVLTSVNILIGINGSVSTFVLELFGNNE--IGGINDILKNVLLIFPHFCLGRGLIDMVKNQAMADALERFGENRFRSPFEWDMVGKNLFAMAVEGVVFFIITVLIQYRF-----FFKPNAKLSP---IGEEDEDVARERQRI-VSGAGQGDILELRELTKVY--------------------KRKQKPAVDRLCVGIPPGECFGLLGVNGAGKTTTFKMLTGDTVVTSGEAFLARKSILREIDQVHQNMGYCPQFDAINDLLTGREHLEFYAILRGVPEREVCEVAEWGIRKLGLVKYSDKAAGSYSGGNMRKLSTAMALIGGPPVVFLDEPTTGMDPKARRALWNCIHSVIKEGR-SVVLTSHSMEECEALCTRMAIMVNGRFRCLGSVQHLKNRFGDGYTIILRV---AGPDPDLQPVMKFIESELPGST-LKEKHRNMLQYQLPSSVSSLAHIFSILAKHKDFLRIEDYSVSQTTLDQVFVNFAKDQS 2120          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Cavefish
Match: abca4a (retinal-specific ATP-binding cassette transporter-like [Source:NCBI gene;Acc:103024609])

HSP 1 Score: 1119.38 bits (2894), Expect = 0.000e+0
Identity = 697/1920 (36.30%), Postives = 1048/1920 (54.58%), Query Frame = 1
Query:  688 RQLLEMTAPIIFGKIYFTPDSEFTRQIIKKANITFEILDNLRLSAVEW-----------RLNFR-DWLSNQVNNSSTLDNMSNNAKVCMETSQNYYTVCQLIYKSSDRNRIQNSIEIASR-IFDLIERGL-------NCTELNKFQPMKSKVDI-----DNLAQNKLINIFAGVVFNESFQYLTLNNATVLNYQIRMPTNRIDSTKNFKVLDTFWNPIPRRDTIYDLKYYTSGFLFLQEAFDQAFIELVTGNVTINIGTSMQIMPYPCFVDDRFIKFLSMIMPFILIIAWTPSVTIIIKSIVYEKENRLKEFMLLMGLTNFVHWCSWFISTIVVLIFPVIFMTLILKYNEIIQFSSPGIIFILILSYVISFICQSFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENIAIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFE-------------------IQSETCHNNKASESG--TKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQITSEMLDTLTDGGNLPRPVSVLSFRKKTINTANINDPKVSFEFENNLVLLSGLSLIFQQISGLFIKRFHHTKRNIKGXXXXXXXXXXXXXXXXXXXXXXXXMDNQPSMTISPWLMMPKTRLVNLNTFYRKENTSDQISFKLNENYRSDIGQSGVRCMNTSLYQLENFKC-----------LYP-----YNTNKWSEKSPIEISLVTPECDCST----TGNQICSSPLSGGPESSNRIMASSDRLYDLSSYNISDYLMKNFKTFIMK----------QYGGLQFILPSFFGQSCQVIGESQIWFDFRQSINSSRDNNSNPEQVKFLNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFSYLRYNIS---GGDENYNAFEWDITG-NKICSLGILFVGWCLIIVFMESKHKKTLCIKLKDVKLKPYEIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPH--YNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNR-NSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFDSSVKLSDIFRVFEDLRTNEM---VKEYSVSQMSLDEVFINFAKNDS 6189
            R +     P + GKI + PDS   RQ+IK AN TFE L+ LR     W           + N + D L + + N S +D M    K    T      +   ++  S+  R ++ ++   R IF+L +R L        C  L+KF  +  +  +     D +A+ K    +AG+VF ++F + T      + ++IRM  + ++ T   K+ D +W+P PR D + DL+Y   GF +LQ+  + A I+  TG     +G  +Q MPYPC+VDD F+  LS   P  +++AW  SV++++KS+V EKE RLKE +  MG+TN V WC+WFI + +V+      +T I+   +++ +S+P I+FI +L++  + I Q F+++VFF+ +N+AA   GI+YF FYLP L    +QD ++ +M     L++QV+F     ++   E+   G Q+ N+  S +    F     +IM+ +D+V Y ++AWY+++VFPG+YG+ +P+YF     Y         +  +S    ++        FE EP  L +G+ +ENLVK F  S  PA+D L++ FY+ QIT FLGHNGAGKTTT+SILTG+  PTSGTAFI   DIR DM+ IR  +G+CPQHNI+F ++TV +HI FY LLKG   +E + ++ +++++ GL  K    ++NLSGG++RKLS+AMAFVG ++++FLDEPT+GVDP+SRR IWDL++KYR   RT+IL+THHMDEAD L DR+AIISQG+L CCGS LFLK   G G+YL L +  +                    +   C   K S  G    +   +   +P ++L++    + T +L         + SLF +L+ +L  + ++S+G+SDTSLEEV           S +   +Q++S       +G    +P +  S   +   +  +                 G+SL+ +Q   L IKRFHHT R+ K  F++++LP   +L+      I       PS+T+SPW+   +       TF+  E  S+    K   +   +    G RCM      LE + C           + P      N ++W+E  P      +P+C CST    T   +C    +GG     RI ++ D L DL+  NISDYL+K + T I            +YGG+        G    V+G S                                      KT    +W N+KG+ +MPA+ N+ +N +LR+ +  +     YG+ V N+PL  T+  L         ++  +A+ VIF +SF+PASFV++LI+ERVT +K  Q+VSGV+P VYW +NF WD I YS+S  +V+  F+ F+ + Y    N+ A I LL LY  +V P MYP S+  S  STA+V +S  NL +G  ++  TF LDL+     +L   N  LK++ LIFP + LGRG+ID++ +    ++    G D + + F W+  G N +C     F+ + L I+    +++  L   + D K KP  +I DEDLDV KERERI       +D+L +  L+K Y+                       K AV+ I  GV  GECFGLLGVNGAGKTTTFKML G+ +++ G A I GYSI+ + L  + NMG+CPQFDA+  LLT  E L+ Y R+RG+  S+I    +  ++ L L+ +  Y   TY  SGGNKRK+ TAIA+IG P +V LDEPT GMD  +RRFLW+ I ++  + + AV+LTSH+MEECE LC RLAIMV+G  K +G++QHLK KFG  Y V +++   +  ++ D N  E  + +  +     +E++   ++Y   S    S + R+F+ + TN+    +++YSV+Q +LD+VF+NFAK  S
Sbjct:  381 RLMWNTLKPFLMGKILYAPDSPAIRQLIKNANSTFEELERLRNIIRSWEEVGPQLWDFFQSNIQLDVLRDILRNPSVMDYMDRGLK---NTGLTIRHILNFLHTGSEEERERDMVQFDWRNIFNLTDRTLRMINQYGECLVLDKFVGLPDETQLTQKALDLIAEKKF---WAGLVFVDTFSWTT-KIPPHIKFKIRMDIDTVERTN--KIKDRYWDPGPRADPMDDLRYVWGGFAYLQDMVEHAVIKTHTGK-EWPLGVYLQQMPYPCYVDDLFMLTLSRCFPIFIVLAWVYSVSMMVKSVVLEKEMRLKETLKAMGVTNEVLWCAWFIDSFLVMAASTALLTAIIMGGKVLNYSNPIILFIFLLTFTTATIMQCFLMTVFFNKANLAAACSGILYFSFYLPHLACFTWQDRITKDMKIMASLMSQVAFGFGTEYLSRYEEQGLGLQWDNIHTSPLEGDEFSFHTSIIMMLLDTVLYAVLAWYLDSVFPGQYGIGRPFYFPIQPSY----CSLKPHALVSSPPTEKV------FFEAEPSGLVVGVHVENLVKVFSGSSKPAVDGLSITFYEGQITAFLGHNGAGKTTTMSILTGLFPPTSGTAFIYGKDIRTDMDTIRHSLGMCPQHNIIFHHMTVAEHILFYSLLKGRPLAEAQQEVENMLEDFGLPHKRNEQTQNLSGGLQRKLSVAMAFVGGAKVVFLDEPTSGVDPYSRRSIWDLLLKYRP-GRTVILSTHHMDEADLLSDRVAIISQGRLHCCGSPLFLKSMLGAGFYLTLVRRMKDDTPPTRKEGQCDCKDDCSCKCSICTEYKESTCGDVETITNLVHHHVPEARLVEAVGQELTFLLPSRGFKHRAYASLFRELEETLADIGLSSFGVSDTSLEEV---------STSKELPNRQVSSLYKKACANG----QPTAGGSSSGEGQGSRQVK----------------GVSLVVKQFLALLIKRFHHTTRSGKDFFAQIVLPASFVLVSLMFTLIVPPFGEYPSLTLSPWIYGRQF------TFFSNEQ-SEMEGMKYFADVLLNRPGFGTRCMVDE--PLEEYPCNNITTEWEKPLVNPALVDVLNKSQWTELRP------SPDCQCSTPTKLTMLPVCPEG-AGGLPLPQRIQSTGDVLIDLTGRNISDYLVKTYPTLIRTSSLISECLFYRYGGIS------VGGRLPVVGLSP-------------------------------------KTIQDTVWYNNKGWHAMPAFLNVANNAILRAHLPTNANPSEYGVTVINHPLNLTKEQLSEVNVLTTSVDAVVAMCVIFAMSFVPASFVLYLIQERVTQAKHLQFVSGVSPLVYWTANFLWDMISYSVSAALVVQIFINFDKKCYTSPANLHALIALLMLYGWSVTPMMYPMSYVFSVPSTAYVSLSCLNLFIGINSSAITFILDLFD-SSTTLYMFNQVLKRVLLIFPHFCLGRGLIDMAINQAVMDVYAQFGEDYSLDPFSWNFVGKNVVCMAAEGFIYFILNILI---QYRFFLEHWMPDSK-KP--LIVDEDLDVAKERERIYRGGSS-SDILHIRDLSKTYS--------------------GGTKPAVDRICVGVSPGECFGLLGVNGAGKTTTFKMLTGDIDVSSGEAAITGYSILTNILDVYHNMGYCPQFDAIDDLLTGREHLHLYARLRGVPESEISRVAEWGIQKLGLSQYAGYGAGTY--SGGNKRKLSTAIAMIGCPALVLLDEPTTGMDPHSRRFLWKSIMSVIQDGR-AVVLTSHSMEECEALCTRLAIMVNGIFKCLGTIQHLKYKFGDGYVVTMKIRSAKAGTVPDLNPAEAFM-ENTFPGCVQREKHYNTLQYEVAS----SSLARIFQLVLTNKEKLNIEDYSVTQTTLDQVFVNFAKQQS 2155          

HSP 2 Score: 52.373 bits (124), Expect = 7.128e-6
Identity = 37/143 (25.87%), Postives = 69/143 (48.25%), Query Frame = 1
Query:   40 SVINQISLLLWKNFRLRKRRPFQLTFEXXXXXXXXXXXXXXRQAQLKFRIGRCELREKNMASLGPIPFLRDYLCTFNTTCYNETQIDWKDNKTNDY-----LTFLNNCTRIYNSYPK--------RQLTS-TEFLQWLILHPE 426
              I+Q+ LLLWKN+ +RKR+  +   EI+  +   + L+ +R+A   +R   C    K M S G +P+++   C  N  C+            ++Y     + F ++   +  + P+        R+L+S T+F++ +  HPE
Sbjct:    2 GTISQVRLLLWKNWTVRKRQKMRFFMEIMWPVMLFIGLVWLRKANPLYRQHECHFPNKAMPSAGVLPWIQGIFCNANNPCFQHPTRGESPGLVSNYNNSILIRFWSDAQELLLNDPEFLHLGRVWRELSSMTKFIRAIRTHPE 144          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Cavefish
Match: abca4a (retinal-specific ATP-binding cassette transporter-like [Source:NCBI gene;Acc:103024609])

HSP 1 Score: 1117.45 bits (2889), Expect = 0.000e+0
Identity = 714/2007 (35.58%), Postives = 1079/2007 (53.76%), Query Frame = 1
Query:  688 RQLLEMTAPIIFGKIYFTPDSEFTRQIIKKANITFEILDNLRLSAVEW-----------RLNFR-DWLSNQVNNSSTLDNMSNNAKVCMETSQNYYTVCQLIYKSSDRNRIQNSIEIASR-IFDLIERGL-------NCTELNKFQPMKSKVDI-----DNLAQNKLINIFAGVVFNESFQYLTLNNATVLNYQIRMPTNRIDSTKNFKVLDTFWNPIPRRDTIYDLKYYTSGFLFLQEAFDQAFIELVTGNVTINIGTSMQIMPYPCFVDDRFIKFLSMIMPFILIIAWTPSVTIIIKSIVYEKENRLKEFMLLMGLTNFVHWCSWFISTIVVLIFPVIFMTLILKYNEIIQFSSPGIIFILILSYVISFICQSFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGV---------PKPWYFLFTRRYWIPF------------------SKNNDNIEISDNFRQ------------REENIAI------DG---------------FEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSF---------------------------EIQSETCHNNKASESGTK-----LLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKV-ADDPSQISHKRQEKQITSEMLDTLTDGGNLPRPVSVLSFRKKTINTANINDPKVSFEFENNLVL-----------LSGLSLIFQQISGLFIKRFHHTKRNIKGXXXXXXXXXXXXXXXXXXXXXXXXMDNQPSMTISPWLMMPKTRLVNLNTFYRKENTSDQISFKLNENYRSDIGQSGVRCMNTSLYQLENFKC-----------LYP-----YNTNKWSEKSPIEISLVTPECDCST----TGNQICSSPLSGGPESSNRIMASSDRLYDLSSYNISDYLMKNFKTFIM-----------KQYGGLQF--ILPSFFGQSCQVIGESQIWFDFRQSINSSRD-NNSNPEQVKFLNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFSYLRYNIS---GGDENYNAFEWDITG-NKICSLGILFVGWCLIIVFMESKHKKTLCIKLKDVKLKPYEIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPH--YNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNR-NSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFDSSVKLSDIFRVFEDLRTNEM---VKEYSVSQMSLDEVFINFAKNDS 6189
            R +     P + GKI + PDS   RQ+IK AN TFE L+ LR     W           + N + D L + + N S +D M    K    T      +   ++  S+  R ++ ++   R IF+L +R L        C  L+KF  +  +  +     D +A+ K    +AG+VF ++F + T      + ++IRM  + ++ T   K+ D +W+P PR D + DL+Y   GF +LQ+  + A I+  TG     +G  +Q MPYPC+VDD F+  LS   P  +++AW  SV++++KS+V EKE RLKE +  MG+TN V WC+WFI + +V+      +T I+   +++ +S+P I+FI +L++  + I Q F+++VFF+ +N+AA   GI+YF FYLP L    +QD ++ +M     L++QV+F     ++   E+   G Q+ N+  S +    F     +IM+ +D+V Y ++AWY+++VFPG+YG+         P  W  L      +P                   + NN    + +   Q            R E + +      +G               FE EP  L +G+ +ENLVK F  S  PA+D L++ FY+ QIT FLGHNGAGKTTT+SILTG+  PTSGTAFI   DIR DM+ IR  +G+CPQHNI+F ++TV +HI FY LLKG   +E + ++ +++++ GL  K    ++NLSGG++RKLS+AMAFVG ++++FLDEPT+GVDP+SRR IWDL++KYR   RT+IL+THHMDEAD L DR+AIISQG+L CCGS LFLK   G G+YL L +                             E +  TC   K++          +   +   +P ++L++    + T +L         + SLF +L+ +L  + ++S+G+SDTSLEE+FLKV AD  + +     + +   E     T   ++ R  +V      T+NT    D K     +                + G+SL+ +Q   L IKRFHHT R+ K  F++++LP   +L+      I       PS+T+SPW+   +       TF+  E  S+    K   +   +    G RCM      LE + C           + P      N ++W+E  P      +P+C CST    T   +C    +GG     RI ++ D L DL+  NISDYL+K + T I            ++YGG+     LP   G S + I ++        +I + +    +  +   FL Y +  +N         ++W N+KG+ +MPA+ N+ +N +LR+ +  +     YG+ V N+PL  T+  L         ++  +A+ VIF +SF+PASFV++LI+ERVT +K  Q+VSGV+P VYW +NF WD I YS+S  +V+  F+ F+ + Y    N+ A I LL LY  +V P MYP S+  S  STA+V +S  NL +G  ++  TF LDL+     +L   N  LK++ LIFP + LGRG+ID++ +    ++    G D + + F W+  G N +C     F+ + L I+    +++  L   + D K KP  +I DEDLDV KERERI       +D+L +  L+K Y+                       K AV+ I  GV  GECFGLLGVNGAGKTTTFKML G+ +++ G A I GYSI+ + L  + NMG+CPQFDA+  LLT  E L+ Y R+RG+  S+I    +  ++ L L+ +  Y   TY  SGGNKRK+ TAIA+IG P +V LDEPT GMD  +RRFLW+ I ++  + + AV+LTSH+MEECE LC RLAIMV+G  K +G++QHLK KFG  Y V +++   +  ++ D N  E  + +  +     +E++   ++Y   S    S + R+F+ + TN+    +++YSV+Q +LD+VF+NFAK  S
Sbjct:  384 RLMWNTLKPFLMGKILYAPDSPAIRQLIKNANSTFEELERLRNIIRSWEEVGPQLWDFFQSNIQLDVLRDILRNPSVMDYMDRGLK---NTGLTIRHILNFLHTGSEEERERDMVQFDWRNIFNLTDRTLRMINQYGECLVLDKFVGLPDETQLTQKALDLIAEKKF---WAGLVFVDTFSWTT-KIPPHIKFKIRMDIDTVERTN--KIKDRYWDPGPRADPMDDLRYVWGGFAYLQDMVEHAVIKTHTGK-EWPLGVYLQQMPYPCYVDDLFMLTLSRCFPIFIVLAWVYSVSMMVKSVVLEKEMRLKETLKAMGVTNEVLWCAWFIDSFLVMAASTALLTAIIMGGKVLNYSNPIILFIFLLTFTTATIMQCFLMTVFFNKANLAAACSGILYFSFYLPHLACFTWQDRITKDMKIMASLMSQVAFGFGTEYLSRYEEQGLGLQWDNIHTSPLEGDEFSFHTSIIMMLLDTVLYAVLAWYLDSVFPGQYGIGRPFYFPIQPSYWLNLTNPTKAVPEKSVVKRPSIDNSAQKPEETANNQTQPVEEQTTQPSEPPGTCKHGDRREKLGMQIKLEEEGSSYQNQSYLSGEKVFFEAEPSGLVVGVHVENLVKVFSGSSKPAVDGLSITFYEGQITAFLGHNGAGKTTTMSILTGLFPPTSGTAFIYGKDIRTDMDTIRHSLGMCPQHNIIFHHMTVAEHILFYSLLKGRPLAEAQQEVENMLEDFGLPHKRNEQTQNLSGGLQRKLSVAMAFVGGAKVVFLDEPTSGVDPYSRRSIWDLLLKYRP-GRTVILSTHHMDEADLLSDRVAIISQGRLHCCGSPLFLKSMLGAGFYLTLVRRMKDDTPPTRKEGQCDCKDDCSCKCSICTEYKESTCGQTKSAGRQMDGDVETITNLVHHHVPEARLVEAVGQELTFLLPSRGFKHRAYASLFRELEETLADIGLSSFGVSDTSLEEIFLKVTADGETSLGKSAADLRALQE-----TSRSSVFRDTTV------TVNTEEPEDKKACANGQPTAGGSSSGEGQGSRQVKGVSLVVKQFLALLIKRFHHTTRSGKDFFAQIVLPASFVLVSLMFTLIVPPFGEYPSLTLSPWIYGRQF------TFFSNEQ-SEMEGMKYFADVLLNRPGFGTRCMVDE--PLEEYPCNNITTEWEKPLVNPALVDVLNKSQWTELRP------SPDCQCSTPTKLTMLPVCPEG-AGGLPLPQRIQSTGDVLIDLTGRNISDYLVKTYPTLIRTSLKSKYWVNEQRYGGISVGGRLP-VVGLSPKTIQDTAEQLGGIFNITAGKHVKRALRDTGTFLRYMETEYNV--------KVWYNNKGWHAMPAFLNVANNAILRAHLPTNANPSEYGVTVINHPLNLTKEQLSEVNVLTTSVDAVVAMCVIFAMSFVPASFVLYLIQERVTQAKHLQFVSGVSPLVYWTANFLWDMISYSVSAALVVQIFINFDKKCYTSPANLHALIALLMLYGWSVTPMMYPMSYVFSVPSTAYVSLSCLNLFIGINSSAITFILDLFD-SSTTLYMFNQVLKRVLLIFPHFCLGRGLIDMAINQAVMDVYAQFGEDYSLDPFSWNFVGKNVVCMAAEGFIYFILNILI---QYRFFLEHWMPDSK-KP--LIVDEDLDVAKERERIYRGGSS-SDILHIRDLSKTYS--------------------GGTKPAVDRICVGVSPGECFGLLGVNGAGKTTTFKMLTGDIDVSSGEAAITGYSILTNILDVYHNMGYCPQFDAIDDLLTGREHLHLYARLRGVPESEISRVAEWGIQKLGLSQYAGYGAGTY--SGGNKRKLSTAIAMIGCPALVLLDEPTTGMDPHSRRFLWKSIMSVIQDGR-AVVLTSHSMEECEALCTRLAIMVNGIFKCLGTIQHLKYKFGDGYVVTMKIRSAKAGTVPDLNPAEAFM-ENTFPGCVQREKHYNTLQYEVAS----SSLARIFQLVLTNKEKLNIEDYSVTQTTLDQVFVNFAKQQS 2307          

HSP 2 Score: 52.373 bits (124), Expect = 8.490e-6
Identity = 37/143 (25.87%), Postives = 69/143 (48.25%), Query Frame = 1
Query:   40 SVINQISLLLWKNFRLRKRRPFQLTFEXXXXXXXXXXXXXXRQAQLKFRIGRCELREKNMASLGPIPFLRDYLCTFNTTCYNETQIDWKDNKTNDY-----LTFLNNCTRIYNSYPK--------RQLTS-TEFLQWLILHPE 426
              I+Q+ LLLWKN+ +RKR+  +   EI+  +   + L+ +R+A   +R   C    K M S G +P+++   C  N  C+            ++Y     + F ++   +  + P+        R+L+S T+F++ +  HPE
Sbjct:    2 GTISQVRLLLWKNWTVRKRQKMRFFMEIMWPVMLFIGLVWLRKANPLYRQHECHFPNKAMPSAGVLPWIQGIFCNANNPCFQHPTRGESPGLVSNYNNSILIRFWSDAQELLLNDPEFLHLGRVWRELSSMTKFIRAIRTHPE 144          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Cavefish
Match: abca1a (ATP-binding cassette sub-family A member 1-like [Source:NCBI gene;Acc:103028164])

HSP 1 Score: 1115.91 bits (2885), Expect = 0.000e+0
Identity = 700/1952 (35.86%), Postives = 1064/1952 (54.51%), Query Frame = 1
Query:  661 KYLSVDYFHRQLLEMTAPIIFGKIYFTPDSEFTRQIIKKANITFEILDNLRLSAVEW---RLNFRDWLSNQVNNSSTLDNMSNNAKV------CMETSQNYYTVCQLIYKSSDRNRIQNSIEIASRIFD-------LIERGLNCTELNKFQPMKSKVDIDNLAQNKLIN--IFAGVVFNESFQYLTLNNATV---LNYQIRMPTNRIDSTKNFKVLDTFWNPIPRRDTIYDLKYYTSGFLFLQEAFDQAFIELVTGNVTINIGTSMQIMPYPCFVDDRFIKFLSMIMPFILIIAWTPSVTIIIKSIVYEKENRLKEFMLLMGLTNFVHWCSWFISTIVVLIFPVIFMTLILKYNEIIQFSSPGIIFILILSYVISFICQSFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENIAIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFL-EKSFEIQSET-----------------------------CHNNKASESGTKLLEFIKKII----PNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQITSEMLDTLTDGGNLP---RPV----------SVLSFRKKTINTANINDPKVSFEFENNLVLLSGLSLIFQQISGLFIKRFHHTKRNIKGXXXXXXXXXXXXXXXXXXXXXXXXMDNQPSMTISPWLMMPKTRLVN--------LNTFYRKENTSDQISFKLNENYRSDIGQSGVRCMNTSLYQL-ENFKCLYPYNTNKWSEKSPIEISLVTPECDCSTTGNQICSSPLSGGPESSNRI---------MASSDRLYDLSSYNISDYLMKNFKTFIMK-----------QYGGLQFILPSFFGQSCQVIGESQIWFD----FRQSINSSRDNNSNPEQVKFLNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFSYLRYNIS---GGDENYNAFEWDITGNKICSLGILFVGWCLIIVFMESKHKKTLCIKLK--DVKLKPYEIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFDSSVKLSDIFRVFEDLRTNE---MVKEYSVSQMSLDEVFINFAKNDS 6189
            K L      R +     P++ GKI +TPD+  T++II + N TF+ L  LR     W   R    D++ N          + NNA           T      + + + K S+  R   S      +F+        I R + C  L+K +P+ ++  + N +   L +   +AG+VF +    +  N + +   +NY+IRM  + ++ T   K+ D +W+P PR D   DL+Y   GF +LQ+  +   I  +TG+     G  +Q MPYPC+VDD F++ +S  MP  + +AW  SV IIIK +VYEKE RLKE M +MGL N + W SWFIS+++ L+     + LILK   ++ +S PG++++ ++S+ I  I Q F+IS  F  +N+AA  GGI+YF  YLP+++ + +QD +       V LL+ V+F     +    E+   G Q+SNL +S + + ++ +   + ++  D++ Y ++ WY+EAVFPG+YG+P+PWYF FT+ YW    K       + N R+  E   I   E  P DLE G+ IENLVK +      A+D L L FY+ QIT FLGHNGAGKTTT+SILTG+  PTSGTA+I+  DIR D+  IR  +G+CPQHN+LF+ LTVE+HI+FY  LKG+++ ++K ++  IV ++GL  K K  +  LSGGM+RKLS+A+AFVG S+++ LDEPTAGVDP++RRGIWDL++KYR   RTIIL+THHMDEAD L DRIAIIS GKL C GSSLFLK   G GYYL L ++ F++   +                               ++  SE+ T  +  I  +I    P+++L ++   + T VL + +     F  LF ++D  L  L I+SYG++DT+LEE+FLKVA+D + +  +  +  I S        GG+     RP           S      +  +    +D K S++       + G SL  QQ   L  KRF + +R+ KG F++++LP + + +      I       PS+ + P +   +   V+         N            S +  E  +S  G   +R     + ++ E  + ++   T  WS   P      +P C+CS      C       PE              ++ +D L +L+  NISDYL+K +   I K           +YGG      S   +S Q +  +    D     R+  +  R  +++    +FL     F      K N+ +IW N+KG+ S+ A+ N+ +N +LR+++ A      + I   N+PL  T+  L         ++V ++I VIF +SF+PASFV+FLI+ERV  +K  Q++SGV P++YW++NF WD   Y +   +VI+ F+ F  ++Y+ S N+    +LL LY  ++ P MYP SFF    STA+VV+++ N+L+G   +++TF L+L+  ++  +   ND LK +FLIFP + LGRG+ID+  +    +     G +   +   WD+ G  + ++ +  V +  I V ++ +     CIK +     LKP   I +ED DV +ER+RI L     +D+L++  LTK+Y                    + K+K AV+ +  G+  GECFGLLGVNGAGKT+TFKML G+  IT G A + G S++ +  + H+NMG+CPQFDA++ LLT  E L FY  +RG+   ++    D  ++ L L  + +K     SGGN RK+ TAIALIG P +VFLDEPT GMD  ARR LW  I ++  E + +V+LTSH+MEECE LC R+AIMV+G  + +GSVQHLK++FG  Y + +R+      L     +   I  E+  S  +KE++  +++Y+  SS  LS + R+F  L  N+    +++YSVSQ +LD+VF+NFAK+ S
Sbjct:  364 KSLESSPVSRMIWRALKPLLMGKILYTPDTPATQRIIHEVNKTFQQLGVLRDLGGMWEEMRPKVWDFMENSEEMDLVRTLLQNNASARFFNTKLKGTEWRVEDISRFLTKVSEDTRPPGSAYTWREVFNETDQAIQTISRFMECVNLDKLEPVANEERLVNKSMRLLDDRKFWAGIVFPD----IKANASEIPSNVNYKIRMDIDNVERTN--KIKDGYWDPGPRADPFEDLRYVWGGFSYLQDVIEHGIIRALTGSKE-KTGVYIQQMPYPCYVDDIFLRVMSRSMPLFMTLAWMYSVAIIIKGVVYEKEARLKETMRIMGLDNGILWLSWFISSLIPLLISAALLVLILKMGNLLPYSDPGVVYLFLVSFAIVTIMQCFLISTIFSRANLAAACGGIIYFTLYLPYVLCVAWQDYVGFGAKVVVSLLSPVAFGFGCEYFALFEEQGVGIQWSNLLSSPLEEDSYSLTTSISLMLFDALLYAVMTWYIEAVFPGQYGIPRPWYFPFTKSYWCG-EKCGWTSAQTTNKRENAEAFCI---EDVPSDLEPGVYIENLVKVYRHGNKLAVDGLTLGFYEGQITSFLGHNGAGKTTTMSILTGLFPPTSGTAYIMGKDIRSDLSAIRQNLGMCPQHNVLFSMLTVEEHIWFYARLKGLSEEKVKAEMDQIVSDLGLPHKRKSKTSQLSGGMQRKLSVALAFVGGSKVVILDEPTAGVDPYARRGIWDLLLKYRQ-GRTIILSTHHMDEADILGDRIAIISHGKLCCVGSSLFLKTQLGTGYYLTLVKRDFDLSLSSCHNSSSTVSYSKNSLKKEDSVSESSSDAGLGSDHESETTTIDVSLISNVIFKHVPSARLAEDLGHELTYVLPYEAAKDGAFVELFHEIDDRLIDLGISSYGIADTTLEEIFLKVAED-NGVDAETSDGTILSRRNRRHAFGGDHQSCLRPFTEDDSFDFNDSEGDPESRETDWLGGSDGKGSYQ-------VKGWSLKRQQFVALLWKRFLYARRSRKGFFAQIVLPAVFVCIALIFSLIVPPFGKYPSLELEPSMYEEQFTFVSNDAPEDLQTNKLLGALTERPAYSKRCAEEAKSVDGSCPIRAEEWEMPEIAETVRDMFV--TGNWSMDHP------SPSCECS------CEHSKKMLPECPPGAGGLPPPQIKVSQTDTLQNLTGRNISDYLVKTYAQIIGKSLKNKIWVNEFRYGGF-----SLGARSSQPMPPADEVHDAISHLRRRFSLERGTSAD----RFLKSLSGFIQGLDTKNNV-KIWFNNKGWHSIGAFLNVMNNGILRTSLPAGLDPAKFAIKAFNHPLNLTKEQLSQVALMTTSVDVLVSICVIFAMSFVPASFVVFLIQERVNKAKHLQFISGVQPFLYWLANFVWDMCNYIVPATLVIIIFVCFQQEAYVSSTNLPVLALLLLLYGWSITPLMYPASFFFKIPSTAYVVLTSVNILIGINGSVSTFVLELFGSNE--IGGINDILKNVFLIFPHFCLGRGLIDMVKNQAMADALERFGENRFRSPLAWDMVGKNLFAMAVEGVVFFFITVLIQYR----FCIKARGFSANLKP---IGEEDEDVARERQRI-LGGGGHSDILELRQLTKVY--------------------KRKQKPAVDRLCVGIPPGECFGLLGVNGAGKTSTFKMLTGDSVITGGEAYLAGKSVLTEIDEVHQNMGYCPQFDAINDLLTGREHLEFYAILRGVPEKEVCEVADWGIRKLGLVKYVDKAAGSYSGGNMRKLSTAIALIGGPPVVFLDEPTTGMDPKARRALWNCILSIIKEGR-SVVLTSHSMEECEALCTRMAIMVNGTFRCMGSVQHLKNRFGDGYTIVLRVAGADPQL---EPVMKFIEHELPGST-LKEKHRNMLQYQLPSS--LSSLARIFSILAKNKDELHIEDYSVSQTTLDQVFVNFAKDQS 2234          

HSP 2 Score: 182.57 bits (462), Expect = 2.283e-45
Identity = 119/370 (32.16%), Postives = 191/370 (51.62%), Query Frame = 1
Query: 2140 FSKNNDNIEISDNFRQREENIAIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKT--QWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISH 3243
            FS N   I   D    RE    + G     D LE+      L K + + + PA+D L +     +  G LG NGAGKT+T  +LTG    T G A++    +  +++ +   +G CPQ + +   LT  +H+ FY +L+G+ + E+       ++++GL K +   + + SGG  RKLS A+A +G   ++FLDEPT G+DP +RR +W+ I+      R+++LT+H M+E + LC R+AI+  G  +C GS   LK  FGDGY + L  +            A      +++FI+  +P S L ++ +   Q+ +  S +S  R     +F  L  + D L I  Y +S T+L++VF+  A D S   H
Sbjct: 1890 FSANLKPIGEEDEDVARERQRILGG-GGHSDILEL----RQLTKVYKRKQKPAVDRLCVGIPPGECFGLLGVNGAGKTSTFKMLTGDSVITGGEAYLAGKSVLTEIDEVHQNMGYCPQFDAINDLLTGREHLEFYAILRGVPEKEVCEVADWGIRKLGLVKYVDKAAGSYSGGNMRKLSTAIALIGGPPVVFLDEPTTGMDPKARRALWNCILSIIKEGRSVVLTSHSMEECEALCTRMAIMVNGTFRCMGSVQHLKNRFGDGYTIVLRVA-----------GADPQLEPVMKFIEHELPGSTLKEKHRNMLQYQLPSSLSSLAR-----IFSILAKNKDELHIEDYSVSQTTLDQVFVNFAKDQSDEDH 2238          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Cavefish
Match: abca1a (ATP-binding cassette sub-family A member 1-like [Source:NCBI gene;Acc:103028164])

HSP 1 Score: 1115.91 bits (2885), Expect = 0.000e+0
Identity = 700/1952 (35.86%), Postives = 1064/1952 (54.51%), Query Frame = 1
Query:  661 KYLSVDYFHRQLLEMTAPIIFGKIYFTPDSEFTRQIIKKANITFEILDNLRLSAVEW---RLNFRDWLSNQVNNSSTLDNMSNNAKV------CMETSQNYYTVCQLIYKSSDRNRIQNSIEIASRIFD-------LIERGLNCTELNKFQPMKSKVDIDNLAQNKLIN--IFAGVVFNESFQYLTLNNATV---LNYQIRMPTNRIDSTKNFKVLDTFWNPIPRRDTIYDLKYYTSGFLFLQEAFDQAFIELVTGNVTINIGTSMQIMPYPCFVDDRFIKFLSMIMPFILIIAWTPSVTIIIKSIVYEKENRLKEFMLLMGLTNFVHWCSWFISTIVVLIFPVIFMTLILKYNEIIQFSSPGIIFILILSYVISFICQSFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENIAIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFL-EKSFEIQSET-----------------------------CHNNKASESGTKLLEFIKKII----PNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQITSEMLDTLTDGGNLP---RPV----------SVLSFRKKTINTANINDPKVSFEFENNLVLLSGLSLIFQQISGLFIKRFHHTKRNIKGXXXXXXXXXXXXXXXXXXXXXXXXMDNQPSMTISPWLMMPKTRLVN--------LNTFYRKENTSDQISFKLNENYRSDIGQSGVRCMNTSLYQL-ENFKCLYPYNTNKWSEKSPIEISLVTPECDCSTTGNQICSSPLSGGPESSNRI---------MASSDRLYDLSSYNISDYLMKNFKTFIMK-----------QYGGLQFILPSFFGQSCQVIGESQIWFD----FRQSINSSRDNNSNPEQVKFLNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFSYLRYNIS---GGDENYNAFEWDITGNKICSLGILFVGWCLIIVFMESKHKKTLCIKLK--DVKLKPYEIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFDSSVKLSDIFRVFEDLRTNE---MVKEYSVSQMSLDEVFINFAKNDS 6189
            K L      R +     P++ GKI +TPD+  T++II + N TF+ L  LR     W   R    D++ N          + NNA           T      + + + K S+  R   S      +F+        I R + C  L+K +P+ ++  + N +   L +   +AG+VF +    +  N + +   +NY+IRM  + ++ T   K+ D +W+P PR D   DL+Y   GF +LQ+  +   I  +TG+     G  +Q MPYPC+VDD F++ +S  MP  + +AW  SV IIIK +VYEKE RLKE M +MGL N + W SWFIS+++ L+     + LILK   ++ +S PG++++ ++S+ I  I Q F+IS  F  +N+AA  GGI+YF  YLP+++ + +QD +       V LL+ V+F     +    E+   G Q+SNL +S + + ++ +   + ++  D++ Y ++ WY+EAVFPG+YG+P+PWYF FT+ YW    K       + N R+  E   I   E  P DLE G+ IENLVK +      A+D L L FY+ QIT FLGHNGAGKTTT+SILTG+  PTSGTA+I+  DIR D+  IR  +G+CPQHN+LF+ LTVE+HI+FY  LKG+++ ++K ++  IV ++GL  K K  +  LSGGM+RKLS+A+AFVG S+++ LDEPTAGVDP++RRGIWDL++KYR   RTIIL+THHMDEAD L DRIAIIS GKL C GSSLFLK   G GYYL L ++ F++   +                               ++  SE+ T  +  I  +I    P+++L ++   + T VL + +     F  LF ++D  L  L I+SYG++DT+LEE+FLKVA+D + +  +  +  I S        GG+     RP           S      +  +    +D K S++       + G SL  QQ   L  KRF + +R+ KG F++++LP + + +      I       PS+ + P +   +   V+         N            S +  E  +S  G   +R     + ++ E  + ++   T  WS   P      +P C+CS      C       PE              ++ +D L +L+  NISDYL+K +   I K           +YGG      S   +S Q +  +    D     R+  +  R  +++    +FL     F      K N+ +IW N+KG+ S+ A+ N+ +N +LR+++ A      + I   N+PL  T+  L         ++V ++I VIF +SF+PASFV+FLI+ERV  +K  Q++SGV P++YW++NF WD   Y +   +VI+ F+ F  ++Y+ S N+    +LL LY  ++ P MYP SFF    STA+VV+++ N+L+G   +++TF L+L+  ++  +   ND LK +FLIFP + LGRG+ID+  +    +     G +   +   WD+ G  + ++ +  V +  I V ++ +     CIK +     LKP   I +ED DV +ER+RI L     +D+L++  LTK+Y                    + K+K AV+ +  G+  GECFGLLGVNGAGKT+TFKML G+  IT G A + G S++ +  + H+NMG+CPQFDA++ LLT  E L FY  +RG+   ++    D  ++ L L  + +K     SGGN RK+ TAIALIG P +VFLDEPT GMD  ARR LW  I ++  E + +V+LTSH+MEECE LC R+AIMV+G  + +GSVQHLK++FG  Y + +R+      L     +   I  E+  S  +KE++  +++Y+  SS  LS + R+F  L  N+    +++YSVSQ +LD+VF+NFAK+ S
Sbjct:  364 KSLESSPVSRMIWRALKPLLMGKILYTPDTPATQRIIHEVNKTFQQLGVLRDLGGMWEEMRPKVWDFMENSEEMDLVRTLLQNNASARFFNTKLKGTEWRVEDISRFLTKVSEDTRPPGSAYTWREVFNETDQAIQTISRFMECVNLDKLEPVANEERLVNKSMRLLDDRKFWAGIVFPD----IKANASEIPSNVNYKIRMDIDNVERTN--KIKDGYWDPGPRADPFEDLRYVWGGFSYLQDVIEHGIIRALTGSKE-KTGVYIQQMPYPCYVDDIFLRVMSRSMPLFMTLAWMYSVAIIIKGVVYEKEARLKETMRIMGLDNGILWLSWFISSLIPLLISAALLVLILKMGNLLPYSDPGVVYLFLVSFAIVTIMQCFLISTIFSRANLAAACGGIIYFTLYLPYVLCVAWQDYVGFGAKVVVSLLSPVAFGFGCEYFALFEEQGVGIQWSNLLSSPLEEDSYSLTTSISLMLFDALLYAVMTWYIEAVFPGQYGIPRPWYFPFTKSYWCG-EKCGWTSAQTTNKRENAEAFCI---EDVPSDLEPGVYIENLVKVYRHGNKLAVDGLTLGFYEGQITSFLGHNGAGKTTTMSILTGLFPPTSGTAYIMGKDIRSDLSAIRQNLGMCPQHNVLFSMLTVEEHIWFYARLKGLSEEKVKAEMDQIVSDLGLPHKRKSKTSQLSGGMQRKLSVALAFVGGSKVVILDEPTAGVDPYARRGIWDLLLKYRQ-GRTIILSTHHMDEADILGDRIAIISHGKLCCVGSSLFLKTQLGTGYYLTLVKRDFDLSLSSCHNSSSTVSYSKNSLKKEDSVSESSSDAGLGSDHESETTTIDVSLISNVIFKHVPSARLAEDLGHELTYVLPYEAAKDGAFVELFHEIDDRLIDLGISSYGIADTTLEEIFLKVAED-NGVDAETSDGTILSRRNRRHAFGGDHQSCLRPFTEDDSFDFNDSEGDPESRETDWLGGSDGKGSYQ-------VKGWSLKRQQFVALLWKRFLYARRSRKGFFAQIVLPAVFVCIALIFSLIVPPFGKYPSLELEPSMYEEQFTFVSNDAPEDLQTNKLLGALTERPAYSKRCAEEAKSVDGSCPIRAEEWEMPEIAETVRDMFV--TGNWSMDHP------SPSCECS------CEHSKKMLPECPPGAGGLPPPQIKVSQTDTLQNLTGRNISDYLVKTYAQIIGKSLKNKIWVNEFRYGGF-----SLGARSSQPMPPADEVHDAISHLRRRFSLERGTSAD----RFLKSLSGFIQGLDTKNNV-KIWFNNKGWHSIGAFLNVMNNGILRTSLPAGLDPAKFAIKAFNHPLNLTKEQLSQVALMTTSVDVLVSICVIFAMSFVPASFVVFLIQERVNKAKHLQFISGVQPFLYWLANFVWDMCNYIVPATLVIIIFVCFQQEAYVSSTNLPVLALLLLLYGWSITPLMYPASFFFKIPSTAYVVLTSVNILIGINGSVSTFVLELFGSNE--IGGINDILKNVFLIFPHFCLGRGLIDMVKNQAMADALERFGENRFRSPLAWDMVGKNLFAMAVEGVVFFFITVLIQYR----FCIKARGFSANLKP---IGEEDEDVARERQRI-LGGGGHSDILELRQLTKVY--------------------KRKQKPAVDRLCVGIPPGECFGLLGVNGAGKTSTFKMLTGDSVITGGEAYLAGKSVLTEIDEVHQNMGYCPQFDAINDLLTGREHLEFYAILRGVPEKEVCEVADWGIRKLGLVKYVDKAAGSYSGGNMRKLSTAIALIGGPPVVFLDEPTTGMDPKARRALWNCILSIIKEGR-SVVLTSHSMEECEALCTRMAIMVNGTFRCMGSVQHLKNRFGDGYTIVLRVAGADPQL---EPVMKFIEHELPGST-LKEKHRNMLQYQLPSS--LSSLARIFSILAKNKDELHIEDYSVSQTTLDQVFVNFAKDQS 2234          

HSP 2 Score: 182.57 bits (462), Expect = 2.283e-45
Identity = 119/370 (32.16%), Postives = 191/370 (51.62%), Query Frame = 1
Query: 2140 FSKNNDNIEISDNFRQREENIAIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKT--QWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISH 3243
            FS N   I   D    RE    + G     D LE+      L K + + + PA+D L +     +  G LG NGAGKT+T  +LTG    T G A++    +  +++ +   +G CPQ + +   LT  +H+ FY +L+G+ + E+       ++++GL K +   + + SGG  RKLS A+A +G   ++FLDEPT G+DP +RR +W+ I+      R+++LT+H M+E + LC R+AI+  G  +C GS   LK  FGDGY + L  +            A      +++FI+  +P S L ++ +   Q+ +  S +S  R     +F  L  + D L I  Y +S T+L++VF+  A D S   H
Sbjct: 1890 FSANLKPIGEEDEDVARERQRILGG-GGHSDILEL----RQLTKVYKRKQKPAVDRLCVGIPPGECFGLLGVNGAGKTSTFKMLTGDSVITGGEAYLAGKSVLTEIDEVHQNMGYCPQFDAINDLLTGREHLEFYAILRGVPEKEVCEVADWGIRKLGLVKYVDKAAGSYSGGNMRKLSTAIALIGGPPVVFLDEPTTGMDPKARRALWNCILSIIKEGRSVVLTSHSMEECEALCTRMAIMVNGTFRCMGSVQHLKNRFGDGYTIVLRVA-----------GADPQLEPVMKFIEHELPGSTLKEKHRNMLQYQLPSSLSSLAR-----IFSILAKNKDELHIEDYSVSQTTLDQVFVNFAKDQSDEDH 2238          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002495.1 (pep scaffold:Pmarinus_7.0:GL480265:53:27909:1 gene:ENSPMAG00000002218.1 transcript:ENSPMAT00000002495.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 665.226 bits (1715), Expect = 0.000e+0
Identity = 409/1137 (35.97%), Postives = 627/1137 (55.15%), Query Frame = 1
Query: 1183 LNYQIRMPTNRIDSTKNFKVLDTFWNPIPRRDTIYDLKYYTSGFLFLQEAFDQAFIELVTGNVTINIGTSMQIMPYPCFVDDRFIKFLSMIMPFILIIAWTPSVTIIIKSIVYEKENRLKEFMLLMGLTNFVHWCSWFISTIVVLIFPVIFMTLILKYNE----IIQFSSPGIIFILILSYVISFICQSFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENIAIDGF------EKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEI--------------------QSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQITSEMLDTLTDGGNLPRPVSVLSFRKKTINTANINDPKVSFEFENNL-----VLLSGLSLIFQQISGLFIKRFHHTKRNIKGXXXXXXXXXXXXXXXXXXXXXXXXMDNQPSMTISPWLMMPKTRLVNLNTFYRKENTSDQISFKLNENYRSDIGQS--GVRCMNTSLYQLENFKCL----------------YPYNTNKWSEKSPIEISLVTPECDCSTTGNQI----CSSPLSGGPESSNRIMASSDRLYDLSSYNISDYLMKNFKTFIMK-----------QYGGLQFILPSFFGQSCQVIGESQIWFDFRQSINSSRDNN---SNPEQVKFLNYFQLFFNSSGIKTNLS--------RIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDL 4356
            + Y+IRM  + +  T   K+ D +W+P PR D   DL+Y   GF +LQ++ +Q  I   T N ++++G  +Q MPYPC+VDD F++ ++  +P  L +AW  SV +I+K +V+EKE RLKE M +MGL+  + W SWFIS ++ L+   + +T++LK  E    I+ +S P I+++ +  + I+ + Q F+IS FF  +N+AA  GGIVYF FYLP+++ + +Q++++  +     + + V+F     F    E+   G Q+ N+F+S +   ++     + M+  D+  Y L+  Y+E VFPG+YGVPKPWYF  TR YW     +    E+ +   Q++   AI G       E EP DL +G+ I+ LVK +   K  A+D L+L FYQ QIT FLGHNGAGKTTT+SILTG+  PT+GTA+IL  DIR D++ IR  +G+CPQ+N+LF  LTVE+HI+FY  LKG ++ E K ++  ++++V L+ K   +SK+LSGGM+RKLSI +AFVG S+++FLDEPTAGVDP++RRGIW+L++KYR   RTIIL+THHMDEAD L DRIAIIS G+L+CCGSSLFLK  FG GYYL + K                          E+  ++ A+   + +   +++ +P+++LI+    + T +L  +      F  LF++LD  L  L ++SYG+SDT+LEE+FLKVA++P+  SH     ++++             +PV      K               E  N L       +SG+ LI  Q   LFIKRFHH +R+ KG  +++ILP + + L      I       P + + PW+   +   ++ +     EN       K N  Y + + +   G RCMN     + +  C+                    +  WS + P      +PEC CS  G ++    C    +GGP    R+  ++D L DLS  NISDYL+K +   I K           +YGGL              +G+ ++         S +D +   +N ++V  +    +    SG+K  +S        ++W N+KG+ ++ A+ N+ +N +LRS++ A     +YGI   N+PL  T+  L
Sbjct:    5 VRYKIRMDIDSVQRTN--KIKDRYWDPGPRADPFDDLRYIWGGFAYLQDSVEQGIIRAQT-NGSLSVGVYVQQMPYPCYVDDIFLRIMNRSLPMFLTLAWMYSVAMILKEVVHEKEARLKETMRIMGLSTSMLWLSWFISILIPLLISAMLLTVLLKVREQLGNILYYSDPTIVYLYLCVFAIATVMQCFLISTFFSRANLAAATGGIVYFSFYLPYVLCVAWQNQITYSVKISTSIFSTVAFSFGSEFFSLYEEQGVGMQWENVFSSPVEGEDYTFISSIFMMLFDAFVYGLLTVYIENVFPGQYGVPKPWYFPCTRAYW---RGDTMEKELYETIAQKQPQ-AITGVPDNIYVEDEPGDLPVGVSIQGLVKIYNAGKKLAVDGLSLNFYQGQITSFLGHNGAGKTTTMSILTGLFPPTAGTAYILGRDIRTDIDKIRKNLGVCPQYNVLFDRLTVEEHIWFYARLKGRSEQEAKQEIEQMIQDVDLAHKRSDISKSLSGGMQRKLSIGIAFVGGSKVVFLDEPTAGVDPYARRGIWNLLLKYRH-GRTIILSTHHMDEADLLGDRIAIISHGRLRCCGSSLFLKNAFGAGYYLTMVKRSGSGGSNSSCLAGLASSSDEGFGSDESNPDSIAANHVSSVTRLLQQHVPDARLIENFGQELTYLLPSHGAKDGTFALLFKELDEKLAELGVSSYGVSDTTLEEIFLKVAEEPAANSHFTNGVKLSAR-----NSKYTYLQPVHAGCICKNYSTCKKAPAELGELEKLNELDGKGTQQISGVQLILLQFKALFIKRFHHARRSRKGFVAQIILPAVFVCLALVFSLIIPPFGKYPMLQLQPWMYGEQYTFLSNDA---PENV------KTNSLYDALLNKPGFGTRCMNGE--SIPDAACVETKSEWVQPPMSPAMARTMQSRNWSMEDP------SPECRCSGEGRRVILPDCPEG-AGGPPPMQRVQNTTDTLEDLSGRNISDYLVKTYPQAIRKSLKHKYWVNEIRYGGLS-------------VGKKKL-----SHSASPKDMDIVFTNVKRVFHIENKAVDVLYSGVKDMVSFLGPKETIKVWFNNKGWHAIVAFMNMANNAVLRSSLPAGTDPSDYGITAYNHPLNLTKEQL 1092          

HSP 2 Score: 169.474 bits (428), Expect = 2.085e-42
Identity = 116/380 (30.53%), Postives = 185/380 (48.68%), Query Frame = 1
Query: 5176 LQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVK-----------------IRLHPNRNSLSDRNEIETIINKEIWSSARMKEE---NAVIIE-------YRFDSSVKLSDIFR-VFEDL--RTNEM-VKEYSVSQMSLDEVFINFAKNDSVTRNISNGNAL 6222
            + + GL KIYN                      +KLAV+ +S    +G+    LG NGAGKTTT  +L G    T G A I G  I  D  K  KN+G CPQ++ L   LT EE ++FY R++G    +    ++  ++++ L    +  +  +SGG +RK+   IA +G  K+VFLDEPT G+D  ARR +W L+  L   H   +IL++H+M+E ++L  R+AI+  G ++  GS   LK+ FG  YY+                  +    +    SD +  ++I    + S  R+ ++   +A +IE       Y   S       F  +F++L  +  E+ V  Y VS  +L+E+F+  A+  +   + +NG  L
Sbjct:  363 VSIQGLVKIYNAG--------------------KKLAVDGLSLNFYQGQITSFLGHNGAGKTTTMSILTGLFPPTAGTAYILGRDIRTDIDKIRKNLGVCPQYNVLFDRLTVEEHIWFYARLKGRSEQEAKQEIEQMIQDVDLAHKRSDISKSLSGGMQRKLSIGIAFVGGSKVVFLDEPTAGVDPYARRGIWNLL--LKYRHGRTIILSTHHMDEADLLGDRIAIISHGRLRCCGSSLFLKNAFGAGYYLTMVKRSGSGGSNSSCLAGLASSSDEGFGSDESNPDSIAANHVSSVTRLLQQHVPDARLIENFGQELTYLLPSHGAKDGTFALLFKELDEKLAELGVSSYGVSDTTLEEIFLKVAEEPAANSHFTNGVKL 720          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Sea Lamprey
Match: abca12 (ATP-binding cassette, sub-family A (ABC1), member 12 [Source:ZFIN;Acc:ZDB-GENE-030131-9790])

HSP 1 Score: 412.149 bits (1058), Expect = 2.132e-117
Identity = 275/792 (34.72%), Postives = 426/792 (53.79%), Query Frame = 1
Query: 3928 RLYDLSSYNISDYLMKNFKTFIMKQYGGLQFILPSFFGQSCQVIGESQIWFDFRQSINSSRDNNSNPEQVKFLNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNY-GIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLD-LY-QYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFSYLRYNIS---GGD-ENYNAFEWDITGNKICSLGI-LFVGWCLIIVFMESKHKKTLCIKLKDVKLKPYEIITDEDLDVFKERERIELNHDVL-----NDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAII---NGYSIIDDTLKAHKN---MGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHK--VAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFDSSV-KLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKND-SVTRNISNGNALIQKP 6234
            ++++LS  ++ +YLM     +++K+YGG  F LP       +V+ +++                                  + +  N  ++W N +GY ++PAY N F+NLLL   +   +   +Y GI+V + P  Y    L   +  Q   +  +AI ++ G S +  SF   ++ ER+TGSK  Q +SGV+P  YW  NF +D + Y+++  + I    AF+  +Y  + N+ A  +LL L+  A +P MY  S   S+   AFV   + N+++G  T I+TF ++ LY   D  SL +A + ++ +FL+FPQ+ LG G++ LS   L  +I    G D +  ++F  DITG    +L +   V + L +V  +S  +     + K V+    E+    D DV  ER R+E    V+     +D LQ+ GL K Y       N+ F               AV+ +  GV   +CFGLLGVNGAGKTTTFKML G+   + G+AII   NG+S +    KA +    +G+CPQFDAL  LLT  E LY Y RIRGI    I       +  L L+ H +K     SGG KRK+ TA+ALIG P+++ LDEP+ GMD  ++R+LW+   T+T E +   +VILTSH+MEECE LC +LAIMV+G+ K +G++QHLK++FG+ + +K+RL    + +++  E  T      +  A +KE++   +E++  S+  KLS+IF   E  + +  ++ YS+SQ +LD+VFINFA+    +    SN +A    P
Sbjct: 1056 QIFNLSGEDVEEYLMGTTCQYLLKRYGGWSFGLPHSTTSDLEVVPDNR--------------------------------TLTKVWRNHMKVWYNPEGYHALPAYVNSFNNLLLWDNLPDGEHPGDYKGISVNSKP--YAGQQLSQDMILQNLGDTGVAICILLGFSILTGSFATAVVRERITGSKRLQQISGVSPTFYWAVNFTYDMVSYTVTTGLCIAVIAAFHLPAYTDNSNLGAVSLLLILFGFASLPWMYLISGVFSEEEMAFVTYISINIILGVSTIISTFLVNFLYLSSDSQSLYNAYNIMRWLFLVFPQFCLGWGLVSLSKQRLMEDIMKLLGSDPQESSSFAMDITGWPFVALAVNGIVCFTLRLVLTDSFIR---WWRRKAVEPGQPEL----DTDVQAERSRVEEQSRVVDAATPDDTLQLVGLRKRYR----LLNRSF--------------TAVDGLHLGVSPNQCFGLLGVNGAGKTTTFKMLTGDIQPSGGDAIIRTQNGHSALLKMEKARRTGTLIGYCPQFDALDDLLTGWEHLYCYARIRGIPSHHIEQVSQELVTRLHLSLHADKLVKTYSGGTKRKLSTALALIGKPQLLLLDEPSSGMDPKSKRYLWK---TITREVRGGCSVILTSHSMEECEALCDKLAIMVNGQFKCLGTLQHLKNRFGNGHMIKLRLSSGNSKVTEVTEFIT----SHFPGAYLKEQHISQLEFQVPSNAGKLSEIFIALEKEKESLSIQHYSISQTTLDQVFINFARQQIDMEEESSNADARPPVP 1781          

HSP 2 Score: 380.178 bits (975), Expect = 4.049e-107
Identity = 269/860 (31.28%), Postives = 435/860 (50.58%), Query Frame = 1
Query: 1174 ATVLNYQIRMPTNRIDSTKNFKVLDTFWNPIPRRDTIYDLKYYTSGFLFLQEAFDQAFIELVTGNVTINIGTSMQIMPYPCFVDDRFIKFLSMIMPFILIIAWTPSVTIIIKSIVYEKENRLKEFMLLMGLTNFVHWCSWFISTIVVLIFPVIFMTLILKYNEIIQFSSPGIIFILILSYVISFICQSFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELS--------------TEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTR----RYWIPFSKNNDNI--EISDNFRQREENI----------AIDG-----FEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGM--TKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEI----QSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWT-------VVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFL---KVADDP-----------------SQISHKRQ-------EKQITSEMLDT-LTDGGNLPRPVSVLSFRKKTINTANINDPKVS--------FEFENNLV---LLSGLSLIFQQISGLFIKRFHHTKRNIKG 3492
            AT LNY +R+    +  T   +  D  W P P  +  Y   YYT  FL  +   ++A I L  G         +Q MPYPC+ DD F+  + ++ P + +IAW  ++   +K +V EKE   +E+M +MG+    H+ SW + + V+L+  VI +T+ILK +  +   +  ++  L L + IS +   +M+S  F ++NVA++    +Y + + PFL   +   +L+              T   Y   L+TQ   C  +  +          Q+SN+++S +   +    +   M+ ID+  Y ++ WY+  V+PG YG+ +P+YFLFTR     + IP  K+   +   + D  +     +          A DG      E  P DL  G+ + +L K++ K K  AL +L+L FYQ QIT  LGHNGAGKTTT+S+L G+  P+SG+  +  +D R DM  +R ++G+C Q ++LF  L V +H+  YG LK +  ++  ++ ++   + ++GL      +   LSGGMKRKLSIA+AF+G S  + LDEPT+GVDP SRR IW+LI+K+R+  RTIIL+THH+DEA+ L DRIA++  GKL+CCGS  +LK+ +G G  L L K   +    QS T   ++      +++  ++  +  + L     +          ++ +H+     Q  S    L+ +++ L ++ Y +SDT+LEEV L   +V  +P                 S ++   Q         Q+  E  D  L D  N        S   +T    +   P  S        +  E +LV    ++G+ L+ ++   L  KRFHH +R++KG
Sbjct:    2 ATHLNYTLRLSIQNVMRTDYLR--DLVWVPGPHTNQNY--MYYTHAFLS-RTMLERAAISLYIGRNISEPALQVQPMPYPCYTDDSFLHSVGLMFPILFMIAWILTIASTVKFLVQEKELCQQEYMNIMGVRPASHFLSWLLQSCVLLLLMVILLTVILKASGTLPSINWALLLALFLCFGISVLAMGYMLSACFTHTNVASLTACFIYLLSFFPFLALSSLTLKLTRWQKSLIVRCLLSPTAFSYATNLITQHCTCIPMRAL---------VQWSNMYHSPLFGDDVSFAYLCWMLIIDTAIYFILGWYIRNVYPGTYGLARPFYFLFTRISSKAHGIPGQKHGSRVIRGLQDGRKGVLRGVTECSCTSPLGAPDGSMRPQLEAVPADLTAGVSLRSLTKQYSKGKKAALQDLSLDFYQDQITTLLGHNGAGKTTTMSLLMGLYEPSSGSVHVGGHDARTDMAEVRRQLGVCLQRDVLFPALNVHEHLLLYGRLKALDWSRQRLQQEVDTFLNDLGLYNHKDKLVGTLSGGMKRKLSIAIAFIGGSTTVILDEPTSGVDPCSRRSIWNLILKHRA-GRTIILSTHHLDEAEVLSDRIAVLEHGKLRCCGSPQYLKEIYGQGLTLTLTKKVRVLCLSQSVTL-GSRPPFDPERVVSLVRSGVAGAALKSGEDSSGNRNADMVFLLPAHSQNVLGQ--SFLVTLEENMEELGLSGYAISDTTLEEVCLRQQRVMSEPALGCSASARYFTPTSAASLLTKATQCGPGLYSCSQLVQEAEDQRLKDITNKSPEAESGSINSETAAPPDHTSPAASSILCLSSLWRTEKHLVKKERVTGIHLLVRKTQALIYKRFHHWRRDVKG 843          

HSP 3 Score: 165.236 bits (417), Expect = 7.387e-41
Identity = 146/537 (27.19%), Postives = 253/537 (47.11%), Query Frame = 1
Query: 1726 ICQSFMISVFFDNSNVAAIVGGIVYFIFY-LPFLVFIN---FQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNST----IIDLNFGVGHCLIMI-----------------------WIDSVFYILIAWYVEAV--FPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENIAIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIR---YDMEIIRSK---IGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVA 3219
            +  +F +  + DNSN+ A+   ++ F F  LP++  I+    ++E++   Y  + ++  VS   +   + +L  +SD     N +N      ++   F +G  L+ +                        +D   +  +A  V  +  F  +  +   +   + R+   P     D    ++  R  E++  +D     PDD    + +    +   +S T A+D L+L    +Q  G LG NGAGKTTT  +LTG + P+ G A I   +       ME  R     IG CPQ + L   LT  +H+Y Y  ++G+    I+    ++V  + LS     + K  SGG KRKLS A+A +G  +++ LDEP++G+DP S+R +W  I +      ++ILT+H M+E + LCD++AI+  G+ KC G+   LK  FG+G+ + L  S         N+K +E    + EFI    P + L ++  +Q    +    +N  + + +F  L+   + L I  Y +S T+L++VF+  A
Sbjct: 1242 VIAAFHLPAYTDNSNLGAVSLLLILFGFASLPWMYLISGVFSEEEMAFVTYISINIILGVSTIISTFLVNFLYLSSDSQSLYNAYNIMRWLFLVFPQFCLGWGLVSLSKQRLMEDIMKLLGSDPQESSSFAMDITGWPFVALAVNGIVCFTLRLVLTDSFIRWWRRKAVEPGQPELDTDVQAERSRVEEQSRVVDA--ATPDDTLQLVGLRKRYRLLNRSFT-AVDGLHLGVSPNQCFGLLGVNGAGKTTTFKMLTGDIQPSGGDAIIRTQNGHSALLKMEKARRTGTLIGYCPQFDALDDLLTGWEHLYCYARIRGIPSHHIEQVSQELVTRLHLSLHADKLVKTYSGGTKRKLSTALALIGKPQLLLLDEPSSGMDPKSKRYLWKTITREVRGGCSVILTSHSMEECEALCDKLAIMVNGQFKCLGTLQHLKNRFGNGHMIKLRLS-------SGNSKVTE----VTEFITSHFPGAYLKEQHISQLEFQV---PSNAGKLSEIFIALEKEKESLSIQHYSISQTTLDQVFINFA 1761          

HSP 4 Score: 138.658 bits (348), Expect = 8.885e-33
Identity = 78/216 (36.11%), Postives = 119/216 (55.09%), Query Frame = 1
Query: 5275 RKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSD--IPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGH 5916
            +K A+ ++S    + +   LLG NGAGKTTT  +L+G    + G+  + G+    D  +  + +G C Q D L   L   E L  Y R++ +  S   +   VD  L +L L  H +K    +SGG KRK+  AIA IG    V LDEPT G+D  +RR +W LI  L +     +IL++H+++E EVL  R+A++  G+++  GS Q+LK  +G 
Sbjct:  394 KKAALQDLSLDFYQDQITTLLGHNGAGKTTTMSLLMGLYEPSSGSVHVGGHDARTDMAEVRRQLGVCLQRDVLFPALNVHEHLLLYGRLKALDWSRQRLQQEVDTFLNDLGLYNHKDKLVGTLSGGMKRKLSIAIAFIGGSTTVILDEPTSGVDPCSRRSIWNLI--LKHRAGRTIILSTHHLDEAEVLSDRIAVLEHGKLRCCGSPQYLKEIYGQ 607          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006855.1 (pep scaffold:Pmarinus_7.0:GL486953:391:4596:1 gene:ENSPMAG00000006189.1 transcript:ENSPMAT00000006855.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 283.878 bits (725), Expect = 3.204e-86
Identity = 151/312 (48.40%), Postives = 207/312 (66.35%), Query Frame = 1
Query: 5275 RKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSD---IPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFDS-SVKLSDIFRVFEDLRTNEMVKEYSVSQMSLD---EVFINFAKNDS 6189
            R LAV+ +  GV+ GECFGLLGVNGAGKTTTFKML G+ ++T G A +NG+S++ D  K  + +G+CPQFDAL   LT  E L  Y R+RGI   D   +   V+ +L+ L LT + +KP    SGGNKRK+ TAIALIGYP ++FLDEPT GMD  ARRFLW LI  +    + +V+LTSH+MEECE LC RLAIMV+G  K +GS+QHLK++FG  Y + IR    R++L  + E+    ++  +  A +KE +   ++Y+  S ++ L+ +F   E +     V++YSVSQ +LD   +VF+NFAK  S
Sbjct:    1 RILAVDRLCVGVRPGECFGLLGVNGAGKTTTFKMLTGDASVTGGEAFLNGHSVLRDQHKVQQTIGYCPQFDALFDELTAREHLELYTRLRGIPWRDEKRVRQVVNWALQKLGLTSYADKPAGTYSGGNKRKLSTAIALIGYPPLIFLDEPTTGMDPKARRFLWNLILDIIKTGR-SVVLTSHSMEECEALCTRLAIMVNGHFKCLGSIQHLKNRFGDGYMITIR---TRSTLHVK-EVLRFFSRS-FPDAVLKERHHTKVQYQLKSETLSLAAVFTKMEQVLDVLGVEDYSVSQTTLDNDPQVFVNFAKKQS 306          

HSP 2 Score: 164.081 bits (414), Expect = 1.146e-44
Identity = 104/318 (32.70%), Postives = 169/318 (53.14%), Query Frame = 1
Query: 2296 ALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMT---KSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLE---EVFLKVADDPS 3231
            A+D L +     +  G LG NGAGKTTT  +LTG  + T G AF+  + +  D   ++  IG CPQ + LF  LT  +H+  Y  L+G+    +  ++  +   ++++GL+      +   SGG KRKLS A+A +G   +IFLDEPT G+DP +RR +W+LI+      R+++LT+H M+E + LC R+AI+  G  KC GS   LK  FGDGY + +     +  +            ++L F  +  P++ L +   T+    L   + +     ++F +++  LD L +  Y +S T+L+   +VF+  A   S
Sbjct:    4 AVDRLCVGVRPGECFGLLGVNGAGKTTTFKMLTGDASVTGGEAFLNGHSVLRDQHKVQQTIGYCPQFDALFDELTAREHLELYTRLRGIPWRDEKRVRQVVNWALQKLGLTSYADKPAGTYSGGNKRKLSTAIALIGYPPLIFLDEPTTGMDPKARRFLWNLILDIIKTGRSVVLTSHSMEECEALCTRLAIMVNGHFKCLGSIQHLKNRFGDGYMITIRTRSTLHVK------------EVLRFFSRSFPDAVLKERHHTKVQYQLKSETLS---LAAVFTKMEQVLDVLGVEDYSVSQTTLDNDPQVFVNFAKKQS 306          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004117.1 (pep scaffold:Pmarinus_7.0:GL489716:190:6182:-1 gene:ENSPMAG00000003765.1 transcript:ENSPMAT00000004117.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 287.345 bits (734), Expect = 4.191e-85
Identity = 172/471 (36.52%), Postives = 271/471 (57.54%), Query Frame = 1
Query: 1189 YQIRMPTNRIDSTKNFKVLDTFWNPIPRRDTIYDLKYYTSGFLFLQEAFDQAFIELVTGNVTINIGTSMQIMPYPCFVDDRFIKFLSMIMPFILIIAWTPSVTIIIKSIVYEKENRLKEFMLLMGLTNFVHWCSWFISTIVVLIFPVIFMTLILKYNEIIQFSSPGIIFILILSYVISFICQSFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYG-----VGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENIAIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXX--XXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIK 2580
            Y+IR  ++  + T   +    +W P P     Y   Y+  GF+++Q+  ++A I    G+  +  G  +Q+ PYPC+  D F+  +  +MP  ++I+W  SV ++I+ IV EKE+RLKE M +MGL+N V W +WFI+  + L   V  +T+ILKY +++  S   II++ +  Y ++ +   F++SV +  + +AA  GGI+YF+ Y+P++ ++  ++E++ +           L++  +F     +    E A  G Q+     S +   +F +   L+M+ +DSV Y ++ WY+EAV PG YG+P+PWYF   R YW+  S   D  E S  +  R       G EKEP  L + + IE L K +   K  AL+NL+L  Y++QI  FLGHNGAGKTTT+          PTSG+A I  +DIR +M+ IR  +G+CPQHN+LF  LTVE+H++FY  LKGM   +I+
Sbjct:    7 YKIRQNSSFTEKTNEIR--RAYWRPGPNSGGQY---YFFYGFVWIQDMIERAIINTFVGHDVVEPGNYVQLFPYPCYTRDDFLFVIEHMMPLCMVISWVYSVAMMIQHIVAEKEHRLKEVMKMMGLSNAV-WVAWFITGFLQLSITVAVLTVILKYGQVLMHSDIFIIWLFLTIYALATVMFCFLVSVLYSKARMAAACGGIMYFLSYVPYM-YVAIREEVAHDKITAFEKCIASLMSTTAFGLGAKYFALYEVAGVGIQWHTFRQSPVEGDDFNLSLALLMLLLDSVVYGVLTWYIEAVHPGTYGLPRPWYFPLQRSYWLG-SGRADAWEWS-GYEAR-------GMEKEPTHLPLVVCIERLTKVYKTGKKLALNNLSLNLYENQIVSFLGHNGAGKTTTMYDTRTTGLFPPTSGSARIYGHDIRSEMDAIRKSLGMCPQHNVLFDQLTVEEHLWFYSRLKGMQAHDIR 461          

HSP 2 Score: 65.0846 bits (157), Expect = 1.030e-10
Identity = 42/102 (41.18%), Postives = 56/102 (54.90%), Query Frame = 1
Query: 5314 EGECFGLLGVNGAGKTTTFKMLI--GEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPH 5613
            E +    LG NGAGKTTT       G    T G+A I G+ I  +     K++G CPQ + L   LT EE L+FY+R++G+Q  DI I  D   K +S +PH
Sbjct:  375 ENQIVSFLGHNGAGKTTTMYDTRTTGLFPPTSGSARIYGHDIRSEMDAIRKSLGMCPQHNVLFDQLTVEEHLWFYSRLKGMQAHDIRIETD---KRVSHSPH 473          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010397.1 (pep scaffold:Pmarinus_7.0:GL480213:155963:163950:1 gene:ENSPMAG00000009413.1 transcript:ENSPMAT00000010397.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 256.914 bits (655), Expect = 5.321e-77
Identity = 128/302 (42.38%), Postives = 189/302 (62.58%), Query Frame = 1
Query: 5281 LAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNR-NSLSDRNEIETIINKEIWSSARMKEENAVIIEYRF-DSSVKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAK 6180
            +AV+ IS G+  GECFGLLG NGAGKTTTFKML GEE  T G+A+I GYSI+ D  K  + +G+CPQFD L   +T  E L+ Y R+RG+    IP             PH        SGG KRK+ TA+AL+G P +VFLDEP+ GMD  ARR LW  +  +  E + A+++TSH+MEECE LC R+AIMV+G+ + +GS QHLKS++G  Y +  R+   + ++   ++ +ET     I     +K+++  ++ Y   D ++  + +F + E  + +  + +YS+SQ+SL++VF+ FA+
Sbjct:    4 VAVDGISVGIPAGECFGLLGFNGAGKTTTFKMLTGEETATSGDAVIGGYSILTDIRKVQQRIGYCPQFDGLLEHMTGRETLWMYARLRGVPERLIPWATRTGRVPRVAPPHRR------SGGTKRKLSTAVALMGSPPVVFLDEPSTGMDPVARRLLWDALSRVREEGR-ALVITSHSMEECEALCTRIAIMVNGQFRCLGSQQHLKSRYGSGYTLLARIRAEQADTQPFKHFVETTFPGSI-----LKDQHQGLVHYHLTDMNMSWAQVFGMLEKAKRDYCLDDYSISQISLEQVFLGFAR 293          

HSP 2 Score: 155.221 bits (391), Expect = 1.126e-41
Identity = 102/308 (33.12%), Postives = 160/308 (51.95%), Query Frame = 1
Query: 2296 ALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVA 3219
            A+D +++     +  G LG NGAGKTTT  +LTG  T TSG A I    I  D+  ++ +IG CPQ + L  ++T  + ++ Y  L+G     +  +L       G   ++    +  SGG KRKLS A+A +G+  ++FLDEP+ G+DP +RR +WD + + R   R +++T+H M+E + LC RIAI+  G+ +C GS   LK  +G GY L      E Q++T               F++   P S L D+ +    +V  H +     +  +F  L+ +     +  Y +S  SLE+VFL  A
Sbjct:    5 AVDGISVGIPAGECFGLLGFNGAGKTTTFKMLTGEETATSGDAVIGGYSILTDIRKVQQRIGYCPQFDGLLEHMTGRETLWMYARLRG-----VPERLIPWATRTGRVPRVAPPHRR-SGGTKRKLSTAVALMGSPPVVFLDEPSTGMDPVARRLLWDALSRVREEGRALVITSHSMEECEALCTRIAIMVNGQFRCLGSQQHLKSRYGSGYTLLARIRAE-QADT----------QPFKHFVETTFPGSILKDQHQ---GLVHYHLTDMNMSWAQVFGMLEKAKRDYCLDDYSISQISLEQVFLGFA 292          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Yeast
Match: PDR5 (Plasma membrane ATP-binding cassette (ABC) transporter; multidrug transporter actively regulated by Pdr1p; also involved in steroid transport, cation resistance, and cellular detoxification during exponential growth; PDR5 has a paralog, PDR15, that arose from the whole genome duplication [Source:SGD;Acc:S000005679])

HSP 1 Score: 77.0258 bits (188), Expect = 3.302e-14
Identity = 68/249 (27.31%), Postives = 119/249 (47.79%), Query Frame = 1
Query: 5110 EDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITL----GNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPIN-----VDLSLKNLSLTPHYNKPTYMISGG----NKRKMQTAIALIGYPK-IVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHN 5814
            E  D+  +R+ ++ + +  +D     GL+K       +RN C+    + + +E +R L  NN+   VK G    L+G +GAGKTT    L   E +T+    G+ ++NG   I       +++G+C Q D      T  E L F   +R  QP+++ I      V+  +K L +  + +    +   G     ++++   + L   PK +VFLDEPT G+D+     + +L++ L N H  A++ T H 
Sbjct:  835 ERSDLSSDRKMLQESSEEESDTYGEIGLSK-SEAIFHWRNLCYE---VQIKAETRRIL--NNVDGWVKPGTLTALMGASGAGKTTLLDCL--AERVTMGVITGDILVNG---IPRDKSFPRSIGYCQQQDLHLKTATVRESLRFSAYLR--QPAEVSIEEKNRYVEEVIKILEMEKYADAVVGVAGEGLNVEQRKRLTIGVELTAKPKLLVFLDEPTSGLDSQTAWSICQLMKKLAN-HGQAILCTIHQ 1069          

HSP 2 Score: 55.8398 bits (133), Expect = 8.607e-8
Identity = 52/195 (26.67%), Postives = 92/195 (47.18%), Query Frame = 1
Query: 2299 LDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQ---LPDIVKEVGLSKKLKCM----SKNLSGGMKRKLSIAMAFVGNSRI-IFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHH-----MDEADYL 2844
            L+N++       +T  +G +GAGKTT +  L   +T    T  IL N I  D    RS IG C Q ++     TV + + F   L+   +  I+ +   + +++K + + K    +     + L+   +++L+I +      ++ +FLDEPT+G+D  +   I  L+ K  +  + I+ T H      M E D L
Sbjct:  888 LNNVDGWVKPGTLTALMGASGAGKTTLLDCLAERVTMGVITGDILVNGIPRDKSFPRS-IGYCQQQDLHLKTATVRESLRFSAYLRQPAEVSIEEKNRYVEEVIKILEMEKYADAVVGVAGEGLNVEQRKRLTIGVELTAKPKLLVFLDEPTSGLDSQTAWSICQLMKKLANHGQAILCTIHQPSAILMQEFDRL 1081          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Yeast
Match: ADP1 (Putative ATP-dependent permease of the ABC transporter family [Source:SGD;Acc:S000000604])

HSP 1 Score: 72.4034 bits (176), Expect = 6.409e-13
Identity = 65/241 (26.97%), Postives = 114/241 (47.30%), Query Frame = 1
Query: 2203 AIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLK-----FYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLL---KGMTKSEIKHQLPDIVKEVGLSKKLKCMSKN-----LSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRS-INRTIILTTHH-MDEADYLCDRIAIISQGKL 2880
            A++ F +  DD    +  EN+    P   +  ++   L          QI   +G +GAGKTT + IL         +  I  N I  D +     IG   Q + L   LTV + +    LL   K ++    K ++  +++E+ +      +  N     +SGG KR++SIA   V +  ++FLDEPT+G+D  +   + + +V+  S  NRT++L+ H       YL D++ ++S+G++
Sbjct:  369 AVNNFLQNEDDTLATLSFENITYSVPSINSDGVEETVLNEISGIVKPGQILAIMGGSGAGKTTLLDILAMKRKTGHVSGSIKVNGISMDRKSFSKIIGFVDQDDFLLPTLTVFETVLNSALLRLPKALSFEAKKARVYKVLEELRIIDIKDRIIGNEFDRGISGGEKRRVSIACELVTSPLVLFLDEPTSGLDASNANNVIECLVRLSSDYNRTLVLSIHQPRSNIFYLFDKLVLLSKGEM 609          

HSP 2 Score: 65.0846 bits (157), Expect = 1.305e-10
Identity = 61/241 (25.31%), Postives = 111/241 (46.06%), Query Frame = 1
Query: 5245 AIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENI--TLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINV----------DLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEE-CEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYV 5928
            ++ +++S+   +  +N IS  VK G+   ++G +GAGKTT   +L  +       G+  +NG S+  D     K +GF  Q D L   LT  E +     +R   P  +              +L + ++      N+    ISGG KR++  A  L+  P ++FLDEPT G+DA     +   +  L++++   ++L+ H        L  +L ++  GEM   G+ + +     ++ Y+
Sbjct:  392 SVPSINSDGVEETVLNEISGIVKPGQILAIMGGSGAGKTTLLDILAMKRKTGHVSGSIKVNGISM--DRKSFSKIIGFVDQDDFLLPTLTVFETVLNSALLR--LPKALSFEAKKARVYKVLEELRIIDIKDRIIGNEFDRGISGGEKRRVSIACELVTSPLVLFLDEPTSGLDASNANNVIECLVRLSSDYNRTLVLSIHQPRSNIFYLFDKLVLLSKGEMVYSGNAKKVSEFLRNEGYI 628          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Yeast
Match: PDR15 (Plasma membrane ATP binding cassette (ABC) transporter; multidrug transporter and general stress response factor implicated in cellular detoxification; regulated by Pdr1p, Pdr3p and Pdr8p; promoter contains a PDR responsive element; PDR15 has a paralog, PDR5, that arose from the whole genome duplication [Source:SGD;Acc:S000002814])

HSP 1 Score: 70.4774 bits (171), Expect = 3.054e-12
Identity = 60/212 (28.30%), Postives = 101/212 (47.64%), Query Frame = 1
Query: 5221 FRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAH---KNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPIN-----VDLSLKNLSLTPHYNKPTYMISG-----GNKRKMQTAIALIGYPK-IVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHN 5814
            +R+ C+     +V  +  ++  +NN+   VK G    L+G +GAGKTT    L   E +T+G  +I G   +D  L+     +++G+C Q D      T  E L F   +R  QPS + I      V+  +K L +   Y+     ++G       ++++   + L   PK +VFLDEPT G+D+       +L++ L   H  A++ T H 
Sbjct:  886 WRDLCY-----DVPIKGGQRRILNNVDGWVKPGTLTALMGASGAGKTTLLDCL--AERVTMG--VITGNIFVDGRLRDESFPRSIGYCQQQDLHLKTATVRESLRFSAYLR--QPSSVSIEEKNRYVEEVIKILEMQ-QYSDAVVGVAGEGLNVEQRKRLTIGVELAARPKLLVFLDEPTSGLDSQTAWDTCQLMRKLAT-HGQAILCTIHQ 1084          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Yeast
Match: ATM1 (Mitochondrial inner membrane ATP-binding cassette (ABC) transporter; exports mitochondrially synthesized precursors of iron-sulfur (Fe/S) clusters to the cytosol; human homolog ABCB7 can complement yeast null mutant [Source:SGD;Acc:S000004916])

HSP 1 Score: 68.9366 bits (167), Expect = 6.398e-12
Identity = 73/270 (27.04%), Postives = 130/270 (48.15%), Query Frame = 1
Query: 2161 IEISDNFRQREENIAIDGFEKE---PDDLEIGILIENLVKKF-PKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIR-YDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEI----KHQLPDIVKEV--GLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIV-KYRSINRTIILTTHHMDE-ADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGY 2931
            I++   F+ R+  + I   E+    P+++   I  EN+   + P  K   L N +        T  +G +G+GK+T + ++     P SG   I   DI+ YD++ +R  IG+ PQ   LF   T+ +++ F G +    +  I    K QL  ++K++  G    +      +SGG K++L+IA   + N+RI+F DE T+ +D  + + +   I   + S +RT +   H +   AD   D+I ++  G+++  G  L L    G  Y
Sbjct:  404 IDMETLFKLRKNEVKIKNAERPLMLPENVPYDITFENVTFGYHPDRKI--LKNASFTIPAGWKTAIVGSSGSGKSTILKLVFRFYDPESGRILINGRDIKEYDIDALRKVIGVVPQDTPLFND-TIWENVKF-GRIDATDEEVITVVEKAQLAPLIKKLPQGFDTIVGERGLMISGGEKQRLAIARVLLKNARIMFFDEATSALDTHTEQALLRTIRDNFTSGSRTSVYIAHRLRTIAD--ADKIIVLDNGRVREEGKHLELLAMPGSLY 667          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Yeast
Match: YOL075C_mRNA (Putative ABC transporter [Source:SGD;Acc:S000005435])

HSP 1 Score: 68.9366 bits (167), Expect = 7.387e-12
Identity = 56/201 (27.86%), Postives = 94/201 (46.77%), Query Frame = 1
Query: 2314 LKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQL--PDIVKEVGLSKKLKCM-----SKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKY-RSINRTIILTTHH-MDEADYLCDRIAIISQGKLKCC 2889
            L    S+I+G L HNG+ +       +         A +   D      +I + +   PQ ++L   LT  + + F   LK +  SE   +L    +++E+GL      +      + LSGG KR+LSI    + N  I+FLDEPT G+D +S   +   + K  +   RT I++ H    +  +L D++ I+S+G +  C
Sbjct:   72 LNVLASKISGGLTHNGSIRYVLEDTGSEPNETEPKRAHLDGQDHPIQKHVIMAYL---PQQDVLSPRLTCRETLKFAADLK-LNSSERTKKLMVEQLIEELGLKDCADTLVGDNSHRGLSGGEKRRLSIGTQMISNPSIMFLDEPTTGLDAYSAFLVIKTLKKLAKEDGRTFIMSIHQPRSDILFLLDQVCILSKGNVVYC 268          

HSP 2 Score: 66.6254 bits (161), Expect = 3.924e-11
Identity = 55/212 (25.94%), Postives = 89/212 (41.98%), Query Frame = 1
Query: 5287 VNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIING--YSIIDDT--------------------LKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINV--------------DLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHN 5814
            VN  S  +  G    ++G +G+GKTT   +L  + +   G    NG    +++DT                    ++ H  M + PQ D L   LTC E L F         +D+ +N               +L LK+ + T   +     +SGG KR++     +I  P I+FLDEPT G+DA +   + + ++ L  E     I++ H 
Sbjct:   45 VNTFSMDLPSGSVMAVMGGSGSGKTTLLNVLASKIS---GGLTHNGSIRYVLEDTGSEPNETEPKRAHLDGQDHPIQKHVIMAYLPQQDVLSPRLTCRETLKF--------AADLKLNSSERTKKLMVEQLIEELGLKDCADTLVGDNSHRGLSGGEKRRLSIGTQMISNPSIMFLDEPTTGLDAYSAFLVIKTLKKLAKEDGRTFIMSIHQ 245          

HSP 3 Score: 59.6918 bits (143), Expect = 5.922e-9
Identity = 50/192 (26.04%), Postives = 101/192 (52.60%), Query Frame = 1
Query: 2299 LDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAF-----ILDNDIRYDMEIIRSKIGLCPQHN-ILFAYLTVEDHIYFYGLLK--GMTKSEIKHQLPDIVKEVGLSKKLKCMS--------KNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKY-RSINRTIILTTHH 2823
            L ++N  F    I   +G +G+GK++ +++++G L  +    F     I+ NDI+    + ++      Q +  L A LTV++ + +   L+   +T++E   +  ++++ +GL     C +        K +SGG KR++++ +  + +  I+ LDEPT+G+D F+   I +++ K  R   +TII+T H 
Sbjct:  710 LQSVNAIFKPGMINAIMGPSGSGKSSLLNLISGRLKSSVFAKFDTSGSIMFNDIQVSELMFKNVCSYVSQDDDHLLAALTVKETLKYAAALRLHHLTEAERMERTDNLIRSLGLKH---CENNIIGNEFVKGISGGEKRRVTMGVQLLNDPPILLLDEPTSGLDSFTSATILEILEKLCREQGKTIIITIHQ 898          

HSP 4 Score: 50.0618 bits (118), Expect = 4.069e-6
Identity = 51/201 (25.37%), Postives = 88/201 (43.78%), Query Frame = 1
Query: 5254 NVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNM--GFCPQF----DALHSLLTCEEELYFYNRIR--------GIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHN 5814
            N   E K  L   N  F  K G    ++G +G+GK++   ++ G    ++        SI+ + ++  + M    C       D L + LT +E L +   +R         ++ +D  I   L LK+       N+    ISGG KR++   + L+  P I+ LDEPT G+D+     +  +++ L  E    +I+T H 
Sbjct:  701 NFHHETKEILQSVNAIF--KPGMINAIMGPSGSGKSSLLNLISGRLKSSVFAKFDTSGSIMFNDIQVSELMFKNVCSYVSQDDDHLLAALTVKETLKYAAALRLHHLTEAERMERTDNLIR-SLGLKHCENNIIGNEFVKGISGGEKRRVTMGVQLLNDPPILLLDEPTSGLDSFTSATILEILEKLCREQGKTIIITIHQ 898          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Nematostella
Match: EDO46878 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNL9])

HSP 1 Score: 1105.51 bits (2858), Expect = 0.000e+0
Identity = 670/1747 (38.35%), Postives = 990/1747 (56.67%), Query Frame = 1
Query: 1120 IFAGVVFNESFQYLTLNNATVLNYQIRMPTNRIDSTKNFKVLDTFWNPIPRRDTIYDLKYYTSGFLFLQEAFDQAFIELVTGNVTINIGTSMQIMPYPCFVDDRFIKFLSMIMPFILIIAWTPSVTIIIKSIVYEKENRLKEFMLLMGLTNFVHWCSWFISTIVVLIFPVIFMTLILKYNEIIQFSSPGIIFILILSYVISFICQSFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWI---PFSKNNDNIEISDNFRQREENIAIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGT---------------------------KLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQITSEMLDTLTDGGNLPRPVSVLSFRKKTINTANINDPKVSFEFENNLVLLSGLSLIFQQISGLFIKRFHHTKRNIKGXXXXXXXXXXXXXXXXXXXXXXXXMDNQPSMTISPWLMMPKTRLVNLNTFYRKENTSDQISFKLNENYRSDIGQSGVRCM--NTSLYQLENFKCLYPYNTNKWSEKSPIEISLVTPECDCSTTGNQICSSPLSGGPESSNRIMASSDR--LYDLSSYNISDYLMKNFKTF------------IMKQYGGLQFILPSFFGQSCQVIGESQIWFDFRQSINSSRDNNSNPEQVKFLNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKA-LQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLS-------FSYLRYNISGGDENYNAFEWDITGNKICSLGILFVGWCLIIVFMESKHKKTLCIKLKDVK--LKPYEIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFD-SSVKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKNDS 6189
            IFAG+VF        L     + Y+IR   +    T   ++ D +W P P         Y   GF+FLQ+  D+A + +         GT  Q+ PYPC++ DRF+ ++   MP  + +AW  +  +IIKSIVYEKE RLKE M +MGL   VHW +WFI++   ++  +IF+ + LK   I+Q S P IIF+ ++ ++ + I   F+ISVFF  +NV+A  GGI++F+ YLP+ +   F+  +++       L +  +F  A N++   E+   GAQ++NL+ S I    F +G+ + M+ ID V Y L  +Y+EAV PG+YG+P+PWYF   + YW    P S + D++  S +      ++A+   E EP  L +G+ I NLVK + + K  A+D LNL  Y+ QI  FLGHNGAGKTTT+S+LTG+  PT GTA I   DIR D++++R  +G+CPQHN+LF  LTVE+H++FY  LKGM KS I  ++   +K+VGL+ K   +S NLSGGMKRKLS+AMAFV  SR++ LDEPTAGVDP++RR IWDL++KY+  +RT++L+THHMDEAD L DRIAIISQGKL+CCG+SLFLK ++G+GYYL L K  +       +  ASE  +                            +  FIK  IP++ L++   T+ T VL  ++    +F  +FE+LD +L  L + SYG+SDT+LEEVFLKVA++      + +E   ++E+    +       PV  L    +  +  +  D   S EF++     SGL+L+ +Q   L +KRFHH +RN K   +++ILP + + L   + +I+   + +P++ ++P + + +    N    Y  ++  + ++  L++ +    G  G  CM  N S   +     L P  T              +P+CDCS   N +C +              S D   +  +S  NISDYL+K +  F            I+++YGGL F                    D   ++ ++  N+S+P   +             I     +IW N+KGY ++PA+ N  SN +LR+   A       YGI   N+P+ YT+  L    + +  ++V +AI V+F LSF+PASFV+FL+ ERV+ +K    VSGV PY+YW++N+ WD   Y I  ++ +  FLAF  +SY  + N      LL LY  ++ P MYP S F S SSTA++V+ + NL VG   T+ TF L+L++ DD  L   N  LK +FL+FP Y LGRG+IDL+       FS    N++      + F WDITG  I ++ I    +  + V +E +      IKL+ VK  LKP E   +ED DV +ER+R+        D L++  LTK+Y                   S  KR +AV+ +  GV +GECFGLLGVNGAGKTTTFKML G+  +T G   ++G+SI+ D   AH++MG+CPQFDAL  LLT ++ L  Y R+RG+    IP  V+  ++ ++L  + +      SGGNKRK+ TAIAL+G P IVF+DEPT GMD  ARRFLW +I  +  E +  VILTSH+MEECE LC+R+AIMV+G+MK +GS QHLK+KFG  Y V +R+     S  D  ++   I  + + +A +K+++  ++EY+     + +S +F   E  R    +++YSV+Q +LD+VFINFAK+ +
Sbjct:    1 IFAGLVFENVDSGAELPKH--IKYKIRQDVDFTPRTD--RIRDWYWRPGPN-GWFSKQGYMNFGFVFLQDMIDRALLTISFNETVFEPGTYAQMFPYPCYIRDRFVFYIGGTMPLFMTLAWIYTAAMIIKSIVYEKEKRLKEVMKVMGLGRTVHWVAWFINSASTMLITIIFLVITLKAGRILQHSDPFIIFLFLVVFMFATIMMCFLISVFFSRANVSAACGGIIFFVTYLPYTMVRWFEAFMNSSQIAAACLSSTTAFGVACNYLARYEEQGVGAQWNNLYASPIAGDEFSLGYAMGMMMIDGVLYALATFYIEAVMPGQYGIPRPWYFPLQKSYWFPQKPASPDMDDVAFSPD-GATNNDVAM---ETEPSHLSMGVSIRNLVKIYKEGKKLAVDGLNLNLYEGQILSFLGHNGAGKTTTMSVLTGLFPPTHGTALISGYDIRTDIDMVRRNLGMCPQHNVLFDCLTVEEHLWFYASLKGMEKSRIPGEIEKFLKDVGLTNKRHELSANLSGGMKRKLSVAMAFVAESRVVILDEPTAGVDPYARRSIWDLLLKYKK-DRTVLLSTHHMDEADVLGDRIAIISQGKLQCCGTSLFLKSHYGNGYYLTLTK--KTPGLGLDSVDASERDSLGSRSSDSDPISDSVLGDYSDVYCNEKSVTSFIKSHIPSASLVEHVGTELTYVLPSHAAKEGKFQDMFEELDRNLHKLHVGSYGVSDTTLEEVFLKVAEEA-----QSEEAGTSAEVPVRRSTFTFSSHPVKCLQPPAQGDSKNDSVDG--SLEFDDR---ESGLALLLRQFFALLVKRFHHCRRNRKAFIAQIILPAVFVCLAMIVAQIRPFYE-KPALELTPHMFVKEEPYENY-VLYANDDPGEPLARNLSDAFLQYPGL-GTWCMSNNCSRKPIAFQPSLSPVPTP-------------SPDCDCSEAMN-VCPAGAG---GPPPPTWTSYDGNIIQKMSGRNISDYLLKTYMKFVKKRYINKIEIMIVREYGGLSF-------------------GDNYNNLPANVRNSSDPAIRRL------------ISPRNVKIWYNNKGYHALPAFLNTLSNTVLRAKAKARGLDPSQYGITAYNHPMNYTKEQLDDETFVKRAVDVLVAICVVFALSFVPASFVVFLVSERVSKAKHLHLVSGVKPYIYWLANYVWDMCNYFIPAMLCVFIFLAFGDESYTTAMNFPPTFCLLLLYGWSITPLMYPASHFFSVSSTAYIVLISINLFVGINCTLATFILELFE-DDKELTDINTVLKSVFLVFPNYCLGRGLIDLAKNQFLGIFSRFGVNLT-----RDPFSWDITGRNIFAMIIEGFVFFTLTVLIEYR----FFIKLRPVKVVLKPVE---EEDDDVQRERQRVNSGLGHATDALRLMNLTKVYR------------------SRRKRIVAVDRLCVGVPKGECFGLLGVNGAGKTTTFKMLTGDIPVTSGEGFVDGHSILSDINGAHQSMGYCPQFDALDDLLTAKDHLRLYARLRGVPERYIPKVVNSLIQRMNLVQYQDVCAGKYSGGNKRKLSTAIALVGNPAIVFMDEPTTGMDPKARRFLWNIITGIMKEGRT-VILTSHSMEECEALCNRVAIMVNGQMKCLGSPQHLKNKFGDGYTVILRV---AGSNPDTEQVCQFI-IQCFPNAVLKDKHHNMVEYQIPCQGLSVSRLFGHLEANRKMFDIEDYSVTQTTLDQVFINFAKDQT 1638          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Nematostella
Match: EDO38879 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBQ0])

HSP 1 Score: 578.941 bits (1491), Expect = 2.208e-173
Identity = 335/857 (39.09%), Postives = 488/857 (56.94%), Query Frame = 1
Query: 1120 IFAGVVFNESFQYLTLNNATVLNYQIRMPTNRIDSTKNFKVLDTFWNPIPRRDTIYDLKYYTSGFLFLQEAFDQAFIELVTGNVTINIGTSMQIMPYPCFVDDRFIKFLSMIMPFILIIAWTPSVTIIIKSIVYEKENRLKEFMLLMGLTNFVHWCSWFISTIVVLIFPVIFMTLILKYNEIIQFSSPGIIFILILSYVISFICQSFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQD-------ELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIP--------FSKNNDNIEISDNFRQREENIAIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSF---------EIQSETCHNNKAS-ESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVAD----DPSQISHKRQEKQITS------------------------------EMLDTLTDGGNLP------RPVSVLSFRKKTI-NTANINDPKVSFEFENNLVLLSGLSLIFQQISGLFIKRFHHTKRNIKG 3492
            I AG+VF       TL     + Y+IRM         + ++ D++W P P+    +   YY  GF++LQ+  ++A + L      I     +  MPYPC+  DRF+  +  +MP  L ++W  +V I+++SIVYEKE RLKE M +MGL+N VHW +WFI+++ V+   V+ +T+ILKY +++ FS P II++ ++ + I  I   F+IS FF  + +AA  GGI+YF+ Y+PF VF++ ++       E S +M   + LL+  +F     +    E+  +G Q+SN+  S I   +F +   L  +  D+  Y+++ WY+EAV PG YG+P+PWYF     YW            K N  +  SD      +   +  +E+EP  L +G+ I+NL K + KS T A+D LNL  Y+ QI  FLGHNGAGKTTT+SILTG+  PT+GT +I  +DIR+DM+ IR  +G+CPQHN+LF  LTV++H++FY  +KGM    +K ++  +V+++GL  K  C  + LSGGMKRKLS+AMAFV  SR + LDEPTAGVDP++RR IWDL++KY+   RTI+L+TH M+EAD L DRIAIIS GKL+C GS L+LK+ FG+GY L L K             +  T  N +AS  S  KL  FI   I +++L  +T  ++T +L  NS  R  F  LF  L+ ++D L I SYG++ T LEEVFLKV D    +   + H RQ+K  T                               EM D + + G         +P+S     +  + N A+       FE   +   L+G +L +QQ   L +KRFH+ +RN KG
Sbjct:  222 IVAGIVFTNIEPNKTL--PVHVTYKIRMNATYFTPATD-RIRDSYWRPGPQS---WGQSYYDLGFVWLQDKIERAVVNLHAMREVIKPAVYLHEMPYPCYSKDRFMLVIQHMMPLCLTVSWIYTVAIVVRSIVYEKEQRLKEVMKMMGLSNVVHWVAWFITSVSVMSITVMLLTVILKYGKVLAFSDPLIIWLSLMLFAIVTIVFCFLISAFFSKAKLAAACGGIIYFLTYMPF-VFVSIREGAAHATIESSEKM--AISLLSTSAFGLGARYFALYEEQGEGVQWSNIGKSPIRGDDFNLLKVLYFLVFDTFLYVILVWYIEAVHPGSYGLPRPWYFPIQPTYWFGHNTNACPNLRKKNYRMMTSDEMEDSPQTPGLLAYEREPVHLPLGVTIDNLQKVY-KSGTKAVDGLNLNLYEGQIMSFLGHNGAGKTTTMSILTGLFPPTAGTGYIYGHDIRFDMDKIRHNLGMCPQHNVLFDGLTVDEHLWFYARMKGMAAHAVKTEMNQLVEDIGLPNKRNCAVETLSGGMKRKLSVAMAFVAGSRTVILDEPTAGVDPYARRAIWDLLIKYKK-GRTILLSTHFMEEADILGDRIAIISSGKLRCVGSPLYLKRRFGEGYNLTLVKKSISSPHGSIGSFRRSTSSNLEASRRSEEKLTSFITSHISSAQLKHKTNQEFTFILPDNSIKRGAFKKLFADLEQNIDVLGIDSYGITHTLLEEVFLKVTDVSLNETGNMPHHRQDKLPTQLLQFPADKPGHLGHVLLSPPLPTLPTNEGLEMSDVVRNRGEDTERLLGYQPLSDSGTHQGNLYNEASNGHAAGLFEGVGSHT-LTGSALQWQQFYALMLKRFHYARRNFKG 1066          

HSP 2 Score: 375.555 bits (963), Expect = 2.025e-105
Identity = 230/634 (36.28%), Postives = 337/634 (53.15%), Query Frame = 1
Query: 3832 PECDCSTTGNQICSSPLSGGPESSNRIMASSDRLYDLSSYNISDYLMKNFKTFIMKQYGGLQFILPSFFGQSCQVIGESQIWFDFRQSINSSRDNNSNPEQVKFLNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKA-LQNYGIAVANYPLKY--TQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFS-----YLRYNISGGDENYNAFEWDITG-NKICSLGILFVGWCLIIVFMESKHKKTLCIKLKDVKLKPYEIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFL 5706
            P C CS  G        + G +    +  + D L +++  N+S+YL+   +TF M +YG L F      G   Q +               SR ++ + + V+ L   +            S+ W N+KGY ++P Y N+ +N +LR+++  SK     YGI   N+P  +  T +   S  Y +   ++ +AIFVI  +SF+PASFV+FL+ ER T +K  Q+VSGV+P VYW+SN+ WD   Y I  L  I     F   +Y    N  A + L  LY  ++ P MYP +F  S++S+A+V +   NL VG   T+TTF L L+  DD  L   ND +K I L FP Y LGRG++DL+++     Y R  I   D   + FEW I   N +C   +L  G+   I+ +  + K  L  +   V   P E    ED DV  ER+R+ L  D  +D++++  LTKIY                  S +  + LAV+ +  GV +GECFGLLGVNGAGKT+TFKML G+  +T G+A++N Y I  D  + H+ +G+CPQFDAL   +T EE +  Y R+RG+   +I   +  +++ ++LT +   P    SGGNKRK+ TAIALIG P I+FL
Sbjct: 1211 PGCRCSANGTWYLCDQGAAGKQPKELVTITRDTLQNVTGRNMSEYLLYTTQTFRMHRYGALSF------GNVVQFV--------------PSRLDSVHIDAVRRLAIREA-----------SKSWYNNKGYHALPTYLNVMNNAILRASIPKSKGNPAAYGITAYNHPFPFNSTSAVHLSADYLRQGTDLVIAIFVIIAMSFVPASFVVFLVTERSTKAKHLQFVSGVDPVVYWLSNYLWDMCNYLIPALACITLLYLFGVPAYASETNFPAVVGLFMLYGWSITPMMYPSAFCFSEASSAYVAMIVLNLFVGVTATVTTFILQLFP-DDEVLTDVNDVIKLISLGFPNYCLGRGLMDLAYNQYLSEYYR-QIGEEDSIKSPFEWMIVSRNLVC---MLMEGFAFFILTILIEFKFFLKRRRIPVSQLPIET---EDEDVAAERDRV-LRGDADDDLVKIENLTKIY-----------------YSRKRGKHLAVDRLCVGVPQGECFGLLGVNGAGKTSTFKMLTGDTAMTAGDAVLNSYRIATDIHRVHRCIGYCPQFDALIDEMTSEEHILLYARLRGVPEKEIKQVMKWAIRKMNLTQYAKTPCKTYSGGNKRKLSTAIALIGDPPIIFL 1787          

HSP 3 Score: 157.147 bits (396), Expect = 4.153e-38
Identity = 103/319 (32.29%), Postives = 166/319 (52.04%), Query Frame = 1
Query: 5284 AVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDY---YVKIRLHPNRNSL-------------SDRNE--IETIINKEIWSSARMKEENAVIIEYRF---DSSVKLSDIFRVFEDLRTN---EMVKEYSVSQMSLDEVFI 6168
            AV+ ++  + EG+    LG NGAGKTTT  +L G    T G   I G+ I  D  K   N+G CPQ + L   LT +E L+FY R++G+    +   ++  ++++ L    N     +SGG KRK+  A+A +   + V LDEPT G+D  ARR +W L+  +  +    ++L++H MEE ++L  R+AI+  G+++ +GS  +LK +FG  Y    VK  +     S+             S R+E  + + I   I SSA++K +     E+ F   D+S+K     ++F DL  N     +  Y ++   L+EVF+
Sbjct:  619 AVDGLNLNLYEGQIMSFLGHNGAGKTTTMSILTGLFPPTAGTGYIYGHDIRFDMDKIRHNLGMCPQHNVLFDGLTVDEHLWFYARMKGMAAHAVKTEMNQLVEDIGLPNKRNCAVETLSGGMKRKLSVAMAFVAGSRTVILDEPTAGVDPYARRAIWDLL--IKYKKGRTILLSTHFMEEADILGDRIAIISSGKLRCVGSPLYLKRRFGEGYNLTLVKKSISSPHGSIGSFRRSTSSNLEASRRSEEKLTSFITSHI-SSAQLKHKTNQ--EFTFILPDNSIKRGAFKKLFADLEQNIDVLGIDSYGITHTLLEEVFL 932          

HSP 4 Score: 99.7525 bits (247), Expect = 1.205e-20
Identity = 74/204 (36.27%), Postives = 107/204 (52.45%), Query Frame = 1
Query: 2116 FTRRYWIPFSKNNDNIEISDNFRQREENIAIDGFEKEPDDLEIGILIENLVKKF---PKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFL 2718
            F +R  IP S+     E  D   +R+  +  D      DDL   + IENL K +    + K  A+D L +   Q +  G LG NGAGKT+T  +LTG    T+G A +    I  D+  +   IG CPQ + L   +T E+HI  Y  L+G+ + EIK  +   ++++ L++  K   K  SGG KRKLS A+A +G+  IIFL
Sbjct: 1591 FLKRRRIPVSQLPIETEDEDVAAERDRVLRGDA----DDDL---VKIENLTKIYYSRKRGKHLAVDRLCVGVPQGECFGLLGVNGAGKTSTFKMLTGDTAMTAGDAVLNSYRIATDIHRVHRCIGYCPQFDALIDEMTSEEHILLYARLRGVPEKEIKQVMKWAIRKMNLTQYAKTPCKTYSGGNKRKLSTAIALIGDPPIIFL 1787          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Nematostella
Match: EDO48951 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI12])

HSP 1 Score: 469.929 bits (1208), Expect = 3.050e-136
Identity = 304/797 (38.14%), Postives = 466/797 (58.47%), Query Frame = 1
Query: 1123 FAGVVFNESFQYLTLNNATVLNYQIRMPTNRIDSTKNFKVLDTFWN--PIPRRDTIYDLKYYTSGFLFLQEAFDQAFIELVTGNVTINIGTSMQI--MPYPCFVDDRFIKFLSMIMPFILIIAWTPSVTIIIKSIVYEKENRLKEFMLLMGLTNFVHWCSWFISTIVVLIFPVIFMTLILKYNEIIQFSSPGIIFILILSYVISFICQSFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQ--DELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENIAIDGFEKEPDDLEIGILIENLVKKFPKSKTP--ALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQITSEMLDTLTDGGNLPRPVSVLSFRKKTINTANINDPKVSFEFENNLVLLSGLSLIFQQISGLFIKRFHHTKRNIK 3489
             A VVF+     L+L    V+ Y +RMP +     K ++   T+ N   I  R T +   Y  SGF  LQ A D A I+    ++       M I  +PYP +V D F++ ++ ++P +L +A+  S   IIK +V+EK+ RLKE M +MGL+N++HW +WFI  ++ L F +I +T+ +K  +I +FS+  ++F+  L Y+IS I   F ISVFF N  ++ + G ++++   LP+ +    +  D LS      + LL           I  LE    GA FSNL +S   D +F +   L M+ I S+ Y+++ WY+  VFPG+YG+PKP+YF F + YW  FS ++D +E      + + N AI   E EP DL IG+ I++L K F  S     A+DNL+L  Y+ QIT  LGHNGAGKTTT+SILTG+ TPTSG+A I +  I  D++ IR  +GLCPQHN+LF  LTVE+H+ F+  LKG      K ++  ++ ++ L  K K  S  LSGGMKRKL+ A+A VG S  +FLDEPT+G+DP++RR  WDL++K+++  +T+ILTTH MDEAD+L DRIAI++ G+L+CCGSSLFLK  +G GY+L L     ++ E C +N        ++  +++ +P+++++     +   VL  N      F SLF +L+++ +   IASYG+S T++EEVF+KV +       ++  + I + +L  L+         S+L ++   I        K+    ++N  L +G +L +Q    + +KRF ++KR+ K
Sbjct:  130 LAAVVFDVEKDKLSL--PKVVKYTLRMPHSSAGERKTWRTERTYPNFQGIGARTTNF---YTFSGFAILQYAIDMAIIQ-AKASLPFPFAYPMNIKQLPYPGYVQDFFVQTVANLLPLLLTLAFIYSAVSIIKELVFEKQQRLKESMKMMGLSNWIHWSAWFIKCLLFLGFTIIIITIFVKVLKIFEFSNGIVVFLFFLCYIISMISYCFFISVFFSNPTLSMLFGSVLWYAALLPYQLLAQNENYDTLSQSAKASMCLLPNTCLGIGATLIARLEGFKTGASFSNLASSPSADDHFSLAWVLGMMIISSLVYLILTWYISTVFPGQYGIPKPFYFPFMKSYWCGFS-HDDVVEA--GLERVKNNPAI---EDEPTDLAIGVQIKDLRKVFKGSTGSKVAVDNLSLNMYKGQITALLGHNGAGKTTTMSILTGLFTPTSGSAMIDNKSILTDIDGIRESLGLCPQHNVLFDRLTVEEHLEFFINLKGKYGQAAKDEVLQMITDLQLLDKRKAKSSELSGGMKRKLNCAIALVGGSETVFLDEPTSGMDPYARRATWDLLLKHKA-GKTVILTTHFMDEADFLGDRIAIMADGQLRCCGSSLFLKSRYGVGYHLTL-----VKKEDCDDN-------AIINAVRETVPSAQVLSNVGAEIEFVL--NGEASKDFESLFVKLENNKEDYGIASYGVSCTTMEEVFMKVGE-----GSEKTVEDILNLLLRILSSQ-------SLLRYQNIKI--------KILRLLKSNYPLQTGFALQWQHYKAMLVKRFINSKRDKK 879          

HSP 2 Score: 353.984 bits (907), Expect = 9.542e-99
Identity = 228/686 (33.24%), Postives = 372/686 (54.23%), Query Frame = 1
Query: 4210 NSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPL---KYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSF-----FISKSSTAFVV-ISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFSYLRYNI------------SGGDENYNAFEWDITGNKICSLGILFVGWCLIIVFMESKHKKTLCIKLKDVKLKPYEII-----TDEDLDVFKERERIE-LNHD-VLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFDSS-VKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAK 6180
            N+ GY  + +  N  SN+LL      S+     GI   N+PL      ++D  +   + +FL    AIF+  G++F+ ASF+ FL++ER + +K  Q+VSGV+ + YW + + WD + Y +  L++++ F AF  + +    ++ +  +LL L+ L V+P +Y  SF      I+ + T FV+ I ++ +L+          + L +    +L    + +  +F++ P Y +   +ID+S +Y    I            +G     ++  WD  G        L++    +++F+      TL I+++    +PY +I     T +D DV  ER R+  LN + +  + + V  LTK+Y+ S                     + AV+++  G+  GECFGLLGVNGAGKTTTF ML G+++I+ G A ++GY I     +  + +G+CPQFDA    +T  E L  + R+RG+QP  IP  V  ++++L+L    +K     SGGNKRK+ TAIAL+G P I+FLDEPT GMD  ARRFLW  +  +    + +++LTSH+MEECE LC RLAIMV+G+ K +GS QHLKS+FG  Y + +++      +S+  +  +      +  A++ E +  ++ Y+ +S+ +  S IF   E  R +  + +YSVSQ SL++VF+N AK
Sbjct: 1092 NASGYHIIASSINALSNILLAELSGDSEQ----GIETTNHPLPNNAQNKADNVTSTISVLFL----AIFMSMGMAFMAASFITFLVQERTSKAKHLQFVSGVDAFSYWSATYTWDFLNYLVPCLLILILFAAFQIEEF--ENDMGSVFLLLILFGLVVLPFIYVMSFAFKSQLIAYAMTVFVLSIMSFGMLLA---------VFLCRIPSLNLLDEAEIMHYVFMLLPTYTVSYALIDMSTNYGYRKICSTLQTVESCRDNGIQFTDSSLNWDRPG---VGQHALYMAVEAVVLFI-----LTLLIQVR----RPYRLIPICPWTSQDCDVAGERARVHSLNPEQIKKESVIVKDLTKVYHGS--------------------DRTAVDHLCIGIPRGECFGLLGVNGAGKTTTFSMLTGDQSISEGTAYLDGYDIQTHLKEVQQRIGYCPQFDAFIERMTGREMLTMFARLRGVQPDKIPNVVSTTIEHLNLGKWADKLCGDYSGGNKRKLSTAIALVGNPPIIFLDEPTTGMDPVARRFLWDSLTHVMKGGR-SIVLTSHSMEECEALCTRLAIMVNGQFKCVGSAQHLKSRFGMGYTLMLKVEARLVPVSNTEQFVS----STFPGAQLLESHNGMLTYQINSTELSWSRIFGELERNRASLNIVDYSVSQTSLEQVFLNLAK 1721          

HSP 3 Score: 199.904 bits (507), Expect = 3.375e-51
Identity = 174/641 (27.15%), Postives = 312/641 (48.67%), Query Frame = 1
Query: 1441 FLSMIMPFILIIAWTPSVTIIIKSIVYEKENRLKEFMLLMGLTNFVHWCSWFISTIVVLIFPVIFMTLILKYNEIIQFSSP-GIIFILILS---------YVISFICQSFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAI-----NFIGY---------LEQASD-GAQFSNLFNSTIIDLNF---GVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENIAIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQITSEML 3279
            F+SM M F+            I  +V E+ ++ K    + G+  F +W + +    +  + P + + ++    +I +F +  G +F+L++          YV+SF  +S +I+       ++ +  G++  +F L  +  +N  DE    M+Y   LL   +   A+     N+ GY         +E   D G QF++        LN+   GVG   + + +++V   ++   ++   P +     PW               + + +++   R R  ++  +  +KE       +++++L K +  S   A+D+L +   + +  G LG NGAGKTTT S+LTG  + + GTA++   DI+  ++ ++ +IG CPQ +     +T  + +  +  L+G+   +I + +   ++ + L K    +  + SGG KRKLS A+A VGN  IIFLDEPT G+DP +RR +WD +       R+I+LT+H M+E + LC R+AI+  G+ KC GS+  LK  FG GY L L+   E +     N +         +F+    P ++L++      T  +  NST  + ++ +F +L+ +   L I  Y +S TSLE+VFL +A +  Q S +R + + T   L
Sbjct: 1152 FMSMGMAFM--------AASFITFLVQERTSKAKHLQFVSGVDAFSYWSATYTWDFLNYLVPCLLILILFAAFQIEEFENDMGSVFLLLILFGLVVLPFIYVMSFAFKSQLIAYAMTVFVLSIMSFGMLLAVF-LCRIPSLNLLDEAEI-MHYVFMLLPTYTVSYALIDMSTNY-GYRKICSTLQTVESCRDNGIQFTD------SSLNWDRPGVGQHALYMAVEAVVLFILTLLIQVRRPYRLIPICPW--------------TSQDCDVAGE-RARVHSLNPEQIKKE------SVIVKDLTKVYHGSDRTAVDHLCIGIPRGECFGLLGVNGAGKTTTFSMLTGDQSISEGTAYLDGYDIQTHLKEVQQRIGYCPQFDAFIERMTGREMLTMFARLRGVQPDKIPNVVSTTIEHLNLGKWADKLCGDYSGGNKRKLSTAIALVGNPPIIFLDEPTTGMDPVARRFLWDSLTHVMKGGRSIVLTSHSMEECEALCTRLAIMVNGQFKCVGSAQHLKSRFGMGYTLMLK--VEARLVPVSNTE---------QFVSSTFPGAQLLESHNGMLTYQI--NSTELS-WSRIFGELERNRASLNIVDYSVSQTSLEQVFLNLAKE--QYSEERTKVKRTCGCL 1738          

HSP 4 Score: 169.474 bits (428), Expect = 7.716e-42
Identity = 107/308 (34.74%), Postives = 165/308 (53.57%), Query Frame = 1
Query: 5278 KLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRF--DSSVKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKNDSVT 6195
            K+AV+N+S  + +G+   LLG NGAGKTTT  +L G    T G+A+I+  SI+ D     +++G CPQ + L   LT EE L F+  ++G         V   + +L L       +  +SGG KRK+  AIAL+G  + VFLDEPT GMD  ARR  W L+  L ++    VILT+H M+E + L  R+AIM DG+++  GS   LKS++G  Y++ +     +    D N I   + +E   SA++       IE+    ++S     +F   E+ + +  +  Y VS  +++EVF+   +    T
Sbjct:  515 KVAVDNLSLNMYKGQITALLGHNGAGKTTTMSILTGLFTPTSGSAMIDNKSILTDIDGIRESLGLCPQHNVLFDRLTVEEHLEFFINLKGKYGQAAKDEVLQMITDLQLLDKRKAKSSELSGGMKRKLNCAIALVGGSETVFLDEPTSGMDPYARRATWDLL--LKHKAGKTVILTTHFMDEADFLGDRIAIMADGQLRCCGSSLFLKSRYGVGYHLTLV----KKEDCDDNAIINAV-RETVPSAQVLSNVGAEIEFVLNGEASKDFESLFVKLENNKEDYGIASYGVSCTTMEEVFMKVGEGSEKT 815          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Nematostella
Match: EDO32070 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SW56])

HSP 1 Score: 269.626 bits (688), Expect = 2.511e-78
Identity = 182/519 (35.07%), Postives = 294/519 (56.65%), Query Frame = 1
Query: 1321 LQEAFDQAFIELVTGNVTINI--GTSMQIMPYPCFVDDRFIKFLSMIMPFILIIAWTPSVTIIIKSIVYEKENRLKEFMLLMGLTNFVHWCSWFISTIVVLIFPVIFMTLILKYNEIIQFSSPGIIFILILSYVISFICQSFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYW-IPFSKNNDNIEISDNFRQREENIAIDGFEKEPDDLEI----GILIENLVKKFP-KSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDI-RY-DMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLC 2847
            LQ + D A I  V  N+   I    ++Q+MP   F     ++ +  I+P  +++A++P +TI++ ++V EK+ + KE M +MG+ +  +W SWF++  +V++   + M  +         S+  ++ I+   Y +S I  SFM+S  F N   A  +  +   IF +  L+       +     + V + +  +F  A+N      +   GAQFSNL        +F V +C++M+ +D + Y+LIA Y++AV P +YG  +P YF+F   +W   F +   ++E     RQ   +      + EP   E+     I I NL K FP K  T A+D +++  Y+ QIT  LGHNGAGK+T I  LTG++ P+SGTA I   DI R+ D+  +R  IG+CPQ +++F +LTV++H+ FY  LK    S+  +    I+KE+GL +K   ++KNLSGG KRKLS+ ++ VG+ +++FLDEPT+G+DP SRR +W L+ + +   + ++LTTH MDEAD L 
Sbjct:   17 LQASIDAA-ISKVVANLPFYIVPNITVQMMPKAQFTPS--LQGIQTIVPIYMVLAFSPYITILVINLVREKQEKHKELMRIMGMVDTAYWLSWFLTYAIVVLIACLIMVTVSVIAGFFGESNYLVLLIVFYLYGLSIIMLSFMMSPLFKNPKTAGFIASLFTAIFAV--LIIPLTGPSIPQYAKWLVSIFSPTAFAFALN---EAVEVHPGAQFSNLATKG----DFPVLNCIVMLIVDILLYLLIALYLDAVVPAEYGRRQPPYFIFQPSFWKTMFQRGGGSLEAHGVRRQLSAHEVYSSEDVEPVAQEMHGREAISIHNLKKVFPGKKPTVAVDGISMDIYEGQITALLGHNGAGKSTLIGALTGMIQPSSGTALIYGKDISRFGDLAELRRNIGVCPQQDVIFEFLTVKEHLEFYFKLKTGGDSQQNNGADAILKEIGLQEKKDDIAKNLSGGQKRKLSVGISLVGDPKVLFLDEPTSGMDPHSRREMWKLL-QGQCKEKCVLLTTHFMDEADILA 522          

HSP 2 Score: 129.413 bits (324), Expect = 6.361e-31
Identity = 74/191 (38.74%), Postives = 106/191 (55.50%), Query Frame = 1
Query: 5272 KRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSI--IDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLC 5838
            K  +AV+ IS  + EG+   LLG NGAGK+T    L G    + G A+I G  I    D  +  +N+G CPQ D +   LT +E L FY +++    S      D  LK + L    +     +SGG KRK+   I+L+G PK++FLDEPT GMD  +RR +W+L+Q    E    V+LT+H M+E ++L 
Sbjct:  334 KPTVAVDGISMDIYEGQITALLGHNGAGKSTLIGALTGMIQPSSGTALIYGKDISRFGDLAELRRNIGVCPQQDVIFEFLTVKEHLEFYFKLKTGGDSQQNNGADAILKEIGLQEKKDDIAKNLSGGQKRKLSVGISLVGDPKVLFLDEPTSGMDPHSRREMWKLLQGQCKEK--CVLLTTHFMDEADILA 522          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Nematostella
Match: EDO32071 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SW57])

HSP 1 Score: 205.682 bits (522), Expect = 1.380e-58
Identity = 120/313 (38.34%), Postives = 181/313 (57.83%), Query Frame = 1
Query: 5278 KLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETII---NKEIWSSARMKEENAVIIEYRFDSS--VKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKNDSVTRN 6201
            K+ V ++ FGV  GE FGLLG NGAGKTTT  M+      + G+  + GY +  +T K  ++MGFCPQ DAL   +T EE L  Y  +RG+  + I   V+  +  + +T H NK    +SGG KRK+   +A++G P ++ LDEP+ GMD  ARRFL + +           ILT+H+MEE + LC R+ IMV G++K +GS QHLKSKFG  Y ++I+L P+  S     +++T +    + ++ +A+  E     + Y+   S   KLS  F   E+ + +  ++EYS SQ +L++VF+ FA+     R 
Sbjct:    1 KVVVKDVYFGVTPGEVFGLLGPNGAGKTTTLNMMTAGIPASRGSVSVAGYDLQTETHKVFQHMGFCPQQDALFDDITLEEHLTLYASVRGVPWASIDNVVNHYMSAMKITEHANKRAKELSGGTKRKLSFGMAMLGDPDLLLLDEPSTGMDPSARRFLCKNVTGAR-----GAILTTHSMEEADALCSRVGIMVKGQLKCLGSTQHLKSKFGSGYTLEIKLSPSFQSSDPDVDMQTQLVAFVEGLFPNAKRTESFGDRVIYKVPKSNVSKLSSTFATLEEGKRSIGIEEYSFSQSTLEQVFLEFAREQDDDRT 308          

HSP 2 Score: 156.762 bits (395), Expect = 9.691e-42
Identity = 99/298 (33.22%), Postives = 171/298 (57.38%), Query Frame = 1
Query: 2332 QITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADD 3225
            ++ G LG NGAGKTTT++++T  +  + G+  +   D++ +   +   +G CPQ + LF  +T+E+H+  Y  ++G+  + I + +   +  + +++     +K LSGG KRKLS  MA +G+  ++ LDEP+ G+DP +RR     + K  +  R  ILTTH M+EAD LC R+ I+ +G+LKC GS+  LK  FG GY L ++ S   QS    ++   +  T+L+ F++ + PN+K  +    +  V+     +N ++ +S F  L+     + I  Y  S ++LE+VFL+ A +
Sbjct:   15 EVFGLLGPNGAGKTTTLNMMTAGIPASRGSVSVAGYDLQTETHKVFQHMGFCPQQDALFDDITLEEHLTLYASVRGVPWASIDNVVNHYMSAMKITEHANKRAKELSGGTKRKLSFGMAMLGDPDLLLLDEPSTGMDPSARR----FLCKNVTGARGAILTTHSMEEADALCSRVGIMVKGQLKCLGSTQHLKSKFGSGYTLEIKLSPSFQS----SDPDVDMQTQLVAFVEGLFPNAKRTESFGDR--VIYKVPKSNVSKLSSTFATLEEGKRSIGIEEYSFSQSTLEQVFLEFARE 302          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Medaka
Match: abca1a (ATP-binding cassette sub-family A member 1 [Source:NCBI gene;Acc:101163147])

HSP 1 Score: 1130.16 bits (2922), Expect = 0.000e+0
Identity = 700/1947 (35.95%), Postives = 1073/1947 (55.11%), Query Frame = 1
Query:  661 KYLSVDYFHRQLLEMTAPIIFGKIYFTPDSEFTRQIIKKANITFEILDNLRLSAVEWRLNFRDWLSNQVNNSSTLDNMSN-----------NAKVCMETSQNYYTVCQLIYKSSDRNRI-------QNSIEIASRIFDLIERGLNCTELNKFQPMKSKVDIDNLAQNKLIN--IFAGVVFNESFQYLTLNNATVLNYQIRMPTNRIDSTKNFKVLDTFWNPIPRRDTIYDLKYYTSGFLFLQEAFDQAFIELVTGNVTINIGTSMQIMPYPCFVDDRFIKFLSMIMPFILIIAWTPSVTIIIKSIVYEKENRLKEFMLLMGLTNFVHWCSWFISTIVVLIFPVIFMTLILKYNEIIQFSSPGIIFILILSYVISFICQSFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENIAIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYL-FLEKSFEIQSETCHNNKASESGTKLLE--------------------------------FIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQITSEM--LDTLTDGGNLPRPVSVLSF------RKKTINTANINDPKVSFEFENNLVLLSGLSLIFQQISGLFIKRFHHTKRNIKGXXXXXXXXXXXXXXXXXXXXXXXXMDNQPSMTISPWLMMPKTRLVNLNTFYRKENTSDQISFKLNENYRSDIGQSGVRCM------NTSLYQLENFKCLYP---------YNTNKWSEKSPIEISLVTPECDCSTTGNQI----CSSPLSGGPESSNRIMASSDRLYDLSSYNISDYLMKNFKTFIMK-----------QYGGLQFILPSFFGQSCQVIGESQ----IWFDFRQSINSSRDNNSNPEQVKFLNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFSYLRYNIS---GGDENYNAFEWDITGNKICSLGILFVGWCLIIVFMESKHKKTLCIKLKD--VKLKPYEIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLH-PNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFDSSVKLSDIFRVFEDLRTNE---MVKEYSVSQMSLDEVFINFAKNDS 6189
            K L      R +     P++ GKI +TPD+  T++II + N TF+ L  LR     W    +    N + NS  +D + N           NA++   T      V   + K+S+  R        +++   +      I R + C  L+K +P+ ++  + N + + L N   +AG+VF +       +    +NY+IRM  + ++ T   K+ D +W+P PR D   DL+Y   GF +LQ+  +Q  I  VTG+     G  +Q MPYPC+VDD F++ +S  MP  + +AW  SV IIIK +VYEKE RLKE M +MGL N   W SWFIS+++ L+     + ++LK   ++ +S PG++F+ + S+ +  I Q F+IS  F  +N+AA  GGI+YF  YLP+++ + +QD +       V LL+ V+F     +    E+   G Q+SNL  S + + ++ +   + ++  D+V Y ++ WY+E+VFPG+YG+P+PWYF FT+ YW    K N N+        ++ N  +   E+EP  +E G+ IENLVK +      A+D L+LKFY+ QIT FLGHNGAGKTTT+SILTG+  PTSGTA+IL  DIR ++  IR  +G+CPQHN+LF+ LTVE+HI+FY  LKG+++ ++K ++  IV +VGL  K K  +  LSGGM+RKLS+A+AFVG S+++ LDEPTAGVDP++RRGIWDL++KYR   RTIIL+THHMDEAD L DRIAIIS GKL C GSSLFLK + G GYYL  +++ +++  ++C N+ ++ S +K  E                                 I K +  ++L+++   + T VL + S     F  LF +LD  L  L I+SYG+SDT+LEE+FLKVA+D    + +  +  + +         D  +  +P +   F        +  +     D K SF+       + G SL  QQ   L  KRF + +R+ KG F++++LP + + +      I       PS+ + P +   +       +F   +   D  + KL        G  G RCM      NT    +E+ +   P         +    W+ ++P      +P C CS  G +     C     G P    RI +  D L +L+  N+SDYL+K +   I K           +YGG      S   +S Q +             R+  +  R   ++    +F +    F      K N+ +IW N+KG+ S+ ++ N+ +N +LR+++ A K    +GI   N+PL  T+  L         ++V ++I VIF +SF+PASFV+FLI+ERV  +K  Q++SGV P++YW++NF WD   Y +   +VI+ F+ F   +Y+ S N+    +LL LY  ++ P MYP SFF    STA+VV+++ N+L+G   +++TF L+L+  ++  +   ND LK +FLIFP + LGRG+ID+  +    +     G +   +   WD+ G  + ++ +  V +  I V ++ +     CI  +     LKP   I +ED DV +ER+R+ L+    +D+L++  LTKIY                    + K+K AV+ +  G+  GECFGLLGVNGAGKT+TFKML G+  +T G A + G S+  +  + H+NMG+CPQFDA++ LLT  E L FY  +RG+   ++    +  ++ L L  + +K     SGGN RK+ TAIALIG P +VFLDEPT GMD  ARR LW  I ++  E + +V+LTSH+MEECE LC R+AIMV+G  + +GSVQHLK++FG  Y + +R+  P+     D   +   I +E+  S  +KE++  +++Y+  SS  L+ + R+F  L  N+    +++YSVSQ +LD+VF+NFAK+ S
Sbjct:  365 KSLESSPISRMIWRALKPLLMGKILYTPDTPATQRIIHEVNKTFQELGVLRDLGGMWE-EMKPQFWNFMENSEEMDMVRNLLQSNVGAAFLNAQLS-GTEWRVSDVANFLSKASEDKRPAGTAYTWRDAFNESDHAIQTISRFMECVNLDKLEPVANEERLVNKSMSLLDNQKFWAGIVFPDIVHSDNSDLPPNVNYKIRMDIDNVERTN--KIKDGYWDPGPRADPFEDLRYVWGGFSYLQDVIEQGIIRAVTGSKE-KTGIYIQQMPYPCYVDDIFLRVMSRSMPLFMTLAWMYSVAIIIKGVVYEKEARLKETMRIMGLNNGTLWLSWFISSLIPLLISAGLLVMLLKMGNLLPYSDPGVVFLFLGSFGVVTIMQCFLISTLFSRANLAAACGGIIYFTLYLPYVLCVAWQDYVGFGAKVLVSLLSPVAFGFGCEYFALFEEQGVGIQWSNLLASPLEEDSYNLTTSICLMLFDAVLYGIMTWYIESVFPGQYGIPRPWYFPFTKSYWCG-EKENKNMSA---LLSKKGNAEV-CIEEEPGHIEPGVYIENLVKVYSHGNKLAVDGLSLKFYEGQITSFLGHNGAGKTTTMSILTGLFPPTSGTAYILGKDIRSELSTIRQNLGMCPQHNVLFSMLTVEEHIWFYARLKGLSEEKVKAEMEQIVNDVGLPHKRKSRTNTLSGGMQRKLSVALAFVGGSKVVILDEPTAGVDPYARRGIWDLLLKYRQ-GRTIILSTHHMDEADILGDRIAIISHGKLCCVGSSLFLKTHLGTGYYLTMVKRDYDLALQSCRNSASTVSYSKKTEKEDSISESSSDAGLGSEPDSETTTIDVSLISNVIFKHVREARLVEDLGHELTYVLPYQSAKDGAFVELFHELDDRLTDLGISSYGISDTTLEEIFLKVAEDSGVDAVELSDGVVPTRTRRRHAFGDHQSCLKPFTEDEFDFNDSEESRETDWLGGADGKGSFQ-------VKGWSLKRQQFVALLWKRFLYARRSRKGFFAQIVLPAVFVCIALVFSLIVPPFGKYPSLALHPSMYGEQF------SFISNDMPDDPHTNKLLGALMEKPG-FGSRCMKGEPIPNTPCTAVED-EWAVPEVSESLRDIFAKGNWTRENP------SPLCQCSCEGRKRMLPECPDGAGGLPPPQMRI-SDKDTLQNLTGRNVSDYLVKTYAQIIGKSLKNKIWVNEFRYGGF-----SLGARSSQFLSHKDDIDVAIAQLRRRFHLERGTAAD----RFFHSLSSFIQGLDSKNNV-KIWFNNKGWHSISSFLNVMNNGILRASLPAGKDPTKFGITAYNHPLNLTKEQLSQVALMTTSVDVLVSICVIFAMSFVPASFVVFLIQERVNKAKHMQFISGVQPFLYWLANFVWDMCNYIVPATLVIIIFVCFQQDAYVSSTNLPVLALLLLLYGWSITPLMYPASFFFKIPSTAYVVLTSVNILIGINGSVSTFVLELFGSNE--IGGINDILKNVFLIFPHFCLGRGLIDMVKNQAMADALERFGENRFRSPLAWDMVGKNLFAMAVEGVVFFCITVLIQYR----FCITTRSSISHLKP---IGEEDEDVARERQRV-LSGSGQSDILELRELTKIY--------------------KRKQKPAVDRLCVGIPPGECFGLLGVNGAGKTSTFKMLTGDSLVTSGEAYLAGKSVTTEIDEVHQNMGYCPQFDAINDLLTGREHLEFYAILRGVPEKEVCEVAEWGIRKLGLVKYVDKSAGSYSGGNMRKLSTAIALIGGPPVVFLDEPTTGMDPKARRALWNAILSIIKEGR-SVVLTSHSMEECEALCTRMAIMVNGRFRCLGSVQHLKNRFGDGYTIILRVAGPD----PDLRPVMGFIERELPGST-LKEKHRNMLQYQLPSS--LTSLARIFSLLSKNKETLCIEDYSVSQTTLDQVFVNFAKDQS 2230          

HSP 2 Score: 183.726 bits (465), Expect = 1.080e-45
Identity = 162/626 (25.88%), Postives = 287/626 (45.85%), Query Frame = 1
Query: 1465 ILIIAWTPSVTIIIKSIVYEKENRLKEFMLLMGLTNFVHWCSWFISTIVVLIFP---VIFMTLILKYNEIIQFSSPGIIFILILSYVISFICQSFMISVFFDNSNVAAIV-----------GGIVYFIFYL---------------PFLVFINFQDELSTEMYYGVGLLTQV---SFCNAINFIGYLEQASDGAQFSNLFNSTII-DLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENIAIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISH 3243
            I  +++ P+  ++   ++ E+ N+ K    + G+  F++W + F+  +   I P   VI + +  + +  +  ++  ++ +L+L Y  S     +  S FF   + A +V           G +  F+  L                FL+F +F          G GL+  V   +  +A+   G            N F S +  D+   VG  L  + ++ V +  I   ++            + F  T R  I   K     E  D  R+R+  ++  G   + D LE+      L K + + + PA+D L +     +  G LG NGAGKT+T  +LTG    TSG A++    +  +++ +   +G CPQ + +   LT  +H+ FY +L+G+ + E+       ++++GL K +   + + SGG  RKLS A+A +G   ++FLDEPT G+DP +RR +W+ I+      R+++LT+H M+E + LC R+AI+  G+ +C GS   LK  FGDGY + L  +                   ++ FI++ +P S L ++ +      L  + T+      +F  L  + + L I  Y +S T+L++VF+  A D S   H
Sbjct: 1667 IFAMSFVPASFVVF--LIQERVNKAKHMQFISGVQPFLYWLANFVWDMCNYIVPATLVIIIFVCFQQDAYVSSTNLPVLALLLLLYGWSITPLMYPASFFFKIPSTAYVVLTSVNILIGINGSVSTFVLELFGSNEIGGINDILKNVFLIFPHF--------CLGRGLIDMVKNQAMADALERFG-----------ENRFRSPLAWDM---VGKNLFAMAVEGVVFFCITVLIQ------------YRFCITTRSSISHLKPIGE-EDEDVARERQRVLSGSG---QSDILEL----RELTKIYKRKQKPAVDRLCVGIPPGECFGLLGVNGAGKTSTFKMLTGDSLVTSGEAYLAGKSVTTEIDEVHQNMGYCPQFDAINDLLTGREHLEFYAILRGVPEKEVCEVAEWGIRKLGLVKYVDKSAGSYSGGNMRKLSTAIALIGGPPVVFLDEPTTGMDPKARRALWNAILSIIKEGRSVVLTSHSMEECEALCTRMAIMVNGRFRCLGSVQHLKNRFGDGYTIILRVA-----------GPDPDLRPVMGFIERELPGSTLKEKHRNMLQYQLPSSLTS---LARIFSLLSKNKETLCIEDYSVSQTTLDQVFVNFAKDQSDEDH 2234          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Medaka
Match: ENSORLT00000045391.1 (ATP-binding cassette sub-family A member 1-like [Source:NCBI gene;Acc:101164844])

HSP 1 Score: 1130.16 bits (2922), Expect = 0.000e+0
Identity = 685/1898 (36.09%), Postives = 1069/1898 (56.32%), Query Frame = 1
Query:  712 PIIFGKIYFTPDSEFTRQIIKKANITFEILDNLRLSAVEWRLNFRDWLSNQVNNSSTLDNMSNNAKVCMETSQNYYTVCQLIYKSSDRNRIQNSIEIASRIFDLIERGLNCTELNKFQPMKSKVDIDNLAQNKLIN--IFAGVVFNESFQYLTLNNATVLNYQIRMPTNRIDSTKNFKVLDTFWNPIPRRDTIYDLKYYTSGFLFLQEAFDQAFIELVTGNVTINIGTSMQIMPYPCFVDDRFIKFLSMIMPFILIIAWTPSVTIIIKSIVYEKENRLKEFMLLMGLTNFVHWCSWFISTIVVLIFPVIFMTLILKYNEIIQFSSPGIIFILILSYVISFICQSFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENIAIDGFEKEPD-DLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKS----FEIQSETCHNNKASESGTK----------------------------LLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADD------------PSQISHKRQEKQITSEMLDTLTDGGNLPRPVSVLSFRKKTINTANINDPKVSFEFEN-NLVLLSGLSLIFQQISGLFIKRFHHTKRNIKGXXXXXXXXXXXXXXXXXXXXXXXXMDNQPSMTISPWLMMPKTRLVNLNTFYRKENTSDQISFKLNENYRSDIGQSGVRCMNTSLYQLENFKC-------LYP---------YNTNKWSEKSPIEISLVTPECDCSTTGNQI----CSSPLSGGPESSNRIMASSDRLYDLSSYNISDYLMKNFKTFIMKQYGGLQFILPSFFGQSCQVIGESQIWFDFRQSINSSRDNNSNPEQVKFLNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFSYLRYNI---SGGDENYNAFEWDITGNKICSL---GILFVGWCLIIVFMESKHKKTLCIKLKDVKLKPYEIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFDSSV-KLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAK 6180
            P++ GK+ +TPD+   R ++++AN TF  L  ++  A  W  +   ++   V N + + N S+       T     +              +++    +    L+ + L C ELNKF+ + ++ ++   A   L N   +AG+VF E+ Q  + +    L Y+IRM    +  T   KV +  W+P    +   +L+Y   GF +L++  D A I L T + +  +G  +Q MPYPC+VDD F++ L+  +P  + IAW  SV +I+K IV +KE+RLKE + +MGL   V+W +W ++ ++ +    + +T+I+KY +++Q+S P ++FI +L + +S I + F+ISVFF  +N+AA  GG++YF+ YLP ++   ++D +  +   GV LL+ V+F      +   E+   G Q+ N+  S      +     ++M+ +D+  Y ++ WY+E VFPG+YG+P+PWYFLFT  YW  F K +   +I DNF+  + +   + F ++PD +++ G+ I NLVK +   K  A+D L++ FY++QIT FLGHNGAGKTTT+SILTG+  PTSGTA I   DIR DM+ IR  +G+CPQHN+LF  LTVE+HIYFYG LKG+  SE++ ++  ++K+VGL  K K + KNLSGGM+RKLS+A+AFVG S+I+FLDEPTAGVDPF+RRGIWDL++KY+   RTIIL+THHMDEAD L DRIAIIS GK++CCGSS+FLK++FG GYYL L +S       Q     +  A E  T+                            + +F+++ +P +  ++    + T +L +       F +LF++LD  +D L + SYG+SDT+LEE+FLKVA+D            P    +K+  ++     +      G   +  +    +KK  N   + D K S        V+++G  LI QQ   LFIKRFHH +R+ KGL ++++LP + + L      I  S  + PS+ + PW+   +T      TFY  +   D    ++ E    + G  G RCM  +   +    C         P         +    WS  +P      +P C CST G  I    C    +GG     R+  ++D L +L+S N++D+L+K ++    K+YGG+     S  G + QV+            I  +  N   P     +   ++     G + N+ ++W  +KG+ SM ++ ++ +N +LR  +   + L+ YG++V+N+PL  ++  L     A    +V ++I VIF +SFIPASFV+FLI+ERV+ +K  Q+VSGVNP VYW+++F WD   Y I   +V+  F+ F  ++Y+  +N+ A I+LL +Y  A+ P MYP SF  +  STA+VV++  NL +G   ++ TF ++L++  D S+   N+ +K++ LIFP + LGRG++D++ +    N+    G D   +   W++ G  + ++   G +   + L+I     ++K     +L   K++  E    ED+DV +ER+R+       NDVL++  LTK+Y                      K   AV  +  GV   ECFGLLG+NGAGKTTTFKML G+  ++ G A +NGYSI       H+NMG+CPQFDA++ LL   E L  Y R+RG+   ++ +  +  ++ L L  + NK     SGGNKRK+ TA+ALIG P ++FLDEPT GMD  ARRFLW  I ++  E + +V+LTSH+MEECE LC R+AIMV+G  + +GS+QHLK++FG  Y + +R+        D   +E  + +E +    +KE++   ++Y+  S    L+ IF    D +    +++YSVSQ +LD+VF+NFAK
Sbjct:   61 PLLKGKVLYTPDTPAARLLVEEANATFMALAAIKEFADSWGED-GPFVWGFVENGTAVVNESSANSNNSSTDTPPTS--------------EDAYNDLTHFLKLLSKVLGCFELNKFEAVPTEYELVTEALEHLKNDTFWAGIVF-ENLQPNSSSIPPYLKYKIRMDVEEVQRTD--KVENRLWSPGANDNPYENLRYIWGGFAYLEDIIDHASIRLQT-STSQPLGVYVQQMPYPCYVDDPFLRALAGFLPLFMTIAWIFSVALIVKGIVGDKESRLKETVRIMGLRGEVYWSTWLLTCLLPMAISSVLLTIIIKYGKVLQYSDPSVVFIFLLVFCLSTISECFLISVFFSKANLAAACGGLIYFLLYLPHVLCYAWRDVMGFQAKVGVSLLSCVAFGYGCENLSKFEEQGVGIQWHNIATSPEEGQRYTFIVSILMMLLDAAIYWVLTWYIENVFPGQYGIPRPWYFLFTYSYW--FGKTSVPEDIPDNFKLLKRSSVPNEFLEKPDPNMKAGVSIRNLVKIYKTGKKVAVDGLSVDFYENQITSFLGHNGAGKTTTMSILTGLFPPTSGTALINGYDIRTDMDNIRKYLGMCPQHNVLFDELTVEEHIYFYGRLKGLNPSELQTEMDQMIKDVGLLHKRKDLVKNLSGGMQRKLSVAIAFVGGSKIVFLDEPTAGVDPFARRGIWDLLLKYKK-GRTIILSTHHMDEADILGDRIAIISHGKMRCCGSSIFLKKSFGSGYYLTLVRSGTEVMTAQRSGIISGIAEEKPTESDCPSSSSLDEDRGCQSSDNSNPTDLKHVTQFVRRHVPEAVFLESIGQEITFILPYARARDGTFATLFQELDKVMDKLGLTSYGVSDTTLEEIFLKVAEDTGVDKELSPTKEPVVKDYKKDSRESKRRSMSRFH--GKAAKGNTKDELKKKLSN--KVEDFKKSASVNGRGSVVITGWKLIRQQFLALFIKRFHHARRSRKGLIAQVVLPAIFVCLALVFSLIVPSFTDYPSLELQPWMYNSQT------TFYSNDMPEDANVSRVVETLVDNPG-FGTRCMEGN--PIPRLPCSSGASDWFSPSVDQSVADIFLNGNWSMSNP------SPSCQCSTPGRTIIMPDCPP-GAGGLPPPQRVQNTTDTLLNLTSINMTDFLLKTYEHSGKKRYGGI-----SVGGINSQVLLT-------EVEIEEAFANLEPPGYGDTIQKAEMVLKKLGTRNNV-KVWFYNKGWHSMVSFLSVVNNGILRGYLPEGQNLRQYGLSVSNHPLNLSKEQLSLSAMASTSSDVVVSICVIFAMSFIPASFVLFLIQERVSKAKHLQFVSGVNPTVYWVASFVWDICNYVIPCFLVVGIFICFQQKAYVSPQNLPALILLLVMYGWAITPMMYPASFIFTVPSTAYVVLTCLNLFIGINGSVATFVMELFE--DESITKINNIVKQVLLIFPHFCLGRGLMDMARNQAMANVFSNFGEDRFEDPLSWNMVGKNLIAMSIQGAVMFAFTLLI-----QYKFFYKPRLSLPKVQSEE---KEDVDVARERQRVHEGR-ANNDVLRICDLTKVY--------------------PRKSTPAVYRLCVGVPAAECFGLLGINGAGKTTTFKMLTGDIPVSSGEAFLNGYSIRTQMGDVHQNMGYCPQFDAINDLLNGREHLELYARLRGVPEEEVAMVAEWGIQKLGLVKYANKSAGTYSGGNKRKLSTAMALIGCPPVIFLDEPTTGMDPKARRFLWDCILSVIKEGR-SVVLTSHSMEECEALCTRMAIMVNGRFQCLGSIQHLKNRFGDGYTLIVRVG---GCPPDLKPVEDFV-EETFPGTVLKEKHHNTLQYQLLSQEGALAKIFTELTDHQQELGLEDYSVSQTTLDQVFVNFAK 1867          

HSP 2 Score: 177.563 bits (449), Expect = 7.075e-44
Identity = 164/631 (25.99%), Postives = 290/631 (45.96%), Query Frame = 1
Query: 1465 ILIIAWTPSVTIIIKSIVYEKENRLKEFMLLMGLTNFVHWCSWFISTIVVLIFPVIFMTLILKYNEIIQFSSP---GIIFILILSYVISFICQSFMISVFFDNSNVAAIV-----------GGIVYFIFYLPFLVFINFQDELSTEMYYGVG--LLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPF--SKNNDNIEISDNFRQREENIAIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNN-KASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNS------TNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQITSEMLD 3282
            I  +++ P+  ++   ++ E+ ++ K    + G+   V+W + F+  I   + P   +  I    +   + SP     + +L++ Y  +     +  S  F   + A +V           G +  F+  L       F+DE  T++   V   LL    FC      G ++ A + A  +N+F+      NFG       +  + V   LIA  ++      + +   + F +  R  +P   S+  ++++++     RE     +G  +  +D+   + I +L K +P+  TPA+  L +    ++  G LG NGAGKTTT  +LTG +  +SG AF+    IR  M  +   +G CPQ + +   L   +H+  Y  L+G+ + E+       ++++GL K     +   SGG KRKLS AMA +G   +IFLDEPT G+DP +RR +WD I+      R+++LT+H M+E + LC R+AI+  G+ +C GS   LK  FGDGY L       ++   C  + K  E      +F+++  P + L ++          HN+      +       +F +L      L +  Y +S T+L++VF+  A +     H  ++ Q     +D
Sbjct: 1307 IFAMSFIPASFVLF--LIQERVSKAKHLQFVSGVNPTVYWVASFVWDICNYVIPCFLVVGIFICFQQKAYVSPQNLPALILLLVMYGWAITPMMYPASFIFTVPSTAYVVLTCLNLFIGINGSVATFVMEL-------FEDESITKINNIVKQVLLIFPHFCLGR---GLMDMARNQA-MANVFS------NFGEDRFEDPLSWNMVGKNLIAMSIQGAVMFAFTLLIQYKFFYKPRLSLPKVQSEEKEDVDVA-----RERQRVHEG--RANNDV---LRICDLTKVYPRKSTPAVYRLCVGVPAAECFGLLGINGAGKTTTFKMLTGDIPVSSGEAFLNGYSIRTQMGDVHQNMGYCPQFDAINDLLNGREHLELYARLRGVPEEEVAMVAEWGIQKLGLVKYANKSAGTYSGGNKRKLSTAMALIGCPPVIFLDEPTTGMDPKARRFLWDCILSVIKEGRSVVLTSHSMEECEALCTRMAIMVNGRFQCLGSIQHLKNRFGDGYTLI------VRVGGCPPDLKPVE------DFVEETFPGTVLKEK---------HHNTLQYQLLSQEGALAKIFTELTDHQQELGLEDYSVSQTTLDQVFVNFAKE----QHDEEDLQAHDNPVD 1883          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Medaka
Match: abca1a (ATP-binding cassette sub-family A member 1 [Source:NCBI gene;Acc:101163147])

HSP 1 Score: 1129.39 bits (2920), Expect = 0.000e+0
Identity = 700/1950 (35.90%), Postives = 1073/1950 (55.03%), Query Frame = 1
Query:  661 KYLSVDYFHRQLLEMTAPIIFGKIYFTPDSEFTRQIIKKANITFEILDNLRLSAVEWRLNFRDWLSNQVNNSSTLDNMSN-----------NAKVCMETSQNYYTVCQLIYKSSDRNRI-------QNSIEIASRIFDLIERGLNCTELNKFQPMKSKVDIDNLAQNKLIN--IFAGVVFNESFQYLTLNNATVLNYQIRMPTNRIDSTKNFKVLDTFWNPIPRRDTIYDLKYYTSGFLFLQEAFDQAFIELVTGNVTINIGTSMQIMPYPCFVDDRFIKFLSMIMPFILIIAWTPSVTIIIKSIVYEKENRLKEFMLLMGLTNFVHWCSWFISTIVVLIFPVIFMTLILKYNEIIQFSSPGIIFILILSYVISFICQSFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENIAIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYL-FLEKSFEIQSETCHNNKASESGTKLLE--------------------------------FIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQITSEM--LDTLTDGGNLPRPVSVLSF---------RKKTINTANINDPKVSFEFENNLVLLSGLSLIFQQISGLFIKRFHHTKRNIKGXXXXXXXXXXXXXXXXXXXXXXXXMDNQPSMTISPWLMMPKTRLVNLNTFYRKENTSDQISFKLNENYRSDIGQSGVRCM------NTSLYQLENFKCLYP---------YNTNKWSEKSPIEISLVTPECDCSTTGNQI----CSSPLSGGPESSNRIMASSDRLYDLSSYNISDYLMKNFKTFIMK-----------QYGGLQFILPSFFGQSCQVIGESQ----IWFDFRQSINSSRDNNSNPEQVKFLNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFSYLRYNIS---GGDENYNAFEWDITGNKICSLGILFVGWCLIIVFMESKHKKTLCIKLKD--VKLKPYEIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLH-PNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFDSSVKLSDIFRVFEDLRTNE---MVKEYSVSQMSLDEVFINFAKNDS 6189
            K L      R +     P++ GKI +TPD+  T++II + N TF+ L  LR     W    +    N + NS  +D + N           NA++   T      V   + K+S+  R        +++   +      I R + C  L+K +P+ ++  + N + + L N   +AG+VF +       +    +NY+IRM  + ++ T   K+ D +W+P PR D   DL+Y   GF +LQ+  +Q  I  VTG+     G  +Q MPYPC+VDD F++ +S  MP  + +AW  SV IIIK +VYEKE RLKE M +MGL N   W SWFIS+++ L+     + ++LK   ++ +S PG++F+ + S+ +  I Q F+IS  F  +N+AA  GGI+YF  YLP+++ + +QD +       V LL+ V+F     +    E+   G Q+SNL  S + + ++ +   + ++  D+V Y ++ WY+E+VFPG+YG+P+PWYF FT+ YW    K N N+        ++ N  +   E+EP  +E G+ IENLVK +      A+D L+LKFY+ QIT FLGHNGAGKTTT+SILTG+  PTSGTA+IL  DIR ++  IR  +G+CPQHN+LF+ LTVE+HI+FY  LKG+++ ++K ++  IV +VGL  K K  +  LSGGM+RKLS+A+AFVG S+++ LDEPTAGVDP++RRGIWDL++KYR   RTIIL+THHMDEAD L DRIAIIS GKL C GSSLFLK + G GYYL  +++ +++  ++C N+ ++ S +K  E                                 I K +  ++L+++   + T VL + S     F  LF +LD  L  L I+SYG+SDT+LEE+FLKVA+D    + +  +  + +         D  +  +P +   F           +  +     D K SF+       + G SL  QQ   L  KRF + +R+ KG F++++LP + + +      I       PS+ + P +   +       +F   +   D  + KL        G  G RCM      NT    +E+ +   P         +    W+ ++P      +P C CS  G +     C     G P    RI +  D L +L+  N+SDYL+K +   I K           +YGG      S   +S Q +             R+  +  R   ++    +F +    F      K N+ +IW N+KG+ S+ ++ N+ +N +LR+++ A K    +GI   N+PL  T+  L         ++V ++I VIF +SF+PASFV+FLI+ERV  +K  Q++SGV P++YW++NF WD   Y +   +VI+ F+ F   +Y+ S N+    +LL LY  ++ P MYP SFF    STA+VV+++ N+L+G   +++TF L+L+  ++  +   ND LK +FLIFP + LGRG+ID+  +    +     G +   +   WD+ G  + ++ +  V +  I V ++ +     CI  +     LKP   I +ED DV +ER+R+ L+    +D+L++  LTKIY                    + K+K AV+ +  G+  GECFGLLGVNGAGKT+TFKML G+  +T G A + G S+  +  + H+NMG+CPQFDA++ LLT  E L FY  +RG+   ++    +  ++ L L  + +K     SGGN RK+ TAIALIG P +VFLDEPT GMD  ARR LW  I ++  E + +V+LTSH+MEECE LC R+AIMV+G  + +GSVQHLK++FG  Y + +R+  P+     D   +   I +E+  S  +KE++  +++Y+  SS  L+ + R+F  L  N+    +++YSVSQ +LD+VF+NFAK+ S
Sbjct:  365 KSLESSPISRMIWRALKPLLMGKILYTPDTPATQRIIHEVNKTFQELGVLRDLGGMWE-EMKPQFWNFMENSEEMDMVRNLLQSNVGAAFLNAQLS-GTEWRVSDVANFLSKASEDKRPAGTAYTWRDAFNESDHAIQTISRFMECVNLDKLEPVANEERLVNKSMSLLDNQKFWAGIVFPDIVHSDNSDLPPNVNYKIRMDIDNVERTN--KIKDGYWDPGPRADPFEDLRYVWGGFSYLQDVIEQGIIRAVTGSKE-KTGIYIQQMPYPCYVDDIFLRVMSRSMPLFMTLAWMYSVAIIIKGVVYEKEARLKETMRIMGLNNGTLWLSWFISSLIPLLISAGLLVMLLKMGNLLPYSDPGVVFLFLGSFGVVTIMQCFLISTLFSRANLAAACGGIIYFTLYLPYVLCVAWQDYVGFGAKVLVSLLSPVAFGFGCEYFALFEEQGVGIQWSNLLASPLEEDSYNLTTSICLMLFDAVLYGIMTWYIESVFPGQYGIPRPWYFPFTKSYWCG-EKENKNMSA---LLSKKGNAEV-CIEEEPGHIEPGVYIENLVKVYSHGNKLAVDGLSLKFYEGQITSFLGHNGAGKTTTMSILTGLFPPTSGTAYILGKDIRSELSTIRQNLGMCPQHNVLFSMLTVEEHIWFYARLKGLSEEKVKAEMEQIVNDVGLPHKRKSRTNTLSGGMQRKLSVALAFVGGSKVVILDEPTAGVDPYARRGIWDLLLKYRQ-GRTIILSTHHMDEADILGDRIAIISHGKLCCVGSSLFLKTHLGTGYYLTMVKRDYDLALQSCRNSASTVSYSKKTEKEDSISESSSDAGLGSEPDSETTTIDVSLISNVIFKHVREARLVEDLGHELTYVLPYQSAKDGAFVELFHELDDRLTDLGISSYGISDTTLEEIFLKVAEDSGVDAVELSDGVVPTRTRRRHAFGDHQSCLKPFTEDEFDFNDSEGDPESRETDWLGGADGKGSFQ-------VKGWSLKRQQFVALLWKRFLYARRSRKGFFAQIVLPAVFVCIALVFSLIVPPFGKYPSLALHPSMYGEQF------SFISNDMPDDPHTNKLLGALMEKPG-FGSRCMKGEPIPNTPCTAVED-EWAVPEVSESLRDIFAKGNWTRENP------SPLCQCSCEGRKRMLPECPDGAGGLPPPQMRI-SDKDTLQNLTGRNVSDYLVKTYAQIIGKSLKNKIWVNEFRYGGF-----SLGARSSQFLSHKDDIDVAIAQLRRRFHLERGTAAD----RFFHSLSSFIQGLDSKNNV-KIWFNNKGWHSISSFLNVMNNGILRASLPAGKDPTKFGITAYNHPLNLTKEQLSQVALMTTSVDVLVSICVIFAMSFVPASFVVFLIQERVNKAKHMQFISGVQPFLYWLANFVWDMCNYIVPATLVIIIFVCFQQDAYVSSTNLPVLALLLLLYGWSITPLMYPASFFFKIPSTAYVVLTSVNILIGINGSVSTFVLELFGSNE--IGGINDILKNVFLIFPHFCLGRGLIDMVKNQAMADALERFGENRFRSPLAWDMVGKNLFAMAVEGVVFFCITVLIQYR----FCITTRSSISHLKP---IGEEDEDVARERQRV-LSGSGQSDILELRELTKIY--------------------KRKQKPAVDRLCVGIPPGECFGLLGVNGAGKTSTFKMLTGDSLVTSGEAYLAGKSVTTEIDEVHQNMGYCPQFDAINDLLTGREHLEFYAILRGVPEKEVCEVAEWGIRKLGLVKYVDKSAGSYSGGNMRKLSTAIALIGGPPVVFLDEPTTGMDPKARRALWNAILSIIKEGR-SVVLTSHSMEECEALCTRMAIMVNGRFRCLGSVQHLKNRFGDGYTIILRVAGPD----PDLRPVMGFIERELPGST-LKEKHRNMLQYQLPSS--LTSLARIFSLLSKNKETLCIEDYSVSQTTLDQVFVNFAKDQS 2233          

HSP 2 Score: 183.726 bits (465), Expect = 1.019e-45
Identity = 162/626 (25.88%), Postives = 287/626 (45.85%), Query Frame = 1
Query: 1465 ILIIAWTPSVTIIIKSIVYEKENRLKEFMLLMGLTNFVHWCSWFISTIVVLIFP---VIFMTLILKYNEIIQFSSPGIIFILILSYVISFICQSFMISVFFDNSNVAAIV-----------GGIVYFIFYL---------------PFLVFINFQDELSTEMYYGVGLLTQV---SFCNAINFIGYLEQASDGAQFSNLFNSTII-DLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENIAIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISH 3243
            I  +++ P+  ++   ++ E+ N+ K    + G+  F++W + F+  +   I P   VI + +  + +  +  ++  ++ +L+L Y  S     +  S FF   + A +V           G +  F+  L                FL+F +F          G GL+  V   +  +A+   G            N F S +  D+   VG  L  + ++ V +  I   ++            + F  T R  I   K     E  D  R+R+  ++  G   + D LE+      L K + + + PA+D L +     +  G LG NGAGKT+T  +LTG    TSG A++    +  +++ +   +G CPQ + +   LT  +H+ FY +L+G+ + E+       ++++GL K +   + + SGG  RKLS A+A +G   ++FLDEPT G+DP +RR +W+ I+      R+++LT+H M+E + LC R+AI+  G+ +C GS   LK  FGDGY + L  +                   ++ FI++ +P S L ++ +      L  + T+      +F  L  + + L I  Y +S T+L++VF+  A D S   H
Sbjct: 1670 IFAMSFVPASFVVF--LIQERVNKAKHMQFISGVQPFLYWLANFVWDMCNYIVPATLVIIIFVCFQQDAYVSSTNLPVLALLLLLYGWSITPLMYPASFFFKIPSTAYVVLTSVNILIGINGSVSTFVLELFGSNEIGGINDILKNVFLIFPHF--------CLGRGLIDMVKNQAMADALERFG-----------ENRFRSPLAWDM---VGKNLFAMAVEGVVFFCITVLIQ------------YRFCITTRSSISHLKPIGE-EDEDVARERQRVLSGSG---QSDILEL----RELTKIYKRKQKPAVDRLCVGIPPGECFGLLGVNGAGKTSTFKMLTGDSLVTSGEAYLAGKSVTTEIDEVHQNMGYCPQFDAINDLLTGREHLEFYAILRGVPEKEVCEVAEWGIRKLGLVKYVDKSAGSYSGGNMRKLSTAIALIGGPPVVFLDEPTTGMDPKARRALWNAILSIIKEGRSVVLTSHSMEECEALCTRMAIMVNGRFRCLGSVQHLKNRFGDGYTIILRVA-----------GPDPDLRPVMGFIERELPGSTLKEKHRNMLQYQLPSSLTS---LARIFSLLSKNKETLCIEDYSVSQTTLDQVFVNFAKDQSDEDH 2237          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Medaka
Match: ENSORLT00000046301.1 (ATP-binding cassette sub-family A member 1-like [Source:NCBI gene;Acc:101164844])

HSP 1 Score: 1127.46 bits (2915), Expect = 0.000e+0
Identity = 687/1898 (36.20%), Postives = 1067/1898 (56.22%), Query Frame = 1
Query:  712 PIIFGKIYFTPDSEFTRQIIKKANITFEILDNLRLSAVEWRLNFRDWLSNQVNNSSTLDNMSNNAKVCMETSQNYYTVCQLIYKSSDRNRIQNSIEIASRIFDLIERGLNCTELNKFQPMKSKVDIDNLAQNKLIN--IFAGVVFNESFQYLTLNNATVLNYQIRMPTNRIDSTKNFKVLDTFWNPIPRRDTIYDLKYYTSGFLFLQEAFDQAFIELVTGNVTINIGTSMQIMPYPCFVDDRFIKFLSMIMPFILIIAWTPSVTIIIKSIVYEKENRLKEFMLLMGLTNFVHWCSWFISTIVVLIFPVIFMTLILKYNEIIQFSSPGIIFILILSYVISFICQSFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENIAIDGFEKEPD-DLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKS----FEIQSETCHNNKASESGTK----------------------------LLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADD------------PSQISHKRQEKQITSEMLDTLTDGGNLPRPVSVLSFRKKTINTANINDPKVSFEFEN-NLVLLSGLSLIFQQISGLFIKRFHHTKRNIKGXXXXXXXXXXXXXXXXXXXXXXXXMDNQPSMTISPWLMMPKTRLVNLNTFYRKENTSDQISFKLNENYRSDIGQSGVRCMNTSLYQLENFKC-------LYP---------YNTNKWSEKSPIEISLVTPECDCSTTGNQI----CSSPLSGGPESSNRIMASSDRLYDLSSYNISDYLMKNFKTFIMKQYGGLQFILPSFFGQSCQVIGESQIWFDFRQSINSSRDNNSNPEQVKFLNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFSYLRYNI---SGGDENYNAFEWDITGNKICSL---GILFVGWCLIIVFMESKHKKTLCIKLKDVKLKPYEIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFDSSV-KLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAK 6180
            P++ GK+ +TPD+   R ++++AN TF  L  ++  A  W  +   ++   V N + + N S+       T     +              +++    +    L+ + L C ELNKF+ + ++ ++   A   L N   +AG+VF E+ Q  + +    L Y+IRM    +  T   KV +  W+P    +   +L+Y   GF +L++  D A I L T + +  +G  +Q MPYPC+VDD FI+ +  I+P  LI+A+  SV + IK +V EKE RLKE +  +G+ N   W S F  T+++L  P + M++++KY +++Q+S P ++FI +L + +S I + F+ISVFF  +N+AA  GG++YF+ YLP ++   ++D +  +   GV LL+ V+F      +   E+   G Q+ N+  S      +     ++M+ +D+  Y ++ WY+E VFPG+YG+P+PWYFLFT  YW  F K +   +I DNF+  + +   + F ++PD +++ G+ I NLVK +   K  A+D L++ FY++QIT FLGHNGAGKTTT+SILTG+  PTSGTA I   DIR DM+ IR  +G+CPQHN+LF  LTVE+HIYFYG LKG+  SE++ ++  ++K+VGL  K K + KNLSGGM+RKLS+A+AFVG S+I+FLDEPTAGVDPF+RRGIWDL++KY+   RTIIL+THHMDEAD L DRIAIIS GK++CCGSS+FLK++FG GYYL L +S       Q     +  A E  T+                            + +F+++ +P +  ++    + T +L +       F +LF++LD  +D L + SYG+SDT+LEE+FLKVA+D            P    +K+  ++     +      G   +  +    +KK  N   + D K S        V+++G  LI QQ   LFIKRFHH +R+ KGL ++++LP + + L      I  S  + PS+ + PW+   +T      TFY  +   D    ++ E    + G  G RCM  +   +    C         P         +    WS  +P      +P C CST G  I    C    +GG     R+  ++D L +L+S N++D+L+K ++    K+YGG+     S  G + QV+            I  +  N   P     +   ++     G + N+ ++W  +KG+ SM ++ ++ +N +LR  +   + L+ YG++V+N+PL  ++  L     A    +V ++I VIF +SFIPASFV+FLI+ERV+ +K  Q+VSGVNP VYW+++F WD   Y I   +V+  F+ F  ++Y+  +N+ A I+LL +Y  A+ P MYP SF  +  STA+VV++  NL +G   ++ TF ++L++  D S+   N+ +K++ LIFP + LGRG++D++ +    N+    G D   +   W++ G  + ++   G +   + L+I     ++K     +L   K++  E    ED+DV +ER+R+       NDVL++  LTK+Y                      K   AV  +  GV   ECFGLLG+NGAGKTTTFKML G+  ++ G A +NGYSI       H+NMG+CPQFDA++ LL   E L  Y R+RG+   ++ +  +  ++ L L  + NK     SGGNKRK+ TA+ALIG P ++FLDEPT GMD  ARRFLW  I ++  E + +V+LTSH+MEECE LC R+AIMV+G  + +GS+QHLK++FG  Y + +R+        D   +E  + +E +    +KE++   ++Y+  S    L+ IF    D +    +++YSVSQ +LD+VF+NFAK
Sbjct:   61 PLLKGKVLYTPDTPAARLLVEEANATFMALAAIKEFADSWGED-GPFVWGFVENGTAVVNESSANSNNSSTDTPPTS--------------EDAYNDLTHFLKLLSKVLGCFELNKFEAVPTEYELVTEALEHLKNDTFWAGIVF-ENLQPNSSSIPPYLKYKIRMDVEEVQRTD--KVENRLWSPGANDNPYENLRYIWGGFAYLEDIIDHASIRLQT-STSQPLGVYVQQMPYPCYVDDPFIQSIGAILPMFLILAFMSSVAMTIKGLVLEKELRLKEVLRGVGIQNGALWSSTFTETMILLTVPCVLMSVMVKYGKVLQYSDPSVVFIFLLVFCLSTISECFLISVFFSKANLAAACGGLIYFLLYLPHVLCYAWRDVMGFQAKVGVSLLSCVAFGYGCENLSKFEEQGVGIQWHNIATSPEEGQRYTFIVSILMMLLDAAIYWVLTWYIENVFPGQYGIPRPWYFLFTYSYW--FGKTSVPEDIPDNFKLLKRSSVPNEFLEKPDPNMKAGVSIRNLVKIYKTGKKVAVDGLSVDFYENQITSFLGHNGAGKTTTMSILTGLFPPTSGTALINGYDIRTDMDNIRKYLGMCPQHNVLFDELTVEEHIYFYGRLKGLNPSELQTEMDQMIKDVGLLHKRKDLVKNLSGGMQRKLSVAIAFVGGSKIVFLDEPTAGVDPFARRGIWDLLLKYKK-GRTIILSTHHMDEADILGDRIAIISHGKMRCCGSSIFLKKSFGSGYYLTLVRSGTEVMTAQRSGIISGIAEEKPTESDCPSSSSLDEDRGCQSSDNSNPTDLKHVTQFVRRHVPEAVFLESIGQEITFILPYARARDGTFATLFQELDKVMDKLGLTSYGVSDTTLEEIFLKVAEDTGVDKELSPTKEPVVKDYKKDSRESKRRSMSRFH--GKAAKGNTKDELKKKLSN--KVEDFKKSASVNGRGSVVITGWKLIRQQFLALFIKRFHHARRSRKGLIAQVVLPAIFVCLALVFSLIVPSFTDYPSLELQPWMYNSQT------TFYSNDMPEDANVSRVVETLVDNPG-FGTRCMEGN--PIPRLPCSSGASDWFSPSVDQSVADIFLNGNWSMSNP------SPSCQCSTPGRTIIMPDCPP-GAGGLPPPQRVQNTTDTLLNLTSINMTDFLLKTYEHSGKKRYGGI-----SVGGINSQVLLT-------EVEIEEAFANLEPPGYGDTIQKAEMVLKKLGTRNNV-KVWFYNKGWHSMVSFLSVVNNGILRGYLPEGQNLRQYGLSVSNHPLNLSKEQLSLSAMASTSSDVVVSICVIFAMSFIPASFVLFLIQERVSKAKHLQFVSGVNPTVYWVASFVWDICNYVIPCFLVVGIFICFQQKAYVSPQNLPALILLLVMYGWAITPMMYPASFIFTVPSTAYVVLTCLNLFIGINGSVATFVMELFE--DESITKINNIVKQVLLIFPHFCLGRGLMDMARNQAMANVFSNFGEDRFEDPLSWNMVGKNLIAMSIQGAVMFAFTLLI-----QYKFFYKPRLSLPKVQSEE---KEDVDVARERQRVHEGR-ANNDVLRICDLTKVY--------------------PRKSTPAVYRLCVGVPAAECFGLLGINGAGKTTTFKMLTGDIPVSSGEAFLNGYSIRTQMGDVHQNMGYCPQFDAINDLLNGREHLELYARLRGVPEEEVAMVAEWGIQKLGLVKYANKSAGTYSGGNKRKLSTAMALIGCPPVIFLDEPTTGMDPKARRFLWDCILSVIKEGR-SVVLTSHSMEECEALCTRMAIMVNGRFQCLGSIQHLKNRFGDGYTLIVRVG---GCPPDLKPVEDFV-EETFPGTVLKEKHHNTLQYQLLSQEGALAKIFTELTDHQQELGLEDYSVSQTTLDQVFVNFAK 1867          

HSP 2 Score: 177.563 bits (449), Expect = 6.783e-44
Identity = 164/631 (25.99%), Postives = 290/631 (45.96%), Query Frame = 1
Query: 1465 ILIIAWTPSVTIIIKSIVYEKENRLKEFMLLMGLTNFVHWCSWFISTIVVLIFPVIFMTLILKYNEIIQFSSP---GIIFILILSYVISFICQSFMISVFFDNSNVAAIV-----------GGIVYFIFYLPFLVFINFQDELSTEMYYGVG--LLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPF--SKNNDNIEISDNFRQREENIAIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNN-KASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNS------TNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQITSEMLD 3282
            I  +++ P+  ++   ++ E+ ++ K    + G+   V+W + F+  I   + P   +  I    +   + SP     + +L++ Y  +     +  S  F   + A +V           G +  F+  L       F+DE  T++   V   LL    FC      G ++ A + A  +N+F+      NFG       +  + V   LIA  ++      + +   + F +  R  +P   S+  ++++++     RE     +G  +  +D+   + I +L K +P+  TPA+  L +    ++  G LG NGAGKTTT  +LTG +  +SG AF+    IR  M  +   +G CPQ + +   L   +H+  Y  L+G+ + E+       ++++GL K     +   SGG KRKLS AMA +G   +IFLDEPT G+DP +RR +WD I+      R+++LT+H M+E + LC R+AI+  G+ +C GS   LK  FGDGY L       ++   C  + K  E      +F+++  P + L ++          HN+      +       +F +L      L +  Y +S T+L++VF+  A +     H  ++ Q     +D
Sbjct: 1307 IFAMSFIPASFVLF--LIQERVSKAKHLQFVSGVNPTVYWVASFVWDICNYVIPCFLVVGIFICFQQKAYVSPQNLPALILLLVMYGWAITPMMYPASFIFTVPSTAYVVLTCLNLFIGINGSVATFVMEL-------FEDESITKINNIVKQVLLIFPHFCLGR---GLMDMARNQA-MANVFS------NFGEDRFEDPLSWNMVGKNLIAMSIQGAVMFAFTLLIQYKFFYKPRLSLPKVQSEEKEDVDVA-----RERQRVHEG--RANNDV---LRICDLTKVYPRKSTPAVYRLCVGVPAAECFGLLGINGAGKTTTFKMLTGDIPVSSGEAFLNGYSIRTQMGDVHQNMGYCPQFDAINDLLNGREHLELYARLRGVPEEEVAMVAEWGIQKLGLVKYANKSAGTYSGGNKRKLSTAMALIGCPPVIFLDEPTTGMDPKARRFLWDCILSVIKEGRSVVLTSHSMEECEALCTRMAIMVNGRFQCLGSIQHLKNRFGDGYTLI------VRVGGCPPDLKPVE------DFVEETFPGTVLKEK---------HHNTLQYQLLSQEGALAKIFTELTDHQQELGLEDYSVSQTTLDQVFVNFAKE----QHDEEDLQAHDNPVD 1883          
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Medaka
Match: abca1a (ATP-binding cassette sub-family A member 1 [Source:NCBI gene;Acc:101163147])

HSP 1 Score: 1123.61 bits (2905), Expect = 0.000e+0
Identity = 696/1944 (35.80%), Postives = 1066/1944 (54.84%), Query Frame = 1
Query:  661 KYLSVDYFHRQLLEMTAPIIFGKIYFTPDSEFTRQIIKKANITFEILDNLRLSAVEWRLNFRDWLSNQVNNSSTLDNMSN-----------NAKVCMETSQNYYTVCQLIYKSSDRNRI-------QNSIEIASRIFDLIERGLNCTELNKFQPMKSKVDIDNLAQNKLIN--IFAGVVFNESFQYLTLNNATVLNYQIRMPTNRIDSTKNFKVLDTFWNPIPRRDTIYDLKYYTSGFLFLQEAFDQAFIELVTGNVTINIGTSMQIMPYPCFVDDRFIKFLSMIMPFILIIAWTPSVTIIIKSIVYEKENRLKEFMLLMGLTNFVHWCSWFISTIVVLIFPVIFMTLILKYNEIIQFSSPGIIFILILSYVISFICQSFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENIAIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYL-FLEKSFEIQSETCHNNKASESGTKLLE-------------------------------FIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQITSEM--LDTLTDGGNLPRPVSVLSF---------RKKTINTANINDPKVSFEFENNLVLLSGLSLIFQQISGLFIKRFHHTKRNIKGXXXXXXXXXXXXXXXXXXXXXXXXMDNQPSMTISPWLMMPKTRLVNLNTFYRKENTSDQISFKLNENYRSDIGQSGVRCM------NTSLYQLENFKCLYP---------YNTNKWSEKSPIEISLVTPECDCSTTGNQI----CSSPLSGGPESSNRIMASSDRLYDLSSYNISDYLMKNFKTFIMK-----------QYGGLQFILPSFFGQSCQVIGESQIWFDFRQSINSSRDNNSNPEQVKFLNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFSYLRYNIS---GGDENYNAFEWDITGNKICSLGILFVGWCLIIVFMESKHKKTLCIKLKD--VKLKPYEIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFDSSVKLSDIFRVFEDLRTNE---MVKEYSVSQMSLDEVFINFAKNDS 6189
            K L      R +     P++ GKI +TPD+  T++II + N TF+ L  LR     W    +    N + NS  +D + N           NA++   T      V   + K+S+  R        +++   +      I R + C  L+K +P+ ++  + N + + L N   +AG+VF +       +    +NY+IRM  + ++ T   K+ D +W+P PR D   DL+Y   GF +LQ+  +Q  I  VTG+     G  +Q MPYPC+VDD F++ +S  MP  + +AW  SV IIIK +VYEKE RLKE M +MGL N   W SWFIS+++ L+     + ++LK   ++ +S PG++F+ + S+ +  I Q F+IS  F  +N+AA  GGI+YF  YLP+++ + +QD +       V LL+ V+F     +    E+   G Q+SNL  S + + ++ +   + ++  D+V Y ++ WY+E+VFPG+YG+P+PWYF FT+ YW    K N N+        ++ N  +   E+EP  +E G+ IENLVK +      A+D L+LKFY+ QIT FLGHNGAGKTTT+SILTG+  PTSGTA+IL  DIR ++  IR  +G+CPQHN+LF+ LTVE+HI+FY  LKG+++ ++K ++  IV +VGL  K K  +  LSGGM+RKLS+A+AFVG S+++ LDEPTAGVDP++RRGIWDL++KYR   RTIIL+THHMDEAD L DRIAIIS GKL C GSSLFLK + G GYYL  +++ +++  ++C N+ ++ S +K  E                                I K +  ++L+++   + T VL + S     F  LF +LD  L  L I+SYG+SDT+LEE+FLKVA+D    + +  +  + +         D  +  +P +   F           +  +     D K SF+       + G SL  QQ   L  KRF + +R+ KG F++++LP + + +      I       PS+ + P +   +       +F   +   D  + KL        G  G RCM      NT    +E+ +   P         +    W+ ++P      +P C CS  G +     C     G P          + L +L+  N+SDYL+K +   I K           +YGG      S   +S Q +              S +D+       +F +    F      K N+ +IW N+KG+ S+ ++ N+ +N +LR+++ A K    +GI   N+PL  T+  L         ++V ++I VIF +SF+PASFV+FLI+ERV  +K  Q++SGV P++YW++NF WD   Y +   +VI+ F+ F   +Y+ S N+    +LL LY  ++ P MYP SFF    STA+VV+++ N+L+G   +++TF L+L+  ++  +   ND LK +FLIFP + LGRG+ID+  +    +     G +   +   WD+ G  + ++ +  V +  I V ++ +     CI  +     LKP   I +ED DV +ER+R+ L+    +D+L++  LTKIY                    + K+K AV+ +  G+  GECFGLLGVNGAGKT+TFKML G+  +T G A + G S+  +  + H+NMG+CPQFDA++ LLT  E L FY  +RG+   ++    +  ++ L L  + +K     SGGN RK+ TAIALIG P +VFLDEPT GMD  ARR LW  I ++  E + +V+LTSH+MEECE LC R+AIMV+G  + +GSVQHLK++FG  Y + +R+        D   +   I +E+  S  +KE++  +++Y+  SS  L+ + R+F  L  N+    +++YSVSQ +LD+VF+NFAK+ S
Sbjct:  352 KSLESSPISRMIWRALKPLLMGKILYTPDTPATQRIIHEVNKTFQELGVLRDLGGMWE-EMKPQFWNFMENSEEMDMVRNLLQSNVGAAFLNAQLS-GTEWRVSDVANFLSKASEDKRPAGTAYTWRDAFNESDHAIQTISRFMECVNLDKLEPVANEERLVNKSMSLLDNQKFWAGIVFPDIVHSDNSDLPPNVNYKIRMDIDNVERTN--KIKDGYWDPGPRADPFEDLRYVWGGFSYLQDVIEQGIIRAVTGSKE-KTGIYIQQMPYPCYVDDIFLRVMSRSMPLFMTLAWMYSVAIIIKGVVYEKEARLKETMRIMGLNNGTLWLSWFISSLIPLLISAGLLVMLLKMGNLLPYSDPGVVFLFLGSFGVVTIMQCFLISTLFSRANLAAACGGIIYFTLYLPYVLCVAWQDYVGFGAKVLVSLLSPVAFGFGCEYFALFEEQGVGIQWSNLLASPLEEDSYNLTTSICLMLFDAVLYGIMTWYIESVFPGQYGIPRPWYFPFTKSYWCG-EKENKNMSA---LLSKKGNAEV-CIEEEPGHIEPGVYIENLVKVYSHGNKLAVDGLSLKFYEGQITSFLGHNGAGKTTTMSILTGLFPPTSGTAYILGKDIRSELSTIRQNLGMCPQHNVLFSMLTVEEHIWFYARLKGLSEEKVKAEMEQIVNDVGLPHKRKSRTNTLSGGMQRKLSVALAFVGGSKVVILDEPTAGVDPYARRGIWDLLLKYRQ-GRTIILSTHHMDEADILGDRIAIISHGKLCCVGSSLFLKTHLGTGYYLTMVKRDYDLALQSCRNSASTVSYSKKTEKDSISESSSDAGLGSEPDSETTTIDVSLISNVIFKHVREARLVEDLGHELTYVLPYQSAKDGAFVELFHELDDRLTDLGISSYGISDTTLEEIFLKVAEDSGVDAVELSDGVVPTRTRRRHAFGDHQSCLKPFTEDEFDFNDSEGDPESRETDWLGGADGKGSFQ-------VKGWSLKRQQFVALLWKRFLYARRSRKGFFAQIVLPAVFVCIALVFSLIVPPFGKYPSLALHPSMYGEQF------SFISNDMPDDPHTNKLLGALMEKPG-FGSRCMKGEPIPNTPCTAVED-EWAVPEVSESLRDIFAKGNWTRENP------SPLCQCSCEGRKRMLPECPDGAGGLPP------PQVNTLQNLTGRNVSDYLVKTYAQIIGKSLKNKIWVNEFRYGGF-----SLGARSSQFL--------------SHKDDIDGTAADRFFHSLSSFIQGLDSKNNV-KIWFNNKGWHSISSFLNVMNNGILRASLPAGKDPTKFGITAYNHPLNLTKEQLSQVALMTTSVDVLVSICVIFAMSFVPASFVVFLIQERVNKAKHMQFISGVQPFLYWLANFVWDMCNYIVPATLVIIIFVCFQQDAYVSSTNLPVLALLLLLYGWSITPLMYPASFFFKIPSTAYVVLTSVNILIGINGSVSTFVLELFGSNE--IGGINDILKNVFLIFPHFCLGRGLIDMVKNQAMADALERFGENRFRSPLAWDMVGKNLFAMAVEGVVFFCITVLIQYR----FCITTRSSISHLKP---IGEEDEDVARERQRV-LSGSGQSDILELRELTKIY--------------------KRKQKPAVDRLCVGIPPGECFGLLGVNGAGKTSTFKMLTGDSLVTSGEAYLAGKSVTTEIDEVHQNMGYCPQFDAINDLLTGREHLEFYAILRGVPEKEVCEVAEWGIRKLGLVKYVDKSAGSYSGGNMRKLSTAIALIGGPPVVFLDEPTTGMDPKARRALWNAILSIIKEGR-SVVLTSHSMEECEALCTRMAIMVNGRFRCLGSVQHLKNRFGDGYTIILRV---AGPDPDLRPVMGFIERELPGST-LKEKHRNMLQYQLPSS--LTSLARIFSLLSKNKETLCIEDYSVSQTTLDQVFVNFAKDQS 2200          

HSP 2 Score: 183.726 bits (465), Expect = 1.027e-45
Identity = 162/626 (25.88%), Postives = 287/626 (45.85%), Query Frame = 1
Query: 1465 ILIIAWTPSVTIIIKSIVYEKENRLKEFMLLMGLTNFVHWCSWFISTIVVLIFP---VIFMTLILKYNEIIQFSSPGIIFILILSYVISFICQSFMISVFFDNSNVAAIV-----------GGIVYFIFYL---------------PFLVFINFQDELSTEMYYGVGLLTQV---SFCNAINFIGYLEQASDGAQFSNLFNSTII-DLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENIAIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISH 3243
            I  +++ P+  ++   ++ E+ N+ K    + G+  F++W + F+  +   I P   VI + +  + +  +  ++  ++ +L+L Y  S     +  S FF   + A +V           G +  F+  L                FL+F +F          G GL+  V   +  +A+   G            N F S +  D+   VG  L  + ++ V +  I   ++            + F  T R  I   K     E  D  R+R+  ++  G   + D LE+      L K + + + PA+D L +     +  G LG NGAGKT+T  +LTG    TSG A++    +  +++ +   +G CPQ + +   LT  +H+ FY +L+G+ + E+       ++++GL K +   + + SGG  RKLS A+A +G   ++FLDEPT G+DP +RR +W+ I+      R+++LT+H M+E + LC R+AI+  G+ +C GS   LK  FGDGY + L  +                   ++ FI++ +P S L ++ +      L  + T+      +F  L  + + L I  Y +S T+L++VF+  A D S   H
Sbjct: 1637 IFAMSFVPASFVVF--LIQERVNKAKHMQFISGVQPFLYWLANFVWDMCNYIVPATLVIIIFVCFQQDAYVSSTNLPVLALLLLLYGWSITPLMYPASFFFKIPSTAYVVLTSVNILIGINGSVSTFVLELFGSNEIGGINDILKNVFLIFPHF--------CLGRGLIDMVKNQAMADALERFG-----------ENRFRSPLAWDM---VGKNLFAMAVEGVVFFCITVLIQ------------YRFCITTRSSISHLKPIGE-EDEDVARERQRVLSGSG---QSDILEL----RELTKIYKRKQKPAVDRLCVGIPPGECFGLLGVNGAGKTSTFKMLTGDSLVTSGEAYLAGKSVTTEIDEVHQNMGYCPQFDAINDLLTGREHLEFYAILRGVPEKEVCEVAEWGIRKLGLVKYVDKSAGSYSGGNMRKLSTAIALIGGPPVVFLDEPTTGMDPKARRALWNAILSIIKEGRSVVLTSHSMEECEALCTRMAIMVNGRFRCLGSVQHLKNRFGDGYTIILRVA-----------GPDPDLRPVMGFIERELPGSTLKEKHRNMLQYQLPSSLTS---LARIFSLLSKNKETLCIEDYSVSQTTLDQVFVNFAKDQSDEDH 2204          
BLAST of ATP-binding cassette sub-family A member 1 vs. Planmine SMEST
Match: SMESG000056983.1 (SMESG000056983.1)

HSP 1 Score: 4149.36 bits (10760), Expect = 0.000e+0
Identity = 2080/2086 (99.71%), Postives = 2082/2086 (99.81%), Query Frame = 1
Query:   28 MTFTSVINQISLLLWKNFRLRKRRPFQLTFEXXXXXXXXXXXXXXRQAQLKFRIGRCELREKNMASLGPIPFLRDYLCTFNTTCYNETQIDWKDNKTNDYLTFLNNCTRIYNSYPKRQLTSTEFLQWLILHPEESEMLRYSLIFLNAKIDYVVESIDLINSGNSNNVSRGINKLTTMICGSDKNDAAILIFNLNLLQRSKRSIQTCQEVYEKYLSVDYFHRQLLEMTAPIIFGKIYFTPDSEFTRQIIKKANITFEILDNLRLSAVEWRLNFRDWLSNQVNNSSTLDNMSNNAKVCMETSQNYYTVCQLIYKSSDRNRIQNSIEIASRIFDLIERGLNCTELNKFQPMKSKVDIDNLAQNKLINIFAGVVFNESFQYLTLNNATVLNYQIRMPTNRIDSTKNFKVLDTFWNPIPRRDTIYDLKYYTSGFLFLQEAFDQAFIELVTGNVTINIGTSMQIMPYPCFVDDRFIKFLSMIMPFILIIAWTPSVTIIIKSIVYEKENRLKEFMLLMGLTNFVHWCSWFISTIVVLIFPVIFMTLILKYNEIIQFSSPGIIFILILSYVISFICQSFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQREENIAIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQITSEMLDTLTDGGNLPRPVSVLSFRKKTINTANINDPKVSFEFENNLVLLSGLSLIFQQISGLFIKRFHHTKRNIKGXXXXXXXXXXXXXXXXXXXXXXXXMDNQPSMTISPWLMMPKTRLVNLNTFYRKENTSDQISFKLNENYRSDIGQSGVRCMNTSLYQLENFKCLYPYNTNKWSEKSPIEISLVTPECDCSTTGNQICSSPLSGGPESSNRIMASSDRLYDLSSYNISDYLMKNFKTFIMKQYGGLQFILPSFFGQSCQVIGESQIWFDFRQSINSSRDNNSNPEQVKFLNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFSYLRYNISGGDENYNAFEWDITGNKICSLGILFVGWCLIIVFMESKHKKTLCIKLKDVKLKPYEIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFDSSVKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKNDSVTRNISNGNALIQKPNFNNDGYLNEGFEKTDF 6285
            MTFTSVINQISLLLWKNFRLRKRRPFQLTFEILICLSFILSLIGIRQAQLKFRIGRCELREKNMASLGPIPFLRDYLCTFNTTCYNETQIDWKDNKTNDYLTFLNNCTRIYNSYPKRQLTSTEFLQWLILHPEESEMLRYSLIFLNAKIDYVVESIDLINSGNSNNVSRGINKLTTMICGSDKNDAAILIFNLNLLQRSKRSIQTCQEVYEKYLSVDYFHRQLL MTAPIIFGKIYFTPDSEFTRQIIKKANITFEILDNLRLSAVEWRLNFRDWLSNQVNNSSTLDNMSNNAKVCMETSQNYYTVCQLIYKSSDRNRIQNSIEIASRIFDLIERGLNCTELNKFQPMKSKVDIDNLAQNKLINIFAGVVFNESFQYLTLNNATVLNYQIRMPTNRIDSTKNFKVLDTFWNPIPRRDTIYDLKYYTSGFLFLQEAFDQAFIELVTGNVTINIGTSMQIMPYPCFVDDRFIKFLSMIMPFILIIAWTPSVTIIIKSIVYEKENRLKEFMLLMGLTNFVHWCSWFISTIVVLIFPVIFMTLILKYNEIIQFSSPGIIFILILSYVISFICQSFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDS+FYILIAWYVEAVFPGKYGVPKPWYFLFTR YWIPFSKNNDNIEISDNFRQREENIAIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKTTTISILTGILTPTSGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQITSEMLDTLTDGGNLPRPVSVLSFRKKTINTANINDPKVSFEFENNLVLLSGLSLIFQQISGLFIKRFHHTKRNIKGLFSELILPLLLILLISGLLKIKSSMDNQPSMTISPWLMMPKTRLVNLNTFYRKENTSDQISFKLNENYRSDIGQSGVRCMNTSLYQLENFKCLYPYNTNKWSEKSPIEISLVTPECDCSTTGNQICSSPLSGGPESSNRIMASSDRLYDLSSYNISDYLMKNFKTFIMKQYGGLQFILPSFFGQSCQVIGESQIWFDFRQSINSSRDNNSNPEQVKFLNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFSYLRYNISGGDENYNAFEWDITGNKICSLGILFVGWCLIIVFMESKHKKTLCIKLKDVKLKPYEIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDI INVDLSLKNL LTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFDSSVKLS+IFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKNDSVTRNISNGNALIQKPNFNNDGYLNEGFEKTDF
Sbjct:    1 MTFTSVINQISLLLWKNFRLRKRRPFQLTFEILICLSFILSLIGIRQAQLKFRIGRCELREKNMASLGPIPFLRDYLCTFNTTCYNETQIDWKDNKTNDYLTFLNNCTRIYNSYPKRQLTSTEFLQWLILHPEESEMLRYSLIFLNAKIDYVVESIDLINSGNSNNVSRGINKLTTMICGSDKNDAAILIFNLNLLQRSKRSIQTCQEVYEKYLSVDYFHRQLLGMTAPIIFGKIYFTPDSEFTRQIIKKANITFEILDNLRLSAVEWRLNFRDWLSNQVNNSSTLDNMSNNAKVCMETSQNYYTVCQLIYKSSDRNRIQNSIEIASRIFDLIERGLNCTELNKFQPMKSKVDIDNLAQNKLINIFAGVVFNESFQYLTLNNATVLNYQIRMPTNRIDSTKNFKVLDTFWNPIPRRDTIYDLKYYTSGFLFLQEAFDQAFIELVTGNVTINIGTSMQIMPYPCFVDDRFIKFLSMIMPFILIIAWTPSVTIIIKSIVYEKENRLKEFMLLMGLTNFVHWCSWFISTIVVLIFPVIFMTLILKYNEIIQFSSPGIIFILILSYVISFICQSFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSIFYILIAWYVEAVFPGKYGVPKPWYFLFTRHYWIPFSKNNDNIEISDNFRQREENIAIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKTTTISILTGILTPTSGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQITSEMLDTLTDGGNLPRPVSVLSFRKKTINTANINDPKVSFEFENNLVLLSGLSLIFQQISGLFIKRFHHTKRNIKGLFSELILPLLLILLISGLLKIKSSMDNQPSMTISPWLMMPKTRLVNLNTFYRKENTSDQISFKLNENYRSDIGQSGVRCMNTSLYQLENFKCLYPYNTNKWSEKSPIEISLVTPECDCSTTGNQICSSPLSGGPESSNRIMASSDRLYDLSSYNISDYLMKNFKTFIMKQYGGLQFILPSFFGQSCQVIGESQIWFDFRQSINSSRDNNSNPEQVKFLNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFSYLRYNISGGDENYNAFEWDITGNKICSLGILFVGWCLIIVFMESKHKKTLCIKLKDVKLKPYEIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIQINVDLSLKNLGLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFDSSVKLSNIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKNDSVTRNISNGNALIQKPNFNNDGYLNEGFEKTDF 2086          
BLAST of ATP-binding cassette sub-family A member 1 vs. Planmine SMEST
Match: SMESG000032861.1 (SMESG000032861.1)

HSP 1 Score: 2404.02 bits (6229), Expect = 0.000e+0
Identity = 1218/2042 (59.65%), Postives = 1553/2042 (76.05%), Query Frame = 1
Query:  196 CELREKNMASLGPIPFLRDYLCTFNTTCYNETQIDWKDNKTNDYLTFLNNCTRIYNSYPKRQLTSTEFLQWLILHPEESEMLRYSLIFLNAKIDYVVESIDLINSGNSNNVSRGINKLTTMICGSDKNDAAILIFNLNLLQRSKRSIQTCQEVYEKYLSVDYFHRQLLEMTAPIIFGKIYFTPDSEFTRQIIKKANITFEILDNLRLSAVEWRLNFRDWLSNQVNNSSTLDNMSNNAKVCMETSQNYYTVCQLIYKSSDRNRIQNSIEIASRIFDLIERGLNCTELNKFQPMKSKVDIDNLAQNKLINIFAGVVFNESFQYLTLNNATVLNYQIRMPTNRIDSTKNFKVLDTFWNPIPRRDTIYDLKYYTSGFLFLQEAFDQAFIELV-TGNVTINIGTSMQIMPYPCFVDDRFIKFLSMIMPFILIIAWTPSVTIIIKSIVYEKENRLKEFMLLMGLTNFVHWCSWFISTIVVLIFPVIFMTLILKYNEIIQFSSPGIIFILILSYVISFICQSFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEIS--DNFRQRE--------ENIAIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQITSEMLDTLTDGGNLPRPVSVLSFRKKTINTANINDPKVSFEFENNLVLLSGLSLIFQQISGLFIKRFHHTKRNIKGXXXXXXXXXXXXXXXXXXXXXXXXMDNQPSMTISPWLMMPKTRLVNLNTFYRKENTSDQISFKLNENYRSDIGQSGVRCMNTSLYQLENFKCLYPYNTNKWSEKSPIEISLVTPECDCSTTGNQICSSPLSGGPESSNRIMASSDRLYDLSSYNISDYLMKNFKTFIMKQYGGLQFILPSFFGQSCQVIGESQIWFDFRQSINSSRDNNSNPEQVKFLNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFSYLRYNISGGDENYNAFEWDITGNKICSLGILFVGWCLIIVFMESKH-KKTLCIKLKDVKLKPYEIITD-EDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFDSSVKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKNDSVTRNISNGNALIQKPNFNNDGYLNEGFEKTD 6282
            CELREK MAS+GPIPFLRD+LCT NTTCYN+TQIDW  N TND+ TFLNN T +Y+ + K   T T         P +   L YSL +LN+    ++ ++  I SGN     +G+  +   ICGS +ND  + + +    Q+SKRS+Q+CQ  + + L    +  QL E+ AP+IFGKIY+TPDS FTR++IK+AN TF+ILD+LRLSAVEWRL+F  +  N +NNS  ++N+ N  K+ +  +Q    +C  +  + D   I       S +F +IE  LNCTELNKF PMKS +DIDNLA   L NI+AG+V NESFQYLT NNAT L+YQIRMPTNRID+T  FKV+D+FW P PR  T  D KYYTSGF+ LQEA DQAFIE+V T N +IN+G+SMQIMPYPC+V+D+FIKFLS +MPF+LIIAW PSVTI++K IVYEKENRLKEFM +MGL+N VHW  WFI+TI +L+ P+I MTLIL+Y+ I+ FSSP ++F+++LSYV+SFICQSFMISVFFD +NVAA+ GGI+YFI YLPF VFI   D+++  MYYGVGLLTQV+F N+INFI + EQ++DG QFSNLF+ST+++LN GVGHC++M+W+DSV Y+LIAWYVE+VFPG+YGV KPWYFLFT+ YW    +N+ + +I+  DN+   E        E I   GFE EP +L++GI I+NLVK +P +KT A+D+LNL FYQSQIT FLGHNGAGKTTTISILTGI + TSGTA+IL+ DIR DM+ IR K+GLCPQHNILF+ LTVEDHIYFYGLLKGM   EI+  LP I+++VGL+KK+K  SKNLSGGMKRKLS+AMAF+G+S+++FLDEPTAGVDPF+RRGIWDL++KYR+  RTIILTTHHMDEADYL DRIAIISQGKL+CCGSS+FLK+ FGDGYYL L K+   Q E   +   S SG K+L FI+  I ++K+I+ET+TQWT+VL  N  N  +F+ LF  +D SL  L I SYGLSDTSLEEVFLKVADDP+    + ++KQIT+E LD+LTD GN PRP S LSFR K       +   + +E      LL+G +L+ QQ+ GL +KRFH+TKRNIKG  +EL+LP+LLI+++    KI S+++ QP M ISPWLMMPK R +NLNTFYRKEN+S+ +  KL E YRSD+ ++G RCMN S+Y+L+++ C      N+W+   P  I L+T  CDC+TTG Q+CS+  SGGP++S R+MAS+D+L +L+ YNISD+L+K FK++I KQYGG QF+LPS FGQSC++IG   IW D  +S ++S +++SN +Q+ FLNYFQ FFN SGIKTN +RIWINSKGY S+PAY NIFSNLL+R+   ++ +  NYGI+VANYPLKYTQSDL S +  QMF+EVSLA+FVIFGLSFIPASFVIFLIEER+TGSK QQ VSGVNPYVYW+SNF WD +KY + + I++L F+AF+YQSYIGSKN+ AFI LL  Y LA+IPHMYPFSF +S  STAFVV+ AYNLL+G +TTI+TF+LDL Q DD +LK  ND LKK+FL+FPQY LGRGM+DLSF+YL +NIS G ++Y+ F W  TG K+CSL +LFVGW +++  +ES    + LC K+K+  LK  E+  + ED+DV  ERERI ++  + +DVL+V  LTK+YN S++ +N C  K + +    +KRKLAVNN+ FGV+EGECFGLLGVNGAGKTTTFKML GEE IT GNA ING SII D + AH+NMGFCPQFDALH+LLTCEE+L FY RIRGI+ + I   VD SL+NLSLTPH  K T  +SGGNKRK+ TAIALIG PK++FLDEPT GMDAGARRFLW +IQ +TNE+K+AVILTSHNMEECE LCHRL+IMV+GEMK +GSVQHLKSKFG DYYV IR+   ++  +D  +++ II  +  S     + + V ++YRF SS KL+ IF  FE+L+ + ++ +YSVSQ +LD+VFINFA++D   +      +L+ +   ++ G  NEGF+ ++
Sbjct:    4 CELREKQMASMGPIPFLRDFLCTLNTTCYNKTQIDWSGNNTNDFQTFLNNMTYLYDVFNKPFPTPT---------PNDITQLTYSLNYLNSSTYPLLVAMMQIQSGNKTESDKGMKTIEASICGSSENDMNLFVNSFVTNQKSKRSLQSCQNQFLQTLGSSSYGSQLYEVIAPLIFGKIYYTPDSPFTRELIKRANSTFKILDDLRLSAVEWRLHFSSYFVNYMNNSQPINNLRNFCKLNIPGTQQ---MCSTVNTTLDMENILAYNAAISAVFAIIENSLNCTELNKFVPMKSSIDIDNLANQSLTNIYAGLVINESFQYLTRNNATFLSYQIRMPTNRIDTTLKFKVIDSFWTPAPRISTFSDFKYYTSGFMLLQEALDQAFIEIVSTNNESINVGSSMQIMPYPCYVNDKFIKFLSSMMPFLLIIAWMPSVTILLKGIVYEKENRLKEFMQVMGLSNLVHWIGWFITTISILMLPIIIMTLILRYSTILGFSSPAVVFLILLSYVVSFICQSFMISVFFDKANVAAVAGGIIYFISYLPFYVFITIPDDVTDSMYYGVGLLTQVAFSNSINFIAFWEQSTDGVQFSNLFDSTVVNLNVGVGHCMVMMWVDSVIYLLIAWYVESVFPGQYGVGKPWYFLFTQHYW---CQNSASYKITPIDNYYPYESSPIPNINEGILKHGFESEPTNLKVGISIKNLVKTYPGAKTRAVDDLNLNFYQSQITAFLGHNGAGKTTTISILTGIFSATSGTAYILNEDIRSDMDKIREKMGLCPQHNILFSNLTVEDHIYFYGLLKGMKTEEIREILPKIIEDVGLTKKMKSFSKNLSGGMKRKLSVAMAFIGDSKVVFLDEPTAGVDPFARRGIWDLLIKYRNDERTIILTTHHMDEADYLSDRIAIISQGKLQCCGSSVFLKKEFGDGYYLILVKNSRSQEEDFRSG-ISSSGEKVLNFIRAHITDAKMIEETRTQWTIVLPQNEINSGKFSDLFADIDRSLSGLNIVSYGLSDTSLEEVFLKVADDPAGTVEEIKDKQITAEDLDSLTDDGNFPRPSSRLSFRCKREFPRFDDLNSIPYESGAPSSLLTGSALLRQQLLGLQVKRFHYTKRNIKGFVAELVLPILLIVVMIAFSKISSNLNYQPPMEISPWLMMPKARSLNLNTFYRKENSSNTLIDKLVEGYRSDLSEAGTRCMNQSVYRLDSYPCSSSIG-NQWTGNPPEPIPLLTAACDCNTTGFQLCSNSSSGGPQNSYRLMASTDKLNNLTGYNISDHLIKKFKSYIKKQYGGFQFLLPSPFGQSCKLIGSLPIW-DAMRSQSNSSNSSSNSDQLPFLNYFQEFFNLSGIKTNFTRIWINSKGYASLPAYGNIFSNLLMRTRFESNGS--NYGISVANYPLKYTQSDLLSKLNTQMFVEVSLAVFVIFGLSFIPASFVIFLIEERITGSKRQQIVSGVNPYVYWMSNFLWDILKYIVPIFIIVLIFVAFDYQSYIGSKNLGAFITLLIFYGLAIIPHMYPFSFLLSTPSTAFVVLDAYNLLLGSITTISTFFLDLLQQDDETLKPVNDVLKKVFLLFPQYGLGRGMMDLSFNYLTFNISNGKQDYDPFGWSTTGEKLCSLSVLFVGWWIVVFIIESGIINRMLCGKIKNRNLKAKEMKDEFEDVDVAVERERI-ISEKISDDVLKVIKLTKVYNQSLNVKNTCCKKVVKDTLENEKRKLAVNNLCFGVQEGECFGLLGVNGAGKTTTFKMLTGEEEITHGNAFINGQSIISDMIGAHRNMGFCPQFDALHALLTCEEQLTFYCRIRGIKSNQIKSVVDRSLRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVTIRMPFGKDHENDNEKVKAIIEDKFPSEVSFVDGSFVTLQYRFASSTKLAVIFDFFENLKKDSIILDYSVSQTTLDDVFINFARDDKPVK------SLVLQNLSDDGGAFNEGFDNSE 2018          
BLAST of ATP-binding cassette sub-family A member 1 vs. Planmine SMEST
Match: SMESG000032891.1 (SMESG000032891.1)

HSP 1 Score: 2394.77 bits (6205), Expect = 0.000e+0
Identity = 1214/2033 (59.71%), Postives = 1546/2033 (76.05%), Query Frame = 1
Query:  217 MASLGPIPFLRDYLCTFNTTCYNETQIDWKDNKTNDYLTFLNNCTRIYNSYPKRQLTSTEFLQWLILHPEESEMLRYSLIFLNAKIDYVVESIDLINSGNSNNVSRGINKLTTMICGSDKNDAAILIFNLNLLQRSKRSIQTCQEVYEKYLSVDYFHRQLLEMTAPIIFGKIYFTPDSEFTRQIIKKANITFEILDNLRLSAVEWRLNFRDWLSNQVNNSSTLDNMSNNAKVCMETSQNYYTVCQLIYKSSDRNRIQNSIEIASRIFDLIERGLNCTELNKFQPMKSKVDIDNLAQNKLINIFAGVVFNESFQYLTLNNATVLNYQIRMPTNRIDSTKNFKVLDTFWNPIPRRDTIYDLKYYTSGFLFLQEAFDQAFIELV-TGNVTINIGTSMQIMPYPCFVDDRFIKFLSMIMPFILIIAWTPSVTIIIKSIVYEKENRLKEFMLLMGLTNFVHWCSWFISTIVVLIFPVIFMTLILKYNEIIQFSSPGIIFILILSYVISFICQSFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQRE--------ENIAIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQITSEMLDTLTDGGNLPRPVSVLSFRKKTINTANINDPKVSFEFENNLVLLSGLSLIFQQISGLFIKRFHHTKRNIKGXXXXXXXXXXXXXXXXXXXXXXXXMDNQPSMTISPWLMMPKTRLVNLNTFYRKENTSDQISFKLNENYRSDIGQSGVRCMNTSLYQLENFKCLYPYNTNKWSEKSPIEISLVTPECDCSTTGNQICSSPLSGGPESSNRIMASSDRLYDLSSYNISDYLMKNFKTFIMKQYGGLQFILPSFFGQSCQVIGESQIWFDFRQSINSSRDNNSNPEQVKFLNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFSYLRYNISGGDENYNAFEWDITGNKICSLGILFVGWCLIIVFMESKH-KKTLCIKLKDVKLKPYEIITD-EDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFDSSVKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKNDSVTRNISNGNALIQKPNFNNDGYLNEGFEKTD 6282
            MAS+GPIPFLRD+LCT NTTCYN+TQIDW  N TND+ TFLNN T +Y+ + K   T T         P +   L YSL +LN+    ++ ++  I SGN     +G+  +   ICGS +ND  + + +    Q+SKRS+Q+CQ  + + L    +  Q+ ++ AP+IFGKIY+TPDS FTR++IK+AN TF+ILD+LRLSAVEWRL+F  +  N +NNS  ++N+ N  K+ +  +Q    +C  +  + D   I       S +F +IE  LNCTELNKF PMKS +DIDNLA   L NI+AG+V NESFQYLT NNAT L+YQIRMPTNRID+T  FKVLD++W P PR +T+ D KYYTSGF+ LQEA DQAFIE+V T N +I +G+SMQIMPYPC+V+D F KFLS +MPF+LIIAW PSVTI++K IVYEKENRLKEFM +MGL+N VHW  WFI+TI +L+ P+I MTLIL+Y +I+ FSSP +IF+++LSYV+SFICQSFMISV FD +NVA++ GGI+YFI YLPF VF+N  D+++  MYYGVGLLTQV+FCN+INFI + EQ++DG QFSNLF+ST+++LN GVGHC++M+W+DSV Y+LIAWYVE+VFPG+YGV KPWYFLFTR YW   S + D I + DN    E        E I   GFE EP +L++GI I+NLVK +P +KT A+D+LNL FYQSQIT FLGHNGAGKTTTISILTGI +P+SGTA+IL+ D+R DM+ IR K+GLCPQHNILF+ LTVEDHIYFYGLLKGM   EI+  LP I+++VGL+KK+K  SKNLSGGMKRKLSIAMAF+G+S+++FLDEPTAGVDPF+RRGIW+L++KYR+  RTIILTTHHMDEADYL DRIAIISQGKL+CCGSS+FLK+ FGDGYYL L K+   Q E   +   S SG K+L FI+  I ++K+I+ET+TQWT+VLS N  N  +F+ LF  +D SL  L I SYGLSDTSLEEVFLKVADDP+    + ++KQIT+E LD+LTD GN PRP S LSFR K       +   + +E      LL+G +L+ QQ+ GL +KRFH+TKRNIKG  +EL+LP+LLI+++    KI S+++ QP M ISPWLMMPK R +NLNTFYRKEN+S+ +  KL E YRSD+ ++G RCMN S+Y+L+++ C      N+W+   P  I L+T  CDC  TG Q+CS+  SGGP++S R+MAS+D+L +L+ YNISD+L+K FK++I KQYGG QF+LPS FGQSC++IG   IW D  +S ++S +++SN +Q+ FLNYFQ FFN SGIKTN +RIWINSKGY S+PAY NIFSNLLLR+   ++ +  NYGI+VANYPLKYTQSDL S +  QMF+EVSLA+FVIFGLSFIPASFVIFLIEER+TGSK QQ VSGVNPYVYW+SNF WD +KY + + I++L F+AF+YQSYIGSKN+ AFI LL  Y LA+IPHMYPFSF +S  STAFVV+ AYNLLVG +TTI+TF+LDL Q DD +LK  ND LKK+FL+FPQY LGRGM+DLSF+YL +NIS G ++Y+ F W  TG K+CSL +LFVGW ++++ +ES    +TLC K+K+  LK  EI  + ED+DV  ERERI ++  + +DVL+V  LTK+YN S++ +N C  K + +    +KRKLAVNN+ FGV+EGECFGLLGVNGAGKTTTFKML GEE IT GNA ING SII D + AH+NMGFCPQFDALH+LLTCEE+L FY RIRGI+ + I   VD SL+NLSLTPH  K T  +SGGNKRK+ TAIALIG PK++FLDEPT GMDAGARRFLW +IQ +TNE+K+AVILTSHNMEECE LCHRL+IMV+GEMK +GSVQHLKSKFG DYYV IR+   ++  +D  +++ II  +  S     + + V ++YRF SS KL+ IF  FE+L+ + ++ +YSVSQ +LD+VFINFA++D   +      +LI +   ++ G  NEGF+ ++
Sbjct:    1 MASMGPIPFLRDFLCTLNTTCYNKTQIDWSGNNTNDFQTFLNNMTYLYDVFNKPFPTPT---------PNDIIQLTYSLNYLNSSTYPLLVAMMQIQSGNKTESDKGMKTIEASICGSSENDMNLFVKSFVNNQKSKRSLQSCQNQFIQTLGSSSYGSQMYQVLAPLIFGKIYYTPDSPFTRELIKRANSTFKILDDLRLSAVEWRLHFSSYFVNYMNNSQPINNLRNFCKLNIPGTQQ---MCIYLNATLDMENILAYNAAISAVFAIIENSLNCTELNKFVPMKSSIDIDNLANQSLTNIYAGLVINESFQYLTRNNATFLSYQIRMPTNRIDTTLKFKVLDSYWTPAPRINTLTDFKYYTSGFMLLQEALDQAFIEIVSTNNESITVGSSMQIMPYPCYVNDNFNKFLSGMMPFLLIIAWMPSVTILLKGIVYEKENRLKEFMQVMGLSNLVHWIGWFITTISILMLPIIIMTLILRYGKILAFSSPAVIFLILLSYVVSFICQSFMISVLFDKANVASVAGGIIYFISYLPFYVFLNLPDDVTDSMYYGVGLLTQVAFCNSINFIAFWEQSTDGVQFSNLFDSTVVNLNVGVGHCMVMMWVDSVIYLLIAWYVESVFPGQYGVGKPWYFLFTRHYWCQNSAS-DKITLIDNHYSYESLPIPNINEGILKHGFESEPTNLKVGISIKNLVKTYPGAKTRAVDDLNLNFYQSQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDLRSDMDKIREKMGLCPQHNILFSNLTVEDHIYFYGLLKGMKTEEIREILPKIIEDVGLTKKMKSFSKNLSGGMKRKLSIAMAFIGDSKVVFLDEPTAGVDPFARRGIWNLLIKYRNDERTIILTTHHMDEADYLSDRIAIISQGKLQCCGSSVFLKKEFGDGYYLILVKNSRSQEEDFRSG-ISSSGEKVLNFIRAHITDAKMIEETRTQWTIVLSQNEINNGKFSDLFADIDRSLSGLNIVSYGLSDTSLEEVFLKVADDPAGTVEEIKDKQITTEDLDSLTDDGNFPRPSSRLSFRDKREFPRFDDLNSIPYESGAPSSLLTGSALLCQQLLGLQVKRFHYTKRNIKGFVAELVLPILLIVIMIAFSKISSNLNYQPPMEISPWLMMPKARSLNLNTFYRKENSSNTLIDKLVEGYRSDLSEAGTRCMNQSVYRLDSYPC-SSRTGNQWTGNPPEPIPLLTAACDCKKTGYQMCSNSSSGGPQNSYRLMASTDKLNNLTGYNISDHLIKKFKSYIKKQYGGYQFLLPSPFGQSCKLIGSLPIW-DAIRSQSNSSNSSSNSDQLPFLNYFQEFFNLSGIKTNFTRIWINSKGYASLPAYGNIFSNLLLRTRFESNGS--NYGISVANYPLKYTQSDLLSKLNTQMFIEVSLAVFVIFGLSFIPASFVIFLIEERITGSKRQQIVSGVNPYVYWMSNFLWDILKYIVPIFIIVLIFVAFDYQSYIGSKNLGAFITLLIFYGLAIIPHMYPFSFLLSTPSTAFVVLDAYNLLVGSITTISTFFLDLLQKDDETLKPVNDVLKKVFLLFPQYGLGRGMMDLSFNYLTFNISNGKQDYDPFGWSTTGEKLCSLSVLFVGWWIVVLIIESGIINRTLCGKIKNRNLKAKEIKDEFEDVDVAVERERI-ISEKISDDVLKVIKLTKVYNQSLNVKNTCCKKVVKDALENEKRKLAVNNLCFGVREGECFGLLGVNGAGKTTTFKMLTGEEEITRGNAFINGQSIISDMIGAHRNMGFCPQFDALHALLTCEEQLTFYCRIRGIESNQIKSVVDTSLRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVTIRMPFGKDHANDNGKVKAIIEDKFPSEVSFVDGSFVTLQYRFASSTKLAVIFDFFENLKKDSIILDYSVSQTTLDDVFINFARDDKPVK------SLILQNLSDDGGAFNEGFDNSE 2008          
BLAST of ATP-binding cassette sub-family A member 1 vs. Planmine SMEST
Match: SMESG000068605.1 (SMESG000068605.1)

HSP 1 Score: 2375.9 bits (6156), Expect = 0.000e+0
Identity = 1221/2045 (59.71%), Postives = 1545/2045 (75.55%), Query Frame = 1
Query:  163 RQAQLKFRIGRCELREKNMASLGPIPFLRDYLCTFNTTCYNETQIDWKDNKTNDYLTFLNNCTRIYNSYPKRQLTSTEFLQWLILHPEESEMLRYSLIFLNAKIDYVVESIDLINSGNSNNVSRGINKLTTMICGSDKNDAAILIFNLNL-LQRSKRSIQTCQEVYEKYLSVDYFHRQLLEMTAPIIFGKIYFTPDSEFTRQIIKKANITFEILDNLRLSAVEWRLNFRDWLSNQVNNSSTLDNMSNNAKVCMETSQNYYTVCQLIYKSSDRNRIQNSIEIASRIFDLIERGLNCTELNKFQPMKSKVDIDNLAQNKLINIFAGVVFNESFQYLTLNNATVLNYQIRMPTNRIDSTKNFKVLDTFWNPIPRRDTIYDLKYYTSGFLFLQEAFDQAFIELVTGNVTINIGTSMQIMPYPCFVDDRFIKFLSMIMPFILIIAWTPSVTIIIKSIVYEKENRLKEFMLLMGLTNFVHWCSWFISTIVVLIFPVIFMTLILKYNEIIQFSSPGIIFILILSYVISFICQSFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYW--IPFSKNNDNIE-ISDNFRQREENIAID--GFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQITSEMLDTLTDGGNLPRPVSVLSFRKKTINTANIND-PKVSFEFENNLVLLSGLSLIFQQISGLFIKRFHHTKRNIKGXXXXXXXXXXXXXXXXXXXXXXXXMDNQPSMTISPWLMMPKTRLVNLNTFYRKENTSDQISFKLNENYRSDIGQSGVRCMNTSLYQLENFKCLYPYNTNKWSEKSPIEISLVTPECDCSTTGNQICSSPLSGGPESSNRIMASSDRLYDLSSYNISDYLMKNFKTFIMKQYGGLQFILPSFFGQSCQVIGESQIWFDFRQSINSSRDNNSNPEQVKFLNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFSYLRYNISGGDENYNAFEWDITGNKICSLGILFVGWCLIIVFMESK-HKKTLCIKLKDVKLKPYEIITDEDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKTIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFDSSVKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKNDSVTRNISNGNALIQKPNFNNDGYLNEGFE 6273
            R+    + +G CELREK M S+GPIPFLRD++CTFNT+CYN TQIDW  N  ND+LTF+NN + +Y+S      T   F+ W  ++P     L  S+ +++  I   + SI  + +G+   +++ +  L  ++CGSD+ND  + + N NL L  S +SI TCQ  +  Y +       L  +  P++FGKIY+TP+S FT++II++AN TF ILDNLRL++VEWRL F +WL   +NNS+ +  +++    C  +      +CQ+I  S     IQ++I   S +F LIE  LNCT+LNKF PM S +DIDNL+    + I AG+VF + FQYLT  NAT LNY+IRMP +RIDSTKNFKVLD  W PIPR +T+ +  YYTSGFLFLQE  DQAFIEL+T N ++NIG+SMQIMPYPC+++DR I FLS +MPF+L+IAW P+VT +IKSIVYEKENRLKEFM +MG++NFVHW SWF STI++LI P+I MT+ILK  +I+ FSSP IIF+++  YV+SFICQ FMISVFFD ++VA++ GGI+YF+FYLPFL+F+N QD ++  MYY   LLTQVS  N+INFI Y EQ++DG QFSNLF+S I+DLNFGVGHC++M+WIDSV Y+LIAWYVE VFPG++G+ KPW F FTR YW  I    N D  E  S++  +   N +++  GFE EP  L++GI I+NL K FPKSK PA++NLNL FYQSQIT FLGHNGAGKTTTISILTG+  P+SGTAFIL++DIR +M+ IR K+GLCPQHNILF  LTVEDHIYFYGLLK M K+ IK+ +P I++EVGL+KK+  ++KNLSGGMKRKLS+A+AFVG+SR++FLDEPTAGVDPF+RRGIWDL+VKYR  +R IILTTHHMDEADYL DRIAIISQGKL+CCGSS+FLK+ FG+GYYL + K+  IQ E    N+ S SG   L+FI+  +P++K+++ET++QWT+ L  +  N ++F  LF+ LD +++ L I +YGLSDTSLEEVFLKVADDPS      +EK++T E LD LTDGGN PRP S+LS R K+   A I +  +VSF+ E    +L+G+SL  QQI GL IKRFH+T+RN+K   +EL+LP+L+IL+I GLL I S + + P M ISPWLMMPKTRLVNLNTFYRKE+ S+ I   +   YRSD+G+SGVRCMN+++Y+L N+ C    N N+WS      ISL +PECDCS TG Q CS PLSGGP  S+RIM SSD+L +++ YNISDYL+K FKTFI KQYGG QF+LPS FG S   IG S IW      INSS +N++    + FLNY Q FFN SGIKTN +RIW+NSKG++SMPAY NIFSN+LLRS +N+   +  YGI+V NYPLK++Q+DL S +  QMFLEVSLAIFVIFGLSFIPASFVIFLIEER++G+K QQ+VSGVNPY+YWISNF WD +KY I V IV++ F+ FNYQSYIG++N  AFIVLL  Y LA+IPHMYPFSF +S  STAFV++ AYNLLVG +TTI TF+LDL Q DD SLK AND LKKIFLIFPQYDLGRGM+DLSF+YL+YNISGG   Y+ F W+ TG K+CSL ILF+ W  +I  +ES    +++C ++K+ KLK  E+  +ED DVF ERER+    + + DVL+V  LTKIYNPS++  NKC  +A+ +  S +KRKLAVNNI FGVKEGECFGLLGVNGAGKTTTFKML GEE IT G+A IN +SI+++ + AHKNMGFCPQFDALHSLLTCEE+LYFY RIRGI    I   V+LSLKNLSL PH  K T  +SGGNKRK+ TAIA+IG+PKIVFLDEPT GMDAGARRFLW +IQT+T E+K AVILTSHNMEECEVLCHRL+IMV+GEMK +G+VQHLKSKFG DY+VKIR++   N   + ++I+ I+  +      +K+EN + ++YRF+ S+KLS IF  FE+L+ N ++ +YSVSQ SLDEVFINFAKN S + N +  +     P F  DG +NE +E
Sbjct:   15 RRITSSYSMGTCELREKQMGSMGPIPFLRDFICTFNTSCYNTTQIDWTKNSINDFLTFMNNISSLYSSLYTTNFTVPGFVDWSNVNPNLYTQLLNSINYISPVISSFITSIKEMQTGDQTLINKNLKILGQLLCGSDQNDIDVFLQNFNLSLINSTKSIPTCQLAFMNYFTKSNGLSVLYPIIGPLVFGKIYYTPNSAFTQEIIRRANSTFRILDNLRLASVEWRLTFSNWL---INNSTNMGLLNDARNYCANSRT---LMCQIINNSLSIETIQSTIASLSAMFVLIENSLNCTQLNKFTPMPSSIDIDNLSNQSSLGILAGIVFTDDFQYLTPQNATFLNYRIRMPASRIDSTKNFKVLDRLWTPIPRVNTLTNFNYYTSGFLFLQEIIDQAFIELITDNASVNIGSSMQIMPYPCYLNDRLISFLSNLMPFLLVIAWAPAVTNLIKSIVYEKENRLKEFMRVMGMSNFVHWVSWFTSTILILILPIILMTIILKLGKILTFSSPIIIFLILFFYVVSFICQCFMISVFFDKASVASVSGGILYFVFYLPFLIFVNLQDSMTVPMYYAAALLTQVSLSNSINFIAYWEQSTDGIQFSNLFDSAIMDLNFGVGHCMVMMWIDSVIYLLIAWYVETVFPGQFGLSKPWNFPFTRNYWNSICGKSNLDETESFSNSLNEPIPNESLNERGFEHEPAHLKMGISIQNLFKIFPKSKIPAVNNLNLNFYQSQITAFLGHNGAGKTTTISILTGLFAPSSGTAFILNDDIRTNMDRIRQKMGLCPQHNILFEDLTVEDHIYFYGLLKRMDKNMIKNIIPKIIEEVGLTKKISSLTKNLSGGMKRKLSVALAFVGDSRVVFLDEPTAGVDPFARRGIWDLLVKYRCEDRAIILTTHHMDEADYLSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLIIVKTESIQWED-FQNELSISGGIALKFIQNHVPDAKMMEETRSQWTIALPQSENNCSKFPDLFDNLDRAMEDLGIVTYGLSDTSLEEVFLKVADDPSGEVGGIKEKKLTPEKLDALTDGGNFPRPASILSLRDKS-EFAKIEEIRRVSFKSEITYSMLTGISLFIQQIIGLQIKRFHYTRRNMKSFIAELVLPVLMILMIIGLLNISSPLSDAPPMVISPWLMMPKTRLVNLNTFYRKESPSNAIIDSMENVYRSDVGESGVRCMNSAVYRLGNYSCYPENNVNQWSAIPSAPISLSSPECDCSKTGFQFCSDPLSGGPTISSRIMTSSDQLGNITGYNISDYLLKKFKTFIKKQYGGYQFLLPSNFGLSSNSIGSSPIWDGISSYINSSPNNSN---SLGFLNYSQRFFNQSGIKTNYTRIWVNSKGFVSMPAYENIFSNILLRSKLNSFSDISKYGISVTNYPLKFSQTDLQSQLNTQMFLEVSLAIFVIFGLSFIPASFVIFLIEERISGAKRQQFVSGVNPYLYWISNFMWDLVKYIIPVAIVLVIFVLFNYQSYIGTQNAGAFIVLLLFYGLAIIPHMYPFSFVLSNPSTAFVILDAYNLLVGAITTIATFFLDLLQVDDPSLKPANDVLKKIFLIFPQYDLGRGMMDLSFNYLQYNISGGKVTYDPFGWETTGQKLCSLIILFIAWWSVIFTIESGIINRSICGRIKNYKLKERELQHEEDTDVFLERERMTKRKENV-DVLKVINLTKIYNPSLNINNKCCKRAVADSLSSEKRKLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKIRMNFIEN---ESDKIKAIMKTQFPQGVSLKDENFITLQYRFNCSLKLSTIFHFFENLKANGVIADYSVSQTSLDEVFINFAKNKS-SNNENEESIRNSVPLF--DGQVNECYE 2041          
BLAST of ATP-binding cassette sub-family A member 1 vs. Planmine SMEST
Match: SMESG000032896.1 (SMESG000032896.1)

HSP 1 Score: 2273.05 bits (5889), Expect = 0.000e+0
Identity = 1173/2036 (57.61%), Postives = 1498/2036 (73.58%), Query Frame = 1
Query:  217 MASLGPIPFLRDYLCTFNTTCYNETQIDWKDNKTNDYLTFLNNCTRIYNSYPKRQLTSTEFLQWLILHPEESEMLRYSLIFLNAKIDYVVESIDLINSGNSNNVSRGINKLTTMICGSDKNDAAILIFNLNLLQRSKRSIQTCQEVYEKYLSVDYFHRQLLEMTAPIIFGKIYFTPDSEFTRQIIKKANITFEILDNLRLSAVEWRLNFRDWLSNQVNNSSTLDNMSNNAKVCMETSQNYYTVCQLIYKSSDRNRIQNSIEIASRIFDLIERGLNCTELNKFQPMKSKVDIDNLAQNKLINIFAGVVFNESFQYLTLNNATVLNYQIRMPTNRIDSTKNFKVLDTFWNPIPRRDTIYDLKYYTSGFLFLQEAFDQAFIELV-TGNVTINIGTSMQIMPYPCFVDDRFIKFLSMIMPFILIIAWTPSVTIIIKSIVYEKENRLKEFMLLMGLTNFVHWCSWFISTIVVLIFPVIFMTLILKYNEIIQFSSPGIIFILILSYVISFICQSFMISVFFDNSNVAAIVGGIVYFIFYLPFLVFINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNSTIIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRRYWIPFSKNNDNIEISDNFRQRE--------ENIAIDGFEKEPDDLEIGILIENLVKKFPKSKTPALDNLNLKFYQSQITGFLGHNGAGKXXXXXXXXXXXXXXXGTAFILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEIKHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEPTAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGKLKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIKKIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYGLSDTSLEEVFLKVADDPSQISHKRQEKQITSEMLDTLTDGGNLPRPVSVLSFRKKTINTANIND-PKVSFEFENNLVLLSGLSLIFQQISGLFIKRFHHTKRNIKGXXXXXXXXXXXXXXXXXXXXXXXXMDNQPSMTISPWLMMPKTRLVNLNTFYRKENTSDQISFKLNENYRSDIGQSGVRCMNTSLYQLENFKCLYPYNTNKWSEKSPIEISLVTPECDCSTTGNQICSSPLSGGPESSNRIMASSDRLYDLSSYNISDYLMKNFKTFIMKQYGGLQFILPSFFGQSCQVIGESQIWFDFRQSINSSRDNNSNPEQVKFLNYFQLFFNSSGIKTNLSRIWINSKGYISMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQMFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWISNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVIPHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKSANDALKKIFLIFPQYDLGRGMIDLSFSYLRYNISGGDENYNAFEWDITGNKICSLGILFVGWCLIIVFMESK-HKKTLCIKLKDVKLKPYEIITD-EDLDVFKERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKRKLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGYSIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINVDLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGMDAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMK--TIGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIINKEIWSSARMKEENAVIIEYRFDSSVKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFAKNDSVTRNISNGNALIQKPNFNNDGYLNEGFEKTD 6282
            MAS+GPIPFLRD+LCT NTTCYN+TQIDW  N TND+ TFLNN T +Y    K   T T         P +   L YSL +LN+    ++ ++  I SGN     +G+  +   ICGS +ND  + + +    Q+SKRS+Q+CQ  + + L    +  Q+ ++ AP+IFGKIY+TPDS FTR++IK+AN TF+ILD+LRLSAVEWRL+F  +  N +NNS  ++N+ N  K+ +  +Q    +C  +    D   I       S +F +IE  LNCTELNKF PMKS +DIDNLA   L NI+AG+V NESFQYLT NNAT L+YQIRMPTNRID+T  FKVLD++W P PR +T+ D KYYTSGF+ LQEA DQAFIE+V T N +IN+G+SMQIMPYPC+V+D+FIKFLS +MPF+LIIAW PSVT ++K IVYEKENRLKEFM +MGL+N VHW  WFI+TI +L+ P+I MTLIL Y+ I+ FSSP ++F+++LSYV+SFICQSFMISVFFD +NVAA+ GGI+Y I YLPF VFI   D+++  MYYGVGLLTQV+FCN+INFI + EQ++DG QFSNLF+ST+++LN GVGHC++M+W+DSV Y+LIAWYVE+VFPG+YGV KPWYFLFTR YW   S  +D I + DN    E        E I   GFE EP +L++GI I+NLVK +P +KT A+DNLNL FYQSQIT FLGHNG GKTTTISILTGI + TSGTA+IL+ DIR DM+ IR K+GLCPQHNILF+ LTVEDHIYFYGLLKGM   EI+  LP I+++VGL+KK+K  SKNLSGGMKRKLS+AMAF+G+S+++FLDEPTAGVDPF+RRGIWDL++KYR+  RTIILTTHHMDEADYL DRIAIISQGKL+CCGSS+FLK+ FGDGYYL L K+   Q E   +   S SG K+L FI+  I ++K+I+ET+TQWT+VL  N  N  +F+ LF  +D SL  L   SYGLSDTSLEEVFLKVADDP+    + ++KQIT+E LD+LTD GN PRP S LSFR K +     +D   + +E      LL+G +L+ QQ+ GL +KRFH+TKRNIKG  +EL+LP+LLI+++    KI S+++ QP M ISPWLMMPK R +NLNTFYRKEN+S+ +  KL E YRSD+ ++G RCMN S+Y+L+++ C      N+W    P  I L+T  CDC   G Q+CS+  SGGP+SS R+MAS+D+L +L+ YNISD+L+K FK++I KQYGG QF+LPS FGQSC++IG   IW D  +S ++S +++SN +Q+ FLNYFQ FFN SGIKTN +RIWINSKGY S+PAY NIFSNLLLR+   ++ +  NYGI+VANYPLKYTQSDL                 +I GLSFIPASFVIFL EER+TGSK QQ VSGVNPYVYW+SNF WD +KY + + I++L F+AF+YQSYIGSKN+ AFI LL  Y LA+IPHMYPFSF +S  STAFV ++AYNL +G +TTI+TF LDL Q DD +LK  ND LKK+FL+FPQY LGRGM+DLSF+YL++NIS G ++Y+ F W  TG K+CSL +LFVGW +++  +ES    +TLC K+K+  LK  E+  + ED+DV  ERERI ++  + +DVL+V  LTK+YN S++ +N C    + +    +KR+LAVNN+ FGV+EGECFGLLGVNGAGKTTTFKML GEE IT GNA ING SII D + AH+NMGFCPQFDALH+LLTCEE+L FY RIRGI+ + I   VD SL+NLSLTPH  K T  +SGGNKRK+ TAIALIG PK++FLDEPT GMDAGARRFLW +IQ +TNE+K+A +                    +GE +   +GSVQHLKSKFG DYYV IR+   ++  +D  +++ II  +  S       + V ++YRF SS KL+ IF  FE+L+ + ++  YSVSQ +L++VFINFA++D   +      +LI +   ++ G  NEGF+ ++
Sbjct:    1 MASMGPIPFLRDFLCTLNTTCYNKTQIDWSGNNTNDFQTFLNNMTYLYGVLNKPFPTPT---------PNDITQLTYSLNYLNSSTYPLLVAMMQIQSGNKTESDKGMKTIEASICGSSENDMNLFVNSFVTNQKSKRSLQSCQNQFLQTLGSSSYGSQMYQVLAPLIFGKIYYTPDSPFTRELIKRANSTFKILDDLRLSAVEWRLHFSSYFVNYMNNSQPINNLRNFCKLNIPGTQQ---MCSTVNAILDMENILAYNAAISAVFAIIENSLNCTELNKFVPMKSSIDIDNLANQSLTNIYAGLVINESFQYLTRNNATFLSYQIRMPTNRIDTTLKFKVLDSYWTPAPRINTLTDFKYYTSGFMLLQEALDQAFIEIVSTNNESINVGSSMQIMPYPCYVNDKFIKFLSSMMPFLLIIAWMPSVTNLLKGIVYEKENRLKEFMQVMGLSNLVHWIGWFITTISILMLPIIIMTLILHYSTILDFSSPAVVFLILLSYVVSFICQSFMISVFFDKANVAAVAGGIIYSILYLPFYVFITIPDDVTDSMYYGVGLLTQVAFCNSINFIAFWEQSTDGVQFSNLFDSTVVNLNVGVGHCMVMMWVDSVIYLLIAWYVESVFPGQYGVGKPWYFLFTRHYWCQNSA-SDKITLIDNHYSYESLPIPNINEGILKHGFESEPTNLKVGISIKNLVKTYPGAKTRAVDNLNLNFYQSQITAFLGHNGDGKTTTISILTGIFSATSGTAYILNEDIRSDMDKIREKMGLCPQHNILFSNLTVEDHIYFYGLLKGMKTEEIREILPKIIEDVGLTKKMKSFSKNLSGGMKRKLSVAMAFIGDSKVVFLDEPTAGVDPFARRGIWDLLIKYRNDERTIILTTHHMDEADYLSDRIAIISQGKLQCCGSSVFLKKEFGDGYYLILVKNSRSQEEDFRSG-ISSSGEKVLNFIRAHITDAKMIEETRTQWTIVLPQNEINIGKFSDLFADIDRSLSGLNFVSYGLSDTSLEEVFLKVADDPAGSVQEIKDKQITAEDLDSLTDDGNFPRPSSRLSFRDK-LEFPRFDDLNSIPYESGAPSSLLTGSALLRQQLLGLQVKRFHYTKRNIKGFVAELVLPILLIVVMIAFSKISSNLNYQPPMEISPWLMMPKARSLNLNTFYRKENSSNTLIDKLVEGYRSDLSEAGTRCMNQSVYRLDSYLC-SSSTGNQWIGNPPEPIPLLTAACDCKKIGYQMCSNSSSGGPQSSYRLMASNDKLNNLTGYNISDHLIKKFKSYIKKQYGGFQFLLPSPFGQSCKLIGSLPIW-DAMRSQSNSSNSSSNSDQLPFLNYFQEFFNLSGIKTNFTRIWINSKGYASLPAYGNIFSNLLLRTRFESNGS--NYGISVANYPLKYTQSDL----------------LMISGLSFIPASFVIFLSEERITGSKRQQIVSGVNPYVYWMSNFLWDILKYIVPIFIIVLIFVAFDYQSYIGSKNLGAFITLLIFYGLAIIPHMYPFSFLLSTPSTAFVNLNAYNLFLGSITTISTFLLDLLQKDDETLKPVNDFLKKVFLLFPQYGLGRGMMDLSFNYLKFNISNGKQDYDPFGWSTTGEKLCSLSVLFVGWWIVVFIIESGIINRTLCGKIKNRNLKAKEMKDEFEDVDVAVERERI-ISEKISDDVLKVIKLTKVYNQSLNVKNTCCKNVVKDALENEKRELAVNNLCFGVREGECFGLLGVNGAGKTTTFKMLTGEEEITRGNAFINGQSIISDMIGAHRNMGFCPQFDALHALLTCEEQLTFYCRIRGIESNQIKSVVDTSLRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAAV-------------------NNGEWRNEVLGSVQHLKSKFGDDYYVTIRMPFGKDHENDNEKVKAIIEDKFRSEVSFVNGSFVTLQYRFASSTKLAVIFDFFENLKKDSIILYYSVSQTTLNDVFINFARDDKPVK------SLILQNLSDDGGSFNEGFDNSE 1975          
The following BLAST results are available for this feature:
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ABCA10.000e+035.64ATP binding cassette subfamily A member 1 [Source:... [more]
ABCA40.000e+034.75ATP binding cassette subfamily A member 4 [Source:... [more]
ABCA73.679e-3632.87ATP binding cassette subfamily A member 7 [Source:... [more]
ABCA121.560e-3733.23ATP binding cassette subfamily A member 12 [Source... [more]
ABCA121.934e-3733.33ATP binding cassette subfamily A member 12 [Source... [more]
back to top
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abt-21.949e-10934.55ABC Transporter family [Source:UniProtKB/TrEMBL;A... [more]
abt-22.188e-10934.55ABC Transporter family [Source:UniProtKB/TrEMBL;A... [more]
abt-44.630e-10833.99ABC Transporter family [Source:UniProtKB/TrEMBL;A... [more]
ced-79.049e-6728.87ABC transporter ced-7 [Source:UniProtKB/Swiss-Pro... [more]
ced-71.153e-6628.87ABC transporter ced-7 [Source:UniProtKB/Swiss-Pro... [more]
back to top
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ABCA2.966e-12032.73gene:FBgn0031170 transcript:FBtr0332489[more]
ABCA3.116e-12032.73gene:FBgn0031170 transcript:FBtr0306679[more]
ABCA3.143e-12032.73gene:FBgn0031170 transcript:FBtr0332488[more]
CG60521.245e-10032.60gene:FBgn0036747 transcript:FBtr0075195[more]
CG428161.358e-7031.91gene:FBgn0261998 transcript:FBtr0307890[more]
back to top
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abca1b0.000e+036.65ATP-binding cassette, sub-family A (ABC1), member ... [more]
abca1b0.000e+036.29ATP-binding cassette, sub-family A (ABC1), member ... [more]
abca1a3.142e-4836.18ATP-binding cassette, sub-family A (ABC1), member ... [more]
abca1a3.142e-4836.18ATP-binding cassette, sub-family A (ABC1), member ... [more]
abca4a1.073e-3936.38ATP-binding cassette, sub-family A (ABC1), member ... [more]
back to top
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ABCA10.000e+035.82ATP binding cassette subfamily A member 1 [Source:... [more]
ABCA10.000e+035.56ATP binding cassette subfamily A member 1 [Source:... [more]
klf90.000e+034.47Kruppel-like factor 9 [Source:Xenbase;Acc:XB-GENE-... [more]
ABCA10.000e+035.36ATP binding cassette subfamily A member 1 [Source:... [more]
klf90.000e+034.42Kruppel-like factor 9 [Source:Xenbase;Acc:XB-GENE-... [more]
back to top
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Abca10.000e+035.37ATP-binding cassette, sub-family A (ABC1), member ... [more]
Abca40.000e+033.64ATP-binding cassette, sub-family A (ABC1), member ... [more]
Abca71.104e-4132.94ATP-binding cassette, sub-family A (ABC1), member ... [more]
Abca71.189e-4132.91ATP-binding cassette, sub-family A (ABC1), member ... [more]
Abca71.189e-4132.91ATP-binding cassette, sub-family A (ABC1), member ... [more]
back to top
BLAST of ATP-binding cassette sub-family A member 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O95477|ABCA1_HUMAN0.000e+035.64Phospholipid-transporting ATPase ABCA1 OS=Homo sap... [more]
sp|P41233|ABCA1_MOUSE0.000e+035.37Phospholipid-transporting ATPase ABCA1 OS=Mus musc... [more]
sp|O35600|ABCA4_MOUSE0.000e+033.64Retinal-specific phospholipid-transporting ATPase ... [more]
sp|P78363|ABCA4_HUMAN0.000e+034.75Retinal-specific phospholipid-transporting ATPase ... [more]
sp|Q8IZY2|ABCA7_HUMAN1.955e-3532.87Phospholipid-transporting ATPase ABCA7 OS=Homo sap... [more]
back to top
BLAST of ATP-binding cassette sub-family A member 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
N1PB020.000e+038.24Uncharacterized protein OS=Capitella teleta OX=283... [more]
A0A1S3JVH40.000e+036.44LOW QUALITY PROTEIN: ATP-binding cassette sub-fami... [more]
V4ABB81.481e-4437.95Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
A0A3Q1GH780.000e+035.27Uncharacterized protein OS=Acanthochromis polyacan... [more]
A0A3S2MJM91.159e-4034.92Uncharacterized protein OS=Oryzias javanicus OX=12... [more]
back to top
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000016919.20.000e+034.40pep primary_assembly:Astyanax_mexicanus-2.0:8:9912... [more]
abca4a7.128e-636.30retinal-specific ATP-binding cassette transporter-... [more]
abca4a8.490e-635.58retinal-specific ATP-binding cassette transporter-... [more]
abca1a2.283e-4535.86ATP-binding cassette sub-family A member 1-like [S... [more]
abca1a2.283e-4535.86ATP-binding cassette sub-family A member 1-like [S... [more]
back to top
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000002495.12.085e-4235.97pep scaffold:Pmarinus_7.0:GL480265:53:27909:1 gene... [more]
abca122.132e-11734.72ATP-binding cassette, sub-family A (ABC1), member ... [more]
ENSPMAT00000006855.13.204e-8648.40pep scaffold:Pmarinus_7.0:GL486953:391:4596:1 gene... [more]
ENSPMAT00000004117.14.191e-8536.52pep scaffold:Pmarinus_7.0:GL489716:190:6182:-1 gen... [more]
ENSPMAT00000010397.15.321e-7742.38pep scaffold:Pmarinus_7.0:GL480213:155963:163950:1... [more]
back to top
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
PDR53.302e-1427.31Plasma membrane ATP-binding cassette (ABC) transpo... [more]
ADP16.409e-1326.97Putative ATP-dependent permease of the ABC transpo... [more]
PDR153.054e-1228.30Plasma membrane ATP binding cassette (ABC) transpo... [more]
ATM16.398e-1227.04Mitochondrial inner membrane ATP-binding cassette ... [more]
YOL075C_mRNA7.387e-1227.86Putative ABC transporter [Source:SGD;Acc:S00000543... [more]
back to top
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO468780.000e+038.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO388792.208e-17339.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO489513.050e-13638.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO320702.511e-7835.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO320711.380e-5838.34Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ATP-binding cassette sub-family A member 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abca1a1.080e-4535.95ATP-binding cassette sub-family A member 1 [Source... [more]
ENSORLT00000045391.17.075e-4436.09ATP-binding cassette sub-family A member 1-like [S... [more]
abca1a1.019e-4535.90ATP-binding cassette sub-family A member 1 [Source... [more]
ENSORLT00000046301.16.783e-4436.20ATP-binding cassette sub-family A member 1-like [S... [more]
abca1a1.027e-4535.80ATP-binding cassette sub-family A member 1 [Source... [more]
back to top
BLAST of ATP-binding cassette sub-family A member 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000056983.10.000e+099.71SMESG000056983.1[more]
SMESG000032861.10.000e+059.65SMESG000032861.1[more]
SMESG000032891.10.000e+059.71SMESG000032891.1[more]
SMESG000068605.10.000e+059.71SMESG000068605.1[more]
SMESG000032896.10.000e+057.61SMESG000032896.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011962 ID=SMED30011962|Name=ATP-binding cassette sub-family A member 1|organism=Schmidtea mediterranea sexual|type=transcript|length=6465bp
AACTCTATATAAATCTTATATGGTAGAATGACGTTTACTTCAGTGATTAA
CCAAATTAGTTTGTTGTTATGGAAAAATTTTCGATTACGCAAAAGAAGAC
CTTTTCAATTAACTTTTGAAATTTTAATATGTTTAAGTTTTATTTTATCT
CTTATCGGGATCCGTCAAGCCCAGTTAAAATTCCGTATTGGTCGATGTGA
ACTAAGAGAAAAGAATATGGCCTCACTAGGACCAATTCCATTTCTCAGAG
ATTATCTTTGTACATTTAATACAACCTGTTACAATGAAACACAGATCGAC
TGGAAAGATAATAAGACCAATGACTATCTGACATTCCTCAATAATTGTAC
ACGAATTTATAACAGTTATCCAAAGCGTCAGCTAACGTCTACAGAATTTC
TCCAGTGGTTAATATTGCATCCGGAAGAGAGTGAAATGTTGAGATATAGT
CTGATATTTCTGAATGCGAAAATCGATTATGTCGTTGAATCGATAGATCT
GATAAATTCTGGAAATTCAAATAATGTTTCCCGAGGAATCAATAAGCTAA
CCACCATGATTTGTGGATCCGATAAAAATGATGCTGCAATTTTGATTTTC
AATTTGAATTTGTTGCAACGATCTAAACGTTCAATACAGACATGCCAAGA
AGTTTATGAGAAATATTTGTCGGTTGATTATTTTCATCGACAATTACTAG
AAATGACAGCACCGATTATTTTTGGTAAAATTTACTTCACTCCCGATTCA
GAATTTACAAGGCAAATTATTAAAAAAGCCAATATTACATTCGAAATTCT
TGATAATTTACGATTATCAGCTGTCGAATGGCGATTGAATTTTCGTGATT
GGCTGAGTAATCAAGTAAACAATAGCAGTACTCTTGATAACATGTCAAAT
AATGCAAAAGTGTGCATGGAAACTAGTCAAAATTACTATACAGTTTGCCA
GCTAATTTATAAAAGTTCCGATAGGAATAGAATCCAAAACTCTATTGAAA
TAGCATCAAGAATATTCGATTTAATAGAAAGAGGATTGAATTGTACGGAA
TTGAATAAATTCCAACCAATGAAATCAAAGGTCGATATCGATAATTTAGC
TCAGAATAAACTAATCAATATTTTTGCCGGAGTTGTATTTAATGAATCGT
TTCAGTATTTGACTTTAAACAATGCGACTGTTCTCAACTACCAAATCCGA
ATGCCAACCAATAGAATCGATTCTACTAAAAATTTCAAAGTACTCGATAC
ATTTTGGAATCCAATTCCAAGACGGGATACAATTTACGATTTAAAATATT
ATACAAGTGGATTTTTATTTTTACAGGAAGCTTTTGATCAAGCGTTTATT
GAATTAGTAACCGGTAATGTAACTATCAATATTGGTACGAGCATGCAAAT
TATGCCATACCCATGTTTCGTTGATGATAGATTTATCAAATTTCTCTCCA
TGATTATGCCTTTCATTCTGATAATTGCTTGGACTCCGTCTGTAACTATT
ATTATTAAAAGTATTGTTTATGAAAAAGAAAACCGATTGAAAGAATTCAT
GCTATTAATGGGTTTAACAAATTTTGTCCATTGGTGCAGTTGGTTTATTT
CCACAATTGTCGTGTTGATTTTCCCAGTTATTTTTATGACTTTGATATTG
AAATATAACGAAATCATTCAATTCTCATCACCGGGAATTATTTTTATTTT
AATTCTTTCATATGTTATCTCCTTTATTTGTCAATCATTTATGATAAGTG
TGTTTTTTGATAACTCAAATGTCGCCGCAATTGTCGGGGGAATTGTTTAT
TTTATTTTTTACTTGCCATTTTTAGTATTTATAAATTTTCAAGATGAGCT
ATCAACGGAGATGTATTATGGAGTTGGTTTGTTGACGCAAGTTTCATTCT
GCAACGCCATTAATTTCATTGGCTATTTGGAGCAAGCGAGTGACGGTGCG
CAATTTTCTAATCTGTTTAACAGCACAATTATTGATTTGAATTTTGGAGT
TGGACATTGTTTGATAATGATATGGATAGATAGTGTTTTTTATATTTTAA
TAGCTTGGTATGTTGAAGCGGTATTTCCTGGAAAATACGGAGTACCGAAG
CCCTGGTATTTTCTATTCACAAGACGTTATTGGATACCATTTTCTAAGAA
TAACGATAATATTGAAATTTCAGACAATTTTCGGCAACGTGAAGAAAATA
TCGCTATAGATGGTTTTGAGAAGGAGCCCGACGATTTGGAAATTGGAATA
TTGATTGAAAATCTTGTCAAAAAATTTCCGAAATCTAAAACACCGGCACT
TGATAATCTCAATTTGAAATTCTATCAGTCACAAATCACTGGATTTCTCG
GTCATAACGGGGCTGGTAAAACAACCACAATATCGATTTTGACGGGGATT
CTCACCCCTACTTCTGGAACTGCATTTATTTTGGATAATGATATTAGATA
TGACATGGAAATAATAAGATCAAAAATAGGATTATGTCCGCAGCACAATA
TCTTATTCGCCTATTTGACAGTTGAGGATCATATTTATTTTTACGGACTC
CTTAAAGGAATGACAAAATCAGAAATTAAACATCAACTGCCGGATATAGT
TAAAGAAGTTGGCTTATCTAAAAAATTGAAATGTATGTCAAAAAATCTTT
CCGGAGGAATGAAGCGAAAATTAAGCATAGCAATGGCATTTGTTGGCAAT
TCTCGTATAATTTTTCTCGATGAACCAACTGCTGGAGTCGATCCATTTTC
TCGTCGAGGAATTTGGGATTTAATAGTGAAATATCGAAGCATCAATCGAA
CAATTATTCTCACCACTCATCACATGGATGAAGCCGATTATTTGTGTGAC
AGAATTGCCATAATATCTCAAGGTAAACTCAAATGTTGTGGATCATCTTT
GTTTCTAAAACAAAATTTCGGGGATGGATATTATTTATTCCTAGAAAAAT
CTTTTGAAATTCAAAGTGAAACTTGTCATAACAATAAAGCATCTGAAAGT
GGCACTAAGCTTCTAGAATTTATTAAAAAAATCATTCCGAATTCCAAACT
AATTGACGAAACAAAAACTCAATGGACAGTCGTTTTATCGCATAATTCAA
CCAATAGAAATCAATTTACGAGTCTATTTGAACAACTCGATTCTTCGTTA
GACTTTTTAAAAATTGCGTCTTATGGCTTGTCGGATACTTCTCTTGAAGA
GGTATTCTTAAAAGTCGCAGATGACCCGTCTCAAATTTCTCATAAACGAC
AAGAGAAACAAATTACTTCAGAAATGCTGGATACGTTGACAGACGGTGGA
AATTTACCTCGTCCAGTTTCAGTTTTGAGTTTCAGAAAAAAAACTATTAA
TACTGCAAACATAAATGACCCTAAAGTTTCATTTGAATTCGAAAACAATT
TAGTTTTACTTTCTGGCTTGTCTTTAATTTTTCAACAAATTTCCGGGCTG
TTTATTAAGCGTTTTCATCATACTAAAAGAAATATTAAAGGACTTTTCAG
TGAATTAATATTGCCCCTGTTGTTAATTTTATTAATAAGTGGTTTATTAA
AAATTAAAAGCTCTATGGACAATCAACCATCAATGACAATTAGTCCTTGG
TTAATGATGCCTAAAACTCGATTGGTAAATCTAAATACTTTCTATAGAAA
AGAGAACACTTCCGATCAAATTAGCTTTAAGTTAAATGAAAATTACAGGT
CAGATATCGGACAATCTGGAGTTCGGTGTATGAATACATCATTATATCAA
TTGGAAAACTTTAAATGCCTTTATCCATATAACACAAATAAATGGTCGGA
AAAATCGCCAATTGAAATATCTCTAGTTACACCAGAATGTGACTGTAGTA
CCACTGGAAATCAAATTTGTTCCAGTCCACTCAGTGGAGGTCCAGAGAGT
TCGAATCGTATAATGGCCAGTTCAGATAGGCTTTATGATCTTTCCTCGTA
TAATATTTCAGATTATCTTATGAAAAATTTCAAAACATTTATCATGAAAC
AATATGGAGGCCTTCAATTTATTCTTCCAAGCTTTTTCGGGCAATCTTGT
CAAGTGATTGGAGAATCGCAGATTTGGTTTGATTTTCGTCAATCAATCAA
CTCTTCCCGTGATAACAATTCCAACCCGGAACAGGTTAAATTTCTCAATT
ATTTTCAATTGTTTTTCAATTCATCAGGAATAAAAACCAACTTGTCAAGA
ATCTGGATAAATTCAAAAGGTTACATTTCTATGCCAGCCTATGCAAATAT
TTTCAGTAATCTACTTTTGAGGTCGACTGTTAATGCTTCCAAGGCATTGC
AAAATTATGGAATTGCGGTTGCGAATTACCCTTTAAAATATACCCAATCC
GACTTGTTTAGTTTCATCTACGCTCAAATGTTTCTTGAAGTTTCTTTAGC
GATTTTTGTTATATTTGGACTTTCTTTTATACCAGCTAGTTTCGTCATAT
TTTTGATTGAAGAGAGAGTCACTGGGTCCAAGTTACAGCAGTATGTTTCT
GGTGTAAACCCATACGTTTACTGGATATCTAATTTCTTTTGGGATGCGAT
AAAATATTCAATATCTGTGTTAATTGTAATTTTATTTTTTCTTGCATTTA
ATTATCAGTCTTATATCGGTAGTAAGAATATTCTGGCATTTATTGTCTTA
CTTTTCCTTTATTCTTTAGCTGTGATTCCACACATGTATCCGTTTAGTTT
TTTTATATCAAAATCTAGTACGGCTTTTGTTGTTATTAGTGCTTATAATC
TTCTAGTAGGAGGCCTCACGACTATAACCACGTTTTATTTGGATCTCTAT
CAGTATGATGATGCTTCCTTGAAATCTGCCAATGACGCATTGAAAAAAAT
ATTTCTAATATTTCCTCAATATGATCTTGGCCGAGGAATGATAGATTTGT
CTTTCAGTTATTTAAGATATAATATTAGTGGGGGAGATGAAAATTACAAT
GCATTTGAATGGGATATAACTGGAAATAAGATATGCTCTCTTGGTATTCT
ATTCGTCGGATGGTGCCTAATAATAGTTTTCATGGAAAGTAAACATAAAA
AGACATTGTGTATAAAATTAAAAGATGTTAAATTAAAGCCTTATGAAATA
ATCACTGACGAAGATTTGGATGTATTTAAAGAAAGAGAAAGAATTGAGTT
AAATCATGACGTTCTTAATGATGTTCTTCAAGTTTACGGTTTAACAAAAA
TTTATAATCCATCTATTGACTTTAGAAATAAGTGCTTTGGAAAAGCCATT
ATTAATGTATCGTCGGAAGATAAACGTAAACTTGCCGTAAATAATATCAG
TTTCGGAGTTAAAGAAGGAGAATGCTTTGGATTATTAGGAGTGAATGGAG
CAGGCAAAACGACTACATTTAAAATGCTTATCGGAGAAGAAAATATAACT
TTAGGAAATGCAATTATCAATGGATATTCCATTATTGATGACACATTAAA
GGCTCATAAAAATATGGGATTCTGTCCACAATTTGATGCTCTTCATTCTT
TATTGACGTGCGAAGAAGAGTTATATTTTTACAATCGTATACGAGGAATA
CAGCCATCCGATATTCCAATTAATGTTGATTTAAGCTTGAAAAATCTTAG
TCTAACTCCACACTATAATAAACCGACATATATGATATCTGGGGGAAACA
AAAGAAAAATGCAAACTGCTATAGCGCTAATTGGATATCCTAAAATTGTG
TTTTTAGACGAACCGACATGTGGAATGGATGCTGGAGCTAGGAGATTTTT
ATGGCGGTTAATTCAAACATTGACAAATGAACATAAAGTTGCTGTGATTT
TAACATCACATAACATGGAGGAGTGTGAAGTGCTATGTCATAGGTTAGCA
ATCATGGTAGATGGAGAAATGAAAACCATCGGAAGTGTTCAACATTTAAA
ATCAAAATTTGGGCACGATTATTACGTAAAGATTCGTTTGCATCCTAATC
GAAATTCCCTTTCAGATAGAAATGAAATAGAAACGATTATCAATAAAGAA
ATATGGTCCAGTGCCAGGATGAAGGAGGAAAATGCTGTGATAATTGAATA
TCGATTTGATTCGTCAGTTAAATTATCCGATATTTTTAGAGTTTTCGAAG
ATCTCAGAACAAACGAAATGGTTAAGGAATATTCAGTTTCTCAAATGTCT
TTGGATGAGGTCTTCATAAACTTTGCTAAAAATGATTCTGTAACACGAAA
TATTAGTAACGGAAACGCTTTAATTCAAAAACCGAATTTTAATAATGACG
GATATTTGAATGAAGGATTCGAAAAAACGGACTTTTGATATGAGATTTTC
CAATAGTCTGTAGATATCATTTTACAGATTCGTTAAATTGTTTTTAGAAA
TTATTTTGTTGAGACTTCAAAAAAAGAATTTATCAAAAACATCAATTATA
TATTTTCAATGTTTTATTTTGTGACTGTCTATCTTGAACTAAAAATTTGC
AATTTTATTATTTTA
back to top

protein sequence of SMED30011962-orf-1

>SMED30011962-orf-1 ID=SMED30011962-orf-1|Name=SMED30011962-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=2087bp
MTFTSVINQISLLLWKNFRLRKRRPFQLTFEILICLSFILSLIGIRQAQL
KFRIGRCELREKNMASLGPIPFLRDYLCTFNTTCYNETQIDWKDNKTNDY
LTFLNNCTRIYNSYPKRQLTSTEFLQWLILHPEESEMLRYSLIFLNAKID
YVVESIDLINSGNSNNVSRGINKLTTMICGSDKNDAAILIFNLNLLQRSK
RSIQTCQEVYEKYLSVDYFHRQLLEMTAPIIFGKIYFTPDSEFTRQIIKK
ANITFEILDNLRLSAVEWRLNFRDWLSNQVNNSSTLDNMSNNAKVCMETS
QNYYTVCQLIYKSSDRNRIQNSIEIASRIFDLIERGLNCTELNKFQPMKS
KVDIDNLAQNKLINIFAGVVFNESFQYLTLNNATVLNYQIRMPTNRIDST
KNFKVLDTFWNPIPRRDTIYDLKYYTSGFLFLQEAFDQAFIELVTGNVTI
NIGTSMQIMPYPCFVDDRFIKFLSMIMPFILIIAWTPSVTIIIKSIVYEK
ENRLKEFMLLMGLTNFVHWCSWFISTIVVLIFPVIFMTLILKYNEIIQFS
SPGIIFILILSYVISFICQSFMISVFFDNSNVAAIVGGIVYFIFYLPFLV
FINFQDELSTEMYYGVGLLTQVSFCNAINFIGYLEQASDGAQFSNLFNST
IIDLNFGVGHCLIMIWIDSVFYILIAWYVEAVFPGKYGVPKPWYFLFTRR
YWIPFSKNNDNIEISDNFRQREENIAIDGFEKEPDDLEIGILIENLVKKF
PKSKTPALDNLNLKFYQSQITGFLGHNGAGKTTTISILTGILTPTSGTAF
ILDNDIRYDMEIIRSKIGLCPQHNILFAYLTVEDHIYFYGLLKGMTKSEI
KHQLPDIVKEVGLSKKLKCMSKNLSGGMKRKLSIAMAFVGNSRIIFLDEP
TAGVDPFSRRGIWDLIVKYRSINRTIILTTHHMDEADYLCDRIAIISQGK
LKCCGSSLFLKQNFGDGYYLFLEKSFEIQSETCHNNKASESGTKLLEFIK
KIIPNSKLIDETKTQWTVVLSHNSTNRNQFTSLFEQLDSSLDFLKIASYG
LSDTSLEEVFLKVADDPSQISHKRQEKQITSEMLDTLTDGGNLPRPVSVL
SFRKKTINTANINDPKVSFEFENNLVLLSGLSLIFQQISGLFIKRFHHTK
RNIKGLFSELILPLLLILLISGLLKIKSSMDNQPSMTISPWLMMPKTRLV
NLNTFYRKENTSDQISFKLNENYRSDIGQSGVRCMNTSLYQLENFKCLYP
YNTNKWSEKSPIEISLVTPECDCSTTGNQICSSPLSGGPESSNRIMASSD
RLYDLSSYNISDYLMKNFKTFIMKQYGGLQFILPSFFGQSCQVIGESQIW
FDFRQSINSSRDNNSNPEQVKFLNYFQLFFNSSGIKTNLSRIWINSKGYI
SMPAYANIFSNLLLRSTVNASKALQNYGIAVANYPLKYTQSDLFSFIYAQ
MFLEVSLAIFVIFGLSFIPASFVIFLIEERVTGSKLQQYVSGVNPYVYWI
SNFFWDAIKYSISVLIVILFFLAFNYQSYIGSKNILAFIVLLFLYSLAVI
PHMYPFSFFISKSSTAFVVISAYNLLVGGLTTITTFYLDLYQYDDASLKS
ANDALKKIFLIFPQYDLGRGMIDLSFSYLRYNISGGDENYNAFEWDITGN
KICSLGILFVGWCLIIVFMESKHKKTLCIKLKDVKLKPYEIITDEDLDVF
KERERIELNHDVLNDVLQVYGLTKIYNPSIDFRNKCFGKAIINVSSEDKR
KLAVNNISFGVKEGECFGLLGVNGAGKTTTFKMLIGEENITLGNAIINGY
SIIDDTLKAHKNMGFCPQFDALHSLLTCEEELYFYNRIRGIQPSDIPINV
DLSLKNLSLTPHYNKPTYMISGGNKRKMQTAIALIGYPKIVFLDEPTCGM
DAGARRFLWRLIQTLTNEHKVAVILTSHNMEECEVLCHRLAIMVDGEMKT
IGSVQHLKSKFGHDYYVKIRLHPNRNSLSDRNEIETIINKEIWSSARMKE
ENAVIIEYRFDSSVKLSDIFRVFEDLRTNEMVKEYSVSQMSLDEVFINFA
KNDSVTRNISNGNALIQKPNFNNDGYLNEGFEKTDF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000099neuron
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR026082ABCA
IPR003593AAA+_ATPase
IPR027417P-loop_NTPase
IPR003439ABC_transporter-like
IPR017871ABC_transporter_CS
IPR007492LytTR_DNA-bd_dom
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0016887ATPase activity
GO:0003677DNA binding
GO:0000166nucleotide binding
GO:0005102signaling receptor binding
GO:0005215transporter activity
GO:0005515protein binding
GO:0005543phospholipid binding
GO:0005548phospholipid transporter activity
GO:0008509anion transmembrane transporter activity
GO:0015485cholesterol binding
GO:0017127cholesterol transporter activity
GO:0019905syntaxin binding
GO:0031267small GTPase binding
GO:0034185apolipoprotein binding
GO:0034186apolipoprotein A-I binding
GO:0034188apolipoprotein A-I receptor activity
GO:0042626ATPase activity, coupled to transmembrane movement of substances
GO:0051117ATPase binding
GO:0090554phosphatidylcholine-translocating ATPase activity
GO:0090556phosphatidylserine-translocating ATPase activity
Vocabulary: biological process
TermDefinition
GO:0002790peptide secretion
GO:0006497protein lipidation
GO:0006629lipid metabolic process
GO:0006810transport
GO:0006911phagocytosis, engulfment
GO:0007040lysosome organization
GO:0007186G-protein coupled receptor signaling pathway
GO:0007584response to nutrient
GO:0008202steroid metabolic process
GO:0008203cholesterol metabolic process
GO:0010745negative regulation of macrophage derived foam cell differentiation
GO:0010875positive regulation of cholesterol efflux
GO:0010887negative regulation of cholesterol storage
GO:0015914phospholipid transport
GO:0015917aminophospholipid transport
GO:0016197endosomal transport
GO:0030301cholesterol transport
GO:0030819positive regulation of cAMP biosynthetic process
GO:0032367intracellular cholesterol transport
GO:0032489regulation of Cdc42 protein signal transduction
GO:0033344cholesterol efflux
GO:0033700phospholipid efflux
GO:0034380high-density lipoprotein particle assembly
GO:0034616response to laminar fluid shear stress
GO:0038027apolipoprotein A-I-mediated signaling pathway
GO:0042157lipoprotein metabolic process
GO:0042158lipoprotein biosynthetic process
GO:0042493response to drug
GO:0042632cholesterol homeostasis
GO:0043691reverse cholesterol transport
GO:0045332phospholipid translocation
GO:0050702interleukin-1 beta secretion
GO:0055085transmembrane transport
GO:0055091phospholipid homeostasis
GO:0055098response to low-density lipoprotein particle
GO:0060155platelet dense granule organization
GO:0071222cellular response to lipopolysaccharide
GO:0071300cellular response to retinoic acid
GO:0071397cellular response to cholesterol
GO:0090107regulation of high-density lipoprotein particle assembly
GO:0098656anion transmembrane transport
Vocabulary: cellular component
TermDefinition
GO:0005789endoplasmic reticulum membrane
GO:0005794Golgi apparatus
GO:0005886plasma membrane
GO:0005887integral component of plasma membrane
GO:0009897external side of plasma membrane
GO:0009986cell surface
GO:0016020membrane
GO:0016021integral component of membrane
GO:0030139endocytic vesicle
GO:0034364high-density lipoprotein particle
GO:0043231intracellular membrane-bounded organelle
GO:0045121membrane raft
GO:0045335phagocytic vesicle
GO:0048471perinuclear region of cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003593AAA+ ATPase domainSMARTSM00382AAA_5coord: 1764..1948
e-value: 2.5E-6
score: 37.0
coord: 768..951
e-value: 2.7E-10
score: 50.2
IPR003439ABC transporter-likePFAMPF00005ABC_trancoord: 1755..1898
e-value: 7.7E-22
score: 78.3
IPR003439ABC transporter-likePFAMPF00005ABC_trancoord: 759..903
e-value: 1.5E-29
score: 103.3
IPR003439ABC transporter-likePROSITEPS50893ABC_TRANSPORTER_2coord: 742..974
score: 19.995
IPR003439ABC transporter-likePROSITEPS50893ABC_TRANSPORTER_2coord: 1740..1971
score: 16.673
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 739..1009
e-value: 4.0E-64
score: 218.7
NoneNo IPR availablePFAMPF12698ABC2_membrane_3coord: 1156..1667
e-value: 3.7E-32
score: 111.8
coord: 348..679
e-value: 1.7E-20
score: 73.4
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 1734..1975
e-value: 1.6E-51
score: 177.1
NoneNo IPR availableCDDcd03263ABC_subfamily_Acoord: 742..962
e-value: 1.97654E-108
score: 342.562
NoneNo IPR availableCDDcd03263ABC_subfamily_Acoord: 1718..1959
e-value: 1.88271E-96
score: 308.28
NoneNo IPR availableTMHMMTMhelixcoord: 1653..1670
NoneNo IPR availableTMHMMTMhelixcoord: 1504..1526
NoneNo IPR availableTMHMMTMhelixcoord: 1456..1478
NoneNo IPR availableTMHMMTMhelixcoord: 1567..1589
NoneNo IPR availableTMHMMTMhelixcoord: 1535..1557
NoneNo IPR availableTMHMMTMhelixcoord: 547..569
NoneNo IPR availableTMHMMTMhelixcoord: 520..542
NoneNo IPR availableTMHMMTMhelixcoord: 613..635
NoneNo IPR availableTMHMMTMhelixcoord: 581..603
NoneNo IPR availableTMHMMTMhelixcoord: 27..46
NoneNo IPR availableTMHMMTMhelixcoord: 477..499
NoneNo IPR availableTMHMMTMhelixcoord: 1156..1175
NoneNo IPR availableTMHMMTMhelixcoord: 655..677
IPR026082ABC transporter APANTHERPTHR19229ATP-BINDING CASSETTE TRANSPORTER SUBFAMILY A ABCAcoord: 10..2053
IPR017871ABC transporter, conserved sitePROSITEPS00211ABC_TRANSPORTER_1coord: 875..889
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 1743..1968
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 739..957