Tensin 3

Overview
NameTensin 3
Smed IDSMED30011961
Length (bp)2247
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tensin 3 (SMED30011961) t-SNE clustered cells

Violin plots show distribution of expression levels for Tensin 3 (SMED30011961) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tensin 3 (SMED30011961) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tensin 3 (SMED30011961) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011961

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30011961h1SMcG0020652 Contig49799newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30011961h1SMcG0020652 Contig49799uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30011961h1SMcG0020652 dd_Smed_v4_4454_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30011961h1SMcG0020652 dd_Smed_v4_4454_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30011961h1SMcG0020652 dd_Smed_v4_4454_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30011961h1SMcG0020652 dd_Smed_v4_4454_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30011961h1SMcG0020652 dd_Smed_v4_4454_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30011961h1SMcG0020652 dd_Smed_v4_4454_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30011961h1SMcG0020652 dd_Smed_v4_8696_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30011961h1SMcG0020652 dd_Smed_v4_8696_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
anterior sideSMED30011961h1SMcG0020652 dd_Smed_v4_8696_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30011961h1SMcG0020652 dd_Smed_v4_4454_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30011961h1SMcG0020652 dd_Smed_v4_8696_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tensin 3 vs. Ensembl Human
Match: TNS1 (tensin 1 [Source:HGNC Symbol;Acc:HGNC:11973])

HSP 1 Score: 222.631 bits (566), Expect = 3.656e-61
Identity = 117/279 (41.94%), Postives = 173/279 (62.01%), Query Frame = 1
Query: 1270 LRKSAKIWYQPNMSREEAVKTLKGKPPGSFVVRQSHTFNNSYGLAVNV--PRTSTVEDDDR------CVRHFLIESNTKGVRIRGCSNEPYFGSLTALVHQHTLTKLALPCCLILPIXXXXXXXXXXXXXXCNKNNTPKVSSLFAPKTFSALYLGSIDTESLTGAAALSKAVEILLENKTEVKQTEVSIRISPEGLTLTDVLRKLFFRRHYPLNSISYCGTE-NSTYWDSAETRSRGFAKSKIFGFVARKTG-TTENMCHLLCEWHPQDNSRAITNFIS 2076
            ++ ++K WY+P +SRE+A+  LK + PG+F++R SH+F  +YGLA+ V  P  + ++ + +       VRHFLIE+  +GV+++GC NEP FGSL+ALV+QH++  LALPC L++P   +     +S   S   N+T  +  L      + L++ S+D ESLTG  A+SKA    L        T V  ++S +G+TLTD  RKLFFRRHYPLN++++C  +     W     ++ G A +K+FGFVARK G TT+N CHL  E  P   + AI NF+S
Sbjct:  567 VQDTSKYWYKPEISREQAIALLKDQEPGAFIIRDSHSFRGAYGLAMKVSSPPPTIMQQNKKGDMTHELVRHFLIETGPRGVKLKGCPNEPNFGSLSALVYQHSIIPLALPCKLVIP---NRDPTDESKDSSGPANSTADL--LKQGAACNVLFVNSVDMESLTGPQAISKATSETLAADPTPAATIVHFKVSAQGITLTDNQRKLFFRRHYPLNTVTFCDLDPQERKW----MKTEGGAPAKLFGFVARKQGSTTDNACHLFAELDPNQPASAIVNFVS 836          
BLAST of Tensin 3 vs. Ensembl Human
Match: TNS1 (tensin 1 [Source:HGNC Symbol;Acc:HGNC:11973])

HSP 1 Score: 224.172 bits (570), Expect = 1.160e-60
Identity = 117/279 (41.94%), Postives = 173/279 (62.01%), Query Frame = 1
Query: 1270 LRKSAKIWYQPNMSREEAVKTLKGKPPGSFVVRQSHTFNNSYGLAVNV--PRTSTVEDDDR------CVRHFLIESNTKGVRIRGCSNEPYFGSLTALVHQHTLTKLALPCCLILPIXXXXXXXXXXXXXXCNKNNTPKVSSLFAPKTFSALYLGSIDTESLTGAAALSKAVEILLENKTEVKQTEVSIRISPEGLTLTDVLRKLFFRRHYPLNSISYCGTE-NSTYWDSAETRSRGFAKSKIFGFVARKTG-TTENMCHLLCEWHPQDNSRAITNFIS 2076
            ++ ++K WY+P +SRE+A+  LK + PG+F++R SH+F  +YGLA+ V  P  + ++ + +       VRHFLIE+  +GV+++GC NEP FGSL+ALV+QH++  LALPC L++P   +     +S   S   N+T  +  L      + L++ S+D ESLTG  A+SKA    L        T V  ++S +G+TLTD  RKLFFRRHYPLN++++C  +     W     ++ G A +K+FGFVARK G TT+N CHL  E  P   + AI NF+S
Sbjct: 1086 VQDTSKYWYKPEISREQAIALLKDQEPGAFIIRDSHSFRGAYGLAMKVSSPPPTIMQQNKKGDMTHELVRHFLIETGPRGVKLKGCPNEPNFGSLSALVYQHSIIPLALPCKLVIP---NRDPTDESKDSSGPANSTADL--LKQGAACNVLFVNSVDMESLTGPQAISKATSETLAADPTPAATIVHFKVSAQGITLTDNQRKLFFRRHYPLNTVTFCDLDPQERKW----MKTEGGAPAKLFGFVARKQGSTTDNACHLFAELDPNQPASAIVNFVS 1355          
BLAST of Tensin 3 vs. Ensembl Human
Match: TNS3 (tensin 3 [Source:HGNC Symbol;Acc:HGNC:21616])

HSP 1 Score: 222.631 bits (566), Expect = 3.137e-60
Identity = 125/289 (43.25%), Postives = 179/289 (61.94%), Query Frame = 1
Query: 1270 LRKSAKIWYQPNMSREEAVKTLKGKPPGSFVVRQSHTFNNSYGLAVNV--PRTSTVEDDDRC-------VRHFLIESNTKGVRIRGCSNEPYFGSLTALVHQHTLTKLALPCCLILPIXXXXXXXXXXXXXXCNKNNTPKVSSLFAPKTFSALYLGSIDTESLTGAAALSKAVEILLENKTEVKQTEVSIRISPEGLTLTDVLRKLFFRRHYPLNSISYCGTENSTYWDSAETRSRGFAK----SKIFGFVARKTGT-TENMCHLLCEWHPQDNSRAITNFISCCVPGT 2094
            ++ ++K WY+ ++SRE+A+  LK K PGSF+VR SH+F  +YGLA+ V  P  S ++ + +        VRHFLIE   KGVR++GCSNEPYFGSLTALV QH++T LALPC L++P     L++   S      N+  ++  L      +  YL S++ ESLTG  A+ KA+ I L  +     T V  ++S +G+TLTD  RKLFFRRHYP+NS+ +C         + + + R + K    SK+FGFVARK G+ T+N+CHL  E  P+  + AI NF+S  + G+
Sbjct: 1165 VQDTSKFWYKADISREQAIAMLKDKEPGSFIVRDSHSFRGAYGLAMKVATPPPSVLQLNKKAGDLANELVRHFLIECTPKGVRLKGCSNEPYFGSLTALVCQHSITPLALPCKLLIP-ERDPLEEIAESSPQTAANSAAEL--LKQGAACNVWYLNSVEMESLTGHQAIQKALSITLVQEPPPVSTVVHFKVSAQGITLTDNQRKLFFRRHYPVNSVIFC---------ALDPQDRKWIKDGPSSKVFGFVARKQGSATDNVCHLFAEHDPEQPASAIVNFVSKVMIGS 1441          
BLAST of Tensin 3 vs. Ensembl Human
Match: TNS1 (tensin 1 [Source:HGNC Symbol;Acc:HGNC:11973])

HSP 1 Score: 222.246 bits (565), Expect = 5.021e-60
Identity = 117/278 (42.09%), Postives = 173/278 (62.23%), Query Frame = 1
Query: 1270 LRKSAKIWYQPNMSREEAVKTLKGKPPGSFVVRQSHTFNNSYGLAVNV--PRTSTVEDDDR-----CVRHFLIESNTKGVRIRGCSNEPYFGSLTALVHQHTLTKLALPCCLILPIXXXXXXXXXXXXXXCNKNNTPKVSSLFAPKTFSALYLGSIDTESLTGAAALSKAVEILLENKTEVKQTEVSIRISPEGLTLTDVLRKLFFRRHYPLNSISYCGTE-NSTYWDSAETRSRGFAKSKIFGFVARKTG-TTENMCHLLCEWHPQDNSRAITNFIS 2076
            ++ ++K WY+P +SRE+A+  LK + PG+F++R SH+F  +YGLA+ V  P  + ++ + +      VRHFLIE+  +GV+++GC NEP FGSL+ALV+QH++  LALPC L++P   +     +S   S   N+T  +  L      + L++ S+D ESLTG  A+SKA    L        T V  ++S +G+TLTD  RKLFFRRHYPLN++++C  +     W     ++ G A +K+FGFVARK G TT+N CHL  E  P   + AI NF+S
Sbjct: 1443 VQDTSKYWYKPEISREQAIALLKDQEPGAFIIRDSHSFRGAYGLAMKVSSPPPTIMQQNKKDMTHELVRHFLIETGPRGVKLKGCPNEPNFGSLSALVYQHSIIPLALPCKLVIP---NRDPTDESKDSSGPANSTADL--LKQGAACNVLFVNSVDMESLTGPQAISKATSETLAADPTPAATIVHFKVSAQGITLTDNQRKLFFRRHYPLNTVTFCDLDPQERKW----MKTEGGAPAKLFGFVARKQGSTTDNACHLFAELDPNQPASAIVNFVS 1711          
BLAST of Tensin 3 vs. Ensembl Human
Match: TNS1 (tensin 1 [Source:HGNC Symbol;Acc:HGNC:11973])

HSP 1 Score: 222.246 bits (565), Expect = 5.021e-60
Identity = 117/278 (42.09%), Postives = 173/278 (62.23%), Query Frame = 1
Query: 1270 LRKSAKIWYQPNMSREEAVKTLKGKPPGSFVVRQSHTFNNSYGLAVNV--PRTSTVEDDDR-----CVRHFLIESNTKGVRIRGCSNEPYFGSLTALVHQHTLTKLALPCCLILPIXXXXXXXXXXXXXXCNKNNTPKVSSLFAPKTFSALYLGSIDTESLTGAAALSKAVEILLENKTEVKQTEVSIRISPEGLTLTDVLRKLFFRRHYPLNSISYCGTE-NSTYWDSAETRSRGFAKSKIFGFVARKTG-TTENMCHLLCEWHPQDNSRAITNFIS 2076
            ++ ++K WY+P +SRE+A+  LK + PG+F++R SH+F  +YGLA+ V  P  + ++ + +      VRHFLIE+  +GV+++GC NEP FGSL+ALV+QH++  LALPC L++P   +     +S   S   N+T  +  L      + L++ S+D ESLTG  A+SKA    L        T V  ++S +G+TLTD  RKLFFRRHYPLN++++C  +     W     ++ G A +K+FGFVARK G TT+N CHL  E  P   + AI NF+S
Sbjct: 1443 VQDTSKYWYKPEISREQAIALLKDQEPGAFIIRDSHSFRGAYGLAMKVSSPPPTIMQQNKKDMTHELVRHFLIETGPRGVKLKGCPNEPNFGSLSALVYQHSIIPLALPCKLVIP---NRDPTDESKDSSGPANSTADL--LKQGAACNVLFVNSVDMESLTGPQAISKATSETLAADPTPAATIVHFKVSAQGITLTDNQRKLFFRRHYPLNTVTFCDLDPQERKW----MKTEGGAPAKLFGFVARKQGSTTDNACHLFAELDPNQPASAIVNFVS 1711          
BLAST of Tensin 3 vs. Ensembl Celegans
Match: tns-1 (TeNSin homolog [Source:UniProtKB/TrEMBL;Acc:H2L045])

HSP 1 Score: 195.282 bits (495), Expect = 3.960e-56
Identity = 106/283 (37.46%), Postives = 164/283 (57.95%), Query Frame = 1
Query: 1270 LRKSAKIWYQPNMSREEAVKTLKGKPPGSFVVRQSHTFNNSYGLAVNV---PRTSTVEDDDRCVRHFLIESNTKGVRIRGCSNEPYFGSLTALVHQHTLTKLALPCCLILPIXXXXXXXXXXXXXXCNKNNTPKVSS-----LFAPKTFSALYLGSIDTESLTGAAALSKAVEILLENKT--EVKQTEVSIRISPEGLTLTDVLRKLFFRRHYPLNSISYCGTENSTYWDSAETRSRGF-----AKSKIFGFVARKTGTTENMCHLLCEWHPQDNSRAITNFI 2073
            ++ ++K WY+P +SRE+A+  L+ KPPG+FVVR S++F  ++GLA+ V   P      D    VRHFLIE + KGV+++GC+NEP FGSL+ALV+QH++T LALP  L+LP                +   TP+  S     L      + +Y+GS+D ESLTG   + +++    +     + +   V  ++S +G+TLTD  RK+FFRRH+ + S+ + G +         TR+ GF     A++++F FVAR   ++EN CH+  E  P+    A+ NFI
Sbjct:   39 VKDTSKYWYKPTISREQAINMLRDKPPGTFVVRDSNSFPGAFGLALKVSTPPPGVNPGDGSELVRHFLIEPSPKGVKLKGCNNEPVFGSLSALVYQHSITALALPTKLVLP--------------DFDPAATPEHLSATQALLEQGAACNVVYVGSVDVESLTGNECVKRSIATCSQRAINGDSRAVSVHFKVSSQGVTLTDNTRKVFFRRHFNVQSVIFAGMD-PIERRFENTRALGFHDGCIAQARLFAFVARIPSSSENACHVFAELEPEQPGSAVVNFI 306          
BLAST of Tensin 3 vs. Ensembl Celegans
Match: tns-1 (TeNSin homolog [Source:UniProtKB/TrEMBL;Acc:H2L045])

HSP 1 Score: 195.667 bits (496), Expect = 3.434e-55
Identity = 106/283 (37.46%), Postives = 164/283 (57.95%), Query Frame = 1
Query: 1270 LRKSAKIWYQPNMSREEAVKTLKGKPPGSFVVRQSHTFNNSYGLAVNV---PRTSTVEDDDRCVRHFLIESNTKGVRIRGCSNEPYFGSLTALVHQHTLTKLALPCCLILPIXXXXXXXXXXXXXXCNKNNTPKVSS-----LFAPKTFSALYLGSIDTESLTGAAALSKAVEILLENKT--EVKQTEVSIRISPEGLTLTDVLRKLFFRRHYPLNSISYCGTENSTYWDSAETRSRGF-----AKSKIFGFVARKTGTTENMCHLLCEWHPQDNSRAITNFI 2073
            ++ ++K WY+P +SRE+A+  L+ KPPG+FVVR S++F  ++GLA+ V   P      D    VRHFLIE + KGV+++GC+NEP FGSL+ALV+QH++T LALP  L+LP                +   TP+  S     L      + +Y+GS+D ESLTG   + +++    +     + +   V  ++S +G+TLTD  RK+FFRRH+ + S+ + G +         TR+ GF     A++++F FVAR   ++EN CH+  E  P+    A+ NFI
Sbjct:  139 VKDTSKYWYKPTISREQAINMLRDKPPGTFVVRDSNSFPGAFGLALKVSTPPPGVNPGDGSELVRHFLIEPSPKGVKLKGCNNEPVFGSLSALVYQHSITALALPTKLVLP--------------DFDPAATPEHLSATQALLEQGAACNVVYVGSVDVESLTGNECVKRSIATCSQRAINGDSRAVSVHFKVSSQGVTLTDNTRKVFFRRHFNVQSVIFAGMD-PIERRFENTRALGFHDGCIAQARLFAFVARIPSSSENACHVFAELEPEQPGSAVVNFI 406          
BLAST of Tensin 3 vs. Ensembl Celegans
Match: tns-1 (TeNSin homolog [Source:UniProtKB/TrEMBL;Acc:H2L045])

HSP 1 Score: 195.667 bits (496), Expect = 3.434e-55
Identity = 106/283 (37.46%), Postives = 164/283 (57.95%), Query Frame = 1
Query: 1270 LRKSAKIWYQPNMSREEAVKTLKGKPPGSFVVRQSHTFNNSYGLAVNV---PRTSTVEDDDRCVRHFLIESNTKGVRIRGCSNEPYFGSLTALVHQHTLTKLALPCCLILPIXXXXXXXXXXXXXXCNKNNTPKVSS-----LFAPKTFSALYLGSIDTESLTGAAALSKAVEILLENKT--EVKQTEVSIRISPEGLTLTDVLRKLFFRRHYPLNSISYCGTENSTYWDSAETRSRGF-----AKSKIFGFVARKTGTTENMCHLLCEWHPQDNSRAITNFI 2073
            ++ ++K WY+P +SRE+A+  L+ KPPG+FVVR S++F  ++GLA+ V   P      D    VRHFLIE + KGV+++GC+NEP FGSL+ALV+QH++T LALP  L+LP                +   TP+  S     L      + +Y+GS+D ESLTG   + +++    +     + +   V  ++S +G+TLTD  RK+FFRRH+ + S+ + G +         TR+ GF     A++++F FVAR   ++EN CH+  E  P+    A+ NFI
Sbjct:  139 VKDTSKYWYKPTISREQAINMLRDKPPGTFVVRDSNSFPGAFGLALKVSTPPPGVNPGDGSELVRHFLIEPSPKGVKLKGCNNEPVFGSLSALVYQHSITALALPTKLVLP--------------DFDPAATPEHLSATQALLEQGAACNVVYVGSVDVESLTGNECVKRSIATCSQRAINGDSRAVSVHFKVSSQGVTLTDNTRKVFFRRHFNVQSVIFAGMD-PIERRFENTRALGFHDGCIAQARLFAFVARIPSSSENACHVFAELEPEQPGSAVVNFI 406          
BLAST of Tensin 3 vs. Ensembl Celegans
Match: tns-1 (TeNSin homolog [Source:UniProtKB/TrEMBL;Acc:H2L045])

HSP 1 Score: 196.438 bits (498), Expect = 4.275e-54
Identity = 103/278 (37.05%), Postives = 164/278 (58.99%), Query Frame = 1
Query: 1270 LRKSAKIWYQPNMSREEAVKTLKGKPPGSFVVRQSHTFNNSYGLAVNV---PRTSTVEDDDRCVRHFLIESNTKGVRIRGCSNEPYFGSLTALVHQHTLTKLALPCCLILPIXXXXXXXXXXXXXXCNKNNTPKVSSLFAPKTFSALYLGSIDTESLTGAAALSKAVEILLENKT--EVKQTEVSIRISPEGLTLTDVLRKLFFRRHYPLNSISYCGTENSTYWDSAETRSRGF-----AKSKIFGFVARKTGTTENMCHLLCEWHPQDNSRAITNFI 2073
            ++ ++K WY+P +SRE+A+  L+ KPPG+FVVR S++F  ++GLA+ V   P      D    VRHFLIE + KGV+++GC+NEP FGSL+ALV+QH++T LALP  L+LP              +  ++ +   + L      + +Y+GS+D ESLTG   + +++    +     + +   V  ++S +G+TLTD  RK+FFRRH+ + S+ + G +         TR+ GF     A++++F FVAR   ++EN CH+  E  P+    A+ NFI
Sbjct:  292 VKDTSKYWYKPTISREQAINMLRDKPPGTFVVRDSNSFPGAFGLALKVSTPPPGVNPGDGSELVRHFLIEPSPKGVKLKGCNNEPVFGSLSALVYQHSITALALPTKLVLP---------DFDPAATPEHLSATQALLEQGAACNVVYVGSVDVESLTGNECVKRSIATCSQRAINGDSRAVSVHFKVSSQGVTLTDNTRKVFFRRHFNVQSVIFAGMD-PIERRFENTRALGFHDGCIAQARLFAFVARIPSSSENACHVFAELEPEQPGSAVVNFI 559          
BLAST of Tensin 3 vs. Ensembl Celegans
Match: tns-1 (TeNSin homolog [Source:UniProtKB/TrEMBL;Acc:H2L045])

HSP 1 Score: 196.823 bits (499), Expect = 1.856e-52
Identity = 107/283 (37.81%), Postives = 164/283 (57.95%), Query Frame = 1
Query: 1270 LRKSAKIWYQPNMSREEAVKTLKGKPPGSFVVRQSHTFNNSYGLAVNV---PRTSTVEDDDRCVRHFLIESNTKGVRIRGCSNEPYFGSLTALVHQHTLTKLALPCCLILPIXXXXXXXXXXXXXXCNKNNTPKVSS-----LFAPKTFSALYLGSIDTESLTGAAALSKAVEILLENKTEVKQTEVSI--RISPEGLTLTDVLRKLFFRRHYPLNSISYCGTENSTYWDSAETRSRGF-----AKSKIFGFVARKTGTTENMCHLLCEWHPQDNSRAITNFI 2073
            ++ ++K WY+P +SRE+A+  L+ KPPG+FVVR S++F  ++GLA+ V   P      D    VRHFLIE + KGV+++GC+NEP FGSL+ALV+QH++T LALP  L+LP                +   TP+  S     L      + +Y+GS+D ESLTG   + +++    +         VS+  ++S +G+TLTD  RK+FFRRH+ + S+ + G +         TR+ GF     A++++F FVAR   ++EN CH+  E  P+    A+ NFI
Sbjct:  671 VKDTSKYWYKPTISREQAINMLRDKPPGTFVVRDSNSFPGAFGLALKVSTPPPGVNPGDGSELVRHFLIEPSPKGVKLKGCNNEPVFGSLSALVYQHSITALALPTKLVLP--------------DFDPAATPEHLSATQALLEQGAACNVVYVGSVDVESLTGNECVKRSIATCSQRAINGDSRAVSVHFKVSSQGVTLTDNTRKVFFRRHFNVQSVIFAGMD-PIERRFENTRALGFHDGCIAQARLFAFVARIPSSSENACHVFAELEPEQPGSAVVNFI 938          
BLAST of Tensin 3 vs. Ensembl Fly
Match: by (gene:FBgn0000244 transcript:FBtr0302382)

HSP 1 Score: 187.578 bits (475), Expect = 6.198e-50
Identity = 105/274 (38.32%), Postives = 155/274 (56.57%), Query Frame = 1
Query: 1273 RKSAKIWYQPNMSREEAVKTLKGKPPGSFVVRQSHTFNNSYGLAVNVPRTSTVEDDDRCVRHFLIESNTKGVRIRGCSNEPYFGSLTALVHQHTLTKLALPCCLILPIXXXXXXXXXXXXXXCNKNNTPKVSSLFAPKTFS-ALYLGSIDTESLTGAAALSKAVEILLENKTEVKQTEVSIRISPEGLTLTDVLRKLFFRRHYPLNSISYCGTENSTYWDSAETRSRGFAKSKIFGFVARKT-GTTENMCHLLCEWHPQDNSRAITNFISCCVP 2088
            R S++ WY+PN++RE+A+  L    PG+F+VR S T+ +SYGL V V  +         VRHFLIE    GV ++GC +EP F SL+ALV +H++++LALPC L LP  +              +  TP    L A    +  L+L S DTESLTG  A+ KA+  +   +   + TEV  ++S +G+TLTD  RK FFR+HY  + IS+C  +      ++E  S    K  IF FVAR++  +T+N CH+ C+      + AI +F +  +P
Sbjct:  452 RSSSQFWYKPNLTREDAIALLASAQPGTFLVRDSTTYKDSYGLVVRV--SQPPPGSQELVRHFLIEPTKGGVHLKGCDDEPVFTSLSALVFEHSISQLALPCLLRLPDRDIVPPV---------RATTPAQQHLLAHGAATNVLWLYSCDTESLTGNEAIRKAIRQMYGQQPLPQPTEVHFKVSSQGITLTDNTRKKFFRKHYKADVISHCAIDPENRMWTSEGES---DKKTIFAFVARRSHSSTDNQCHVFCDLSVSQPAAAIVSFANRTLP 711          
BLAST of Tensin 3 vs. Ensembl Fly
Match: by (gene:FBgn0000244 transcript:FBtr0082119)

HSP 1 Score: 187.578 bits (475), Expect = 6.198e-50
Identity = 105/274 (38.32%), Postives = 155/274 (56.57%), Query Frame = 1
Query: 1273 RKSAKIWYQPNMSREEAVKTLKGKPPGSFVVRQSHTFNNSYGLAVNVPRTSTVEDDDRCVRHFLIESNTKGVRIRGCSNEPYFGSLTALVHQHTLTKLALPCCLILPIXXXXXXXXXXXXXXCNKNNTPKVSSLFAPKTFS-ALYLGSIDTESLTGAAALSKAVEILLENKTEVKQTEVSIRISPEGLTLTDVLRKLFFRRHYPLNSISYCGTENSTYWDSAETRSRGFAKSKIFGFVARKT-GTTENMCHLLCEWHPQDNSRAITNFISCCVP 2088
            R S++ WY+PN++RE+A+  L    PG+F+VR S T+ +SYGL V V  +         VRHFLIE    GV ++GC +EP F SL+ALV +H++++LALPC L LP  +              +  TP    L A    +  L+L S DTESLTG  A+ KA+  +   +   + TEV  ++S +G+TLTD  RK FFR+HY  + IS+C  +      ++E  S    K  IF FVAR++  +T+N CH+ C+      + AI +F +  +P
Sbjct:  452 RSSSQFWYKPNLTREDAIALLASAQPGTFLVRDSTTYKDSYGLVVRV--SQPPPGSQELVRHFLIEPTKGGVHLKGCDDEPVFTSLSALVFEHSISQLALPCLLRLPDRDIVPPV---------RATTPAQQHLLAHGAATNVLWLYSCDTESLTGNEAIRKAIRQMYGQQPLPQPTEVHFKVSSQGITLTDNTRKKFFRKHYKADVISHCAIDPENRMWTSEGES---DKKTIFAFVARRSHSSTDNQCHVFCDLSVSQPAAAIVSFANRTLP 711          
BLAST of Tensin 3 vs. Ensembl Fly
Match: by (gene:FBgn0000244 transcript:FBtr0301093)

HSP 1 Score: 187.578 bits (475), Expect = 6.198e-50
Identity = 105/274 (38.32%), Postives = 155/274 (56.57%), Query Frame = 1
Query: 1273 RKSAKIWYQPNMSREEAVKTLKGKPPGSFVVRQSHTFNNSYGLAVNVPRTSTVEDDDRCVRHFLIESNTKGVRIRGCSNEPYFGSLTALVHQHTLTKLALPCCLILPIXXXXXXXXXXXXXXCNKNNTPKVSSLFAPKTFS-ALYLGSIDTESLTGAAALSKAVEILLENKTEVKQTEVSIRISPEGLTLTDVLRKLFFRRHYPLNSISYCGTENSTYWDSAETRSRGFAKSKIFGFVARKT-GTTENMCHLLCEWHPQDNSRAITNFISCCVP 2088
            R S++ WY+PN++RE+A+  L    PG+F+VR S T+ +SYGL V V  +         VRHFLIE    GV ++GC +EP F SL+ALV +H++++LALPC L LP  +              +  TP    L A    +  L+L S DTESLTG  A+ KA+  +   +   + TEV  ++S +G+TLTD  RK FFR+HY  + IS+C  +      ++E  S    K  IF FVAR++  +T+N CH+ C+      + AI +F +  +P
Sbjct:  452 RSSSQFWYKPNLTREDAIALLASAQPGTFLVRDSTTYKDSYGLVVRV--SQPPPGSQELVRHFLIEPTKGGVHLKGCDDEPVFTSLSALVFEHSISQLALPCLLRLPDRDIVPPV---------RATTPAQQHLLAHGAATNVLWLYSCDTESLTGNEAIRKAIRQMYGQQPLPQPTEVHFKVSSQGITLTDNTRKKFFRKHYKADVISHCAIDPENRMWTSEGES---DKKTIFAFVARRSHSSTDNQCHVFCDLSVSQPAAAIVSFANRTLP 711          
BLAST of Tensin 3 vs. Ensembl Fly
Match: CG33993 (gene:FBgn0053993 transcript:FBtr0301034)

HSP 1 Score: 63.1586 bits (152), Expect = 1.332e-10
Identity = 36/101 (35.64%), Postives = 55/101 (54.46%), Query Frame = 1
Query: 1291 WYQPNMSREEAVKTLKGKPPGSFVVRQSHTFNNSYGLAVNVPRTSTVEDDDRCVRHFLIESNTKGVRIRGCSNEPYFGSLTALVHQHTLTKLALPCCLILP 1593
            W+Q  + RE +++ L  + PG+F+VRQS T    + L++ VP  S        V H+LI    +G +I+G + E  F SL AL+  H++    LP  L LP
Sbjct:  123 WFQAGIPREISLEALSRQSPGAFLVRQSSTKPGCFALSLRVPPPSPR------VAHYLILRTQRGYKIKGFTKE--FSSLKALITHHSVMPELLPVPLTLP 215          
BLAST of Tensin 3 vs. Ensembl Fly
Match: CG33993 (gene:FBgn0053993 transcript:FBtr0100046)

HSP 1 Score: 63.5438 bits (153), Expect = 2.923e-10
Identity = 36/101 (35.64%), Postives = 55/101 (54.46%), Query Frame = 1
Query: 1291 WYQPNMSREEAVKTLKGKPPGSFVVRQSHTFNNSYGLAVNVPRTSTVEDDDRCVRHFLIESNTKGVRIRGCSNEPYFGSLTALVHQHTLTKLALPCCLILP 1593
            W+Q  + RE +++ L  + PG+F+VRQS T    + L++ VP  S        V H+LI    +G +I+G + E  F SL AL+  H++    LP  L LP
Sbjct:  286 WFQAGIPREISLEALSRQSPGAFLVRQSSTKPGCFALSLRVPPPSPR------VAHYLILRTQRGYKIKGFTKE--FSSLKALITHHSVMPELLPVPLTLP 378          
BLAST of Tensin 3 vs. Ensembl Zebrafish
Match: tns3.2 (tensin 3, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-081031-95])

HSP 1 Score: 223.016 bits (567), Expect = 1.739e-61
Identity = 122/286 (42.66%), Postives = 175/286 (61.19%), Query Frame = 1
Query: 1270 LRKSAKIWYQPNMSREEAVKTLKGKPPGSFVVRQSHTFNNSYGLAVNVP-------RTSTVEDD--DRCVRHFLIESNTKGVRIRGCSNEPYFGSLTALVHQHTLTKLALPCCLILPIXXXXXXXXXXXXXXCNKNNTPKVSSLFAPKTFSALYLGSIDTESLTGAAALSKAVEILLENKTEVKQTEVSIRISPEGLTLTDVLRKLFFRRHYPLNSISYCGTE-NSTYWDSAETRSRGFAKSKIFGFVARKTG-TTENMCHLLCEWHPQDNSRAITNFISCCVPGT 2094
            ++ ++K WY+P++SRE+A+  LK K PGSF++R SH+F  +YGLA+ V        +TS    D  +  VRHFLIE   KGVR++GC NEPYFGSLTALV QH++T LALPC LI+P S   L++   S    + N+  ++  L      +  +LGS+D ESLTG   + KA  +          T V  ++S +G+TLTD  RKLFFRRHY ++++ +C  +     W     +  G   +KIFGF+ARK+G +TEN+CHL  E  P+  + AI NF+S  + G+
Sbjct:  575 VQDTSKFWYKPDISREQAISVLKDKEPGSFIIRDSHSFRGAYGLAMKVATPPPTVLQTSRKVGDLSNELVRHFLIECTPKGVRLKGCPNEPYFGSLTALVCQHSITPLALPCRLIIP-SRDPLEEFNESPTQTSTNSAAEL--LKQGAACNVWFLGSVDLESLTGVQGVQKATTVTFNKDPPPTSTVVHFKVSAQGITLTDNQRKLFFRRHYAVSTVIFCALDPQDRKW-----KRDGCTAAKIFGFIARKSGSSTENVCHLFAEHDPEQPASAIVNFVSKVMIGS 852          
BLAST of Tensin 3 vs. Ensembl Zebrafish
Match: tns1b (tensin 1b [Source:ZFIN;Acc:ZDB-GENE-030131-6933])

HSP 1 Score: 220.705 bits (561), Expect = 2.199e-61
Identity = 113/284 (39.79%), Postives = 168/284 (59.15%), Query Frame = 1
Query: 1270 LRKSAKIWYQPNMSREEAVKTLKGKPPGSFVVRQSHTFNNSYGLAVNV--------PRTSTVEDDDRCVRHFLIESNTKGVRIRGCSNEPYFGSLTALVHQHTLTKLALPCCLILPI-----XXXXXXXXXXXXXXCNKNNTPKVSSLFAPKTFSALYLGSIDTESLTGAAALSKAVEILLENKTEVKQTEVSIRISPEGLTLTDVLRKLFFRRHYPLNSISYCGTE-NSTYWDSAETRSRGFAKSKIFGFVARKTG-TTENMCHLLCEWHPQDNSRAITNFIS 2076
            ++ ++K WY+P++SR++A+  LK + PG+FV+R SH+F  +YGLA+ V        P     +  +  VRHFLIE++ KGVR++GC NEPYFG L+ALV+QH++T LALPC L++P         ++    +      K    + SS       + LY+ S+D ESLTG  A++KA+   +        T V  ++S +G+TLTD  RKLFFRRHYP+ ++++C  +     W+  E        +K FGFVARK G TT+N+ HL  E  P   + AI NF+S
Sbjct:  436 VQDTSKFWYKPDISRDQAINMLKDQDPGAFVIRDSHSFRGAYGLAMKVASPPPTTQPTKKAGDVTNELVRHFLIETSPKGVRLKGCPNEPYFGCLSALVYQHSITPLALPCKLVIPTRDPLEESPEIATPTNPAADMLKQGAGQKSSADG-HACNVLYINSVDMESLTGPQAIAKAISETMNASPAPSATIVHFKVSAQGITLTDNQRKLFFRRHYPIGTVTFCDIDPQERKWNKPEG-----GTAKFFGFVARKQGSTTDNVSHLFAEMDPDQPATAIVNFVS 713          
BLAST of Tensin 3 vs. Ensembl Zebrafish
Match: tns1b (tensin 1b [Source:ZFIN;Acc:ZDB-GENE-030131-6933])

HSP 1 Score: 223.787 bits (569), Expect = 1.113e-60
Identity = 112/279 (40.14%), Postives = 167/279 (59.86%), Query Frame = 1
Query: 1270 LRKSAKIWYQPNMSREEAVKTLKGKPPGSFVVRQSHTFNNSYGLAVNV--------PRTSTVEDDDRCVRHFLIESNTKGVRIRGCSNEPYFGSLTALVHQHTLTKLALPCCLILPIXXXXXXXXXXXXXXCNKNNTPKVSSLFAPKTFSALYLGSIDTESLTGAAALSKAVEILLENKTEVKQTEVSIRISPEGLTLTDVLRKLFFRRHYPLNSISYCGTE-NSTYWDSAETRSRGFAKSKIFGFVARKTG-TTENMCHLLCEWHPQDNSRAITNFIS 2076
            ++ ++K WY+P++SR++A+  LK + PG+FV+R SH+F  +YGLA+ V        P     +  +  VRHFLIE++ KGVR++GC NEPYFG L+ALV+QH++T LALPC L++P  +   +  + +         P    L      + LY+ S+D ESLTG  A++KA+   +        T V  ++S +G+TLTD  RKLFFRRHYP+ ++++C  +     W+  E        +K FGFVARK G TT+N+ HL  E  P   + AI NF+S
Sbjct: 1430 VQDTSKFWYKPDISRDQAINMLKDQDPGAFVIRDSHSFRGAYGLAMKVASPPPTTQPTKKAGDVTNELVRHFLIETSPKGVRLKGCPNEPYFGCLSALVYQHSITPLALPCKLVIPTRDPLEESPEIATP-----TNPAADMLKQGAACNVLYINSVDMESLTGPQAIAKAISETMNASPAPSATIVHFKVSAQGITLTDNQRKLFFRRHYPIGTVTFCDIDPQERKWNKPEG-----GTAKFFGFVARKQGSTTDNVSHLFAEMDPDQPATAIVNFVS 1698          
BLAST of Tensin 3 vs. Ensembl Zebrafish
Match: tns1a (tensin 1a [Source:ZFIN;Acc:ZDB-GENE-120215-32])

HSP 1 Score: 219.164 bits (557), Expect = 3.700e-59
Identity = 117/286 (40.91%), Postives = 179/286 (62.59%), Query Frame = 1
Query: 1270 LRKSAKIWYQPNMSREEAVKTLKGKPPGSFVVRQSHTFNNSYGLAVNVPRTS-TVEDDDRC-------VRHFLIESNTKGVRIRGCSNEPYFGSLTALVHQHTLTKLALPCCLILPIXXXXXXXXXXXXXXCNKNN-------TPKVSSLFAPKTFSALYLGSIDTESLTGAAALSKAVEILLENKTEVKQTEVSIRISPEGLTLTDVLRKLFFRRHYPLNSISYCGTE-NSTYWDSAETRSRGFAKSKIFGFVARKTG-TTENMCHLLCEWHPQDNSRAITNFIS 2076
            ++ ++K WY+P ++RE+A+  LK + PG+FV+R S++F  +YGLA+ V     TV+ + +        VRHFLIE++ KGVR++GC NEPYFG L+ALV+QH +T LALPC L++P  + + +  + +  + +  +        PK +  F     + LY+ S+D ESLTG  A++KA+   L  K+    T V  ++S +G+TLTD  RK+FFRRHYP+N I+YC  +     W+ AE        +K+FGFVARK G TT+N+ HL  E  P +++ AI +F+S
Sbjct: 1391 VQDTSKYWYKPEITREQAICILKDREPGAFVIRDSNSFRGAYGLAMKVASPPPTVQQNKKVGDITNELVRHFLIETSAKGVRLKGCPNEPYFGCLSALVYQHAITPLALPCKLMIPTRDPNEEALELATPTSSTMDLLKQGAGPPKPTEDF--YACNVLYINSVDMESLTGPQAVAKAITETLAAKSTPTATIVQFKVSTQGITLTDNQRKVFFRRHYPINLITYCNMDPQERKWNKAEG-----GVAKLFGFVARKQGSTTDNVSHLFAELEPDNSASAIVSFVS 1669          
BLAST of Tensin 3 vs. Ensembl Zebrafish
Match: tns1a (tensin 1a [Source:ZFIN;Acc:ZDB-GENE-120215-32])

HSP 1 Score: 219.164 bits (557), Expect = 3.908e-59
Identity = 117/286 (40.91%), Postives = 179/286 (62.59%), Query Frame = 1
Query: 1270 LRKSAKIWYQPNMSREEAVKTLKGKPPGSFVVRQSHTFNNSYGLAVNVPRTS-TVEDDDRC-------VRHFLIESNTKGVRIRGCSNEPYFGSLTALVHQHTLTKLALPCCLILPIXXXXXXXXXXXXXXCNKNN-------TPKVSSLFAPKTFSALYLGSIDTESLTGAAALSKAVEILLENKTEVKQTEVSIRISPEGLTLTDVLRKLFFRRHYPLNSISYCGTE-NSTYWDSAETRSRGFAKSKIFGFVARKTG-TTENMCHLLCEWHPQDNSRAITNFIS 2076
            ++ ++K WY+P ++RE+A+  LK + PG+FV+R S++F  +YGLA+ V     TV+ + +        VRHFLIE++ KGVR++GC NEPYFG L+ALV+QH +T LALPC L++P  + + +  + +  + +  +        PK +  F     + LY+ S+D ESLTG  A++KA+   L  K+    T V  ++S +G+TLTD  RK+FFRRHYP+N I+YC  +     W+ AE        +K+FGFVARK G TT+N+ HL  E  P +++ AI +F+S
Sbjct: 1365 VQDTSKYWYKPEITREQAICILKDREPGAFVIRDSNSFRGAYGLAMKVASPPPTVQQNKKVGDITNELVRHFLIETSAKGVRLKGCPNEPYFGCLSALVYQHAITPLALPCKLMIPTRDPNEEALELATPTSSTMDLLKQGAGPPKPTEDF--YACNVLYINSVDMESLTGPQAVAKAITETLAAKSTPTATIVQFKVSTQGITLTDNQRKVFFRRHYPINLITYCNMDPQERKWNKAEG-----GVAKLFGFVARKQGSTTDNVSHLFAELEPDNSASAIVSFVS 1643          
BLAST of Tensin 3 vs. Ensembl Xenopus
Match: adamts12 (ADAM metallopeptidase with thrombospondin type 1 motif 12 [Source:Xenbase;Acc:XB-GENE-959575])

HSP 1 Score: 224.172 bits (570), Expect = 8.579e-61
Identity = 113/282 (40.07%), Postives = 177/282 (62.77%), Query Frame = 1
Query: 1270 LRKSAKIWYQPNMSREEAVKTLKGKPPGSFVVRQSHTFNNSYGLAV-------NVPRTSTVED-DDRCVRHFLIESNTKGVRIRGCSNEPYFGSLTALVHQHTLTKLALPCCLILPIXXXXXXXXXXXXXXCNKNNTPKVSSLFAPKTFSALYLGSIDTESLTGAAALSKAVEILLENKTEVKQTEVSIRISPEGLTLTDVLRKLFFRRHYPLNSISYCGTE-NSTYWDSAETRSRGFAKSKIFGFVARKTG-TTENMCHLLCEWHPQDNSRAITNFISCCV 2085
            ++ ++K WY+P++SR++A+  LK K PG+F++R SH+F  +YGLA+       N  + S   D  +  VRHFLIE++ +GV+++GC NEPYFG L+ALV+QH++T LALPC L++P  +   + ++++  + + ++  K  +       + L++ SID ESLTG  A++K +   L          V  ++S +G+TLTD  RKLFFRRHYPL+S+++C  +     W  A+       ++K+FGFVARK G TT+NMCHL  E  P   + AI NF+S  +
Sbjct: 1023 VQDTSKYWYKPDISRDQAISLLKDKDPGAFIIRDSHSFRGAYGLAMKVATPPPNAGQPSKKGDVTNELVRHFLIETSPRGVKLKGCQNEPYFGCLSALVYQHSITPLALPCKLVIPCRDPSDETKETAVPANSASDLLKQGA-----ACNVLFINSIDMESLTGPQAIAKTIAESLAADPPPAAAIVHFKVSAQGITLTDNQRKLFFRRHYPLSSVTFCDLDPQERKWMKADG-----TQAKLFGFVARKQGSTTDNMCHLFAELDPNQPATAIVNFVSRVI 1294          
BLAST of Tensin 3 vs. Ensembl Xenopus
Match: TNS3 (tensin 3 [Source:NCBI gene;Acc:100492216])

HSP 1 Score: 222.631 bits (566), Expect = 3.317e-60
Identity = 134/369 (36.31%), Postives = 207/369 (56.10%), Query Frame = 1
Query: 1045 QSPSEQQANNKI---PPLPNQRRVQHVHHRSDEMSNQNSSNISDRELDSLIGVQDPHNARSYNATVKSANHQNSQNSSLRKSAKIWYQPNMSREEAVKTLKGKPPGSFVVRQSHTFNNSYGLAVNV--PRTSTVEDDDR-------CVRHFLIESNTKGVRIRGCSNEPYFGSLTALVHQHTLTKLALPCCLILPIXXXXXXXXXXXXXXCNKNNTPKVSSLFAPKTF------SALYLGSIDTESLTGAAALSKAVEILLENKTEVKQTEVSIRISPEGLTLTDVLRKLFFRRHYPLNSISYCGTE-NSTYWDSAETRSRGFAKSKIFGFVARKTGTTENMCHLLCEWHPQDNSRAITNFISCCVPGT 2094
            +SP  Q++  K    PPLP ++R+    H    +S  +S   S     + I +  P+    ++  +K+++ ++     ++ ++K WY+P++SR++A+  LK K PGSF+VR SH+F  +YGLA+ V  P  S +    +        VRHFLIE   KGVR++GC NEPYFGSLTALV+QH++T LALPC L++P  +   +   +         TP+ ++  A +        +  YL S++ ESLTG  A+ KA+ I    +     T V  ++S +G+TLTD  RKLFFRRHYP+N++ +C  +     W      +R    +K+FGFVARK     N+CHL  E  P+  + AI NF+S  + G+
Sbjct:  946 RSPFLQRSGKKKYSHPPLPEKKRISEGEHSFGSISPSSSGFSSPNSGST-ISIPFPNVLPDFSQVLKNSSDKHMTVKFVQDTSKFWYKPDISRDQAIAVLKDKEPGSFIVRDSHSFKGAYGLAMKVATPPPSVLHSSKKGLDLTNELVRHFLIECVHKGVRLKGCPNEPYFGSLTALVYQHSITPLALPCKLLIPDKDPLEEIPAA---------TPQSAANSAAELLKQGAACNVWYLNSVEMESLTGYQAVQKALSITQLQEPPPISTVVHFKVSAQGITLTDNQRKLFFRRHYPVNTVIFCALDPQDRKW------TRDGLSAKVFGFVARKGAGNHNICHLFAEHDPEQPASAIVNFVSKVMIGS 1298          
BLAST of Tensin 3 vs. Ensembl Xenopus
Match: adamts12 (ADAM metallopeptidase with thrombospondin type 1 motif 12 [Source:Xenbase;Acc:XB-GENE-959575])

HSP 1 Score: 221.861 bits (564), Expect = 6.294e-60
Identity = 111/279 (39.78%), Postives = 175/279 (62.72%), Query Frame = 1
Query: 1270 LRKSAKIWYQPNMSREEAVKTLKGKPPGSFVVRQSHTFNNSYGLAVNVPR--------TSTVEDDDRCVRHFLIESNTKGVRIRGCSNEPYFGSLTALVHQHTLTKLALPCCLILPIXXXXXXXXXXXXXXCNKNNTPKVSSLFAPKTFSALYLGSIDTESLTGAAALSKAVEILLENKTEVKQTEVSIRISPEGLTLTDVLRKLFFRRHYPLNSISYCGTE-NSTYWDSAETRSRGFAKSKIFGFVARKTG-TTENMCHLLCEWHPQDNSRAITNFIS 2076
            ++ ++K WY+P++SR++A+  LK K PG+F++R SH+F  +YGLA+ V          +   +  +  VRHFLIE++ +GV+++GC NEPYFG L+ALV+QH++T LALPC L++P  +   + ++++  + + ++  K  +       + L++ SID ESLTG  A++K +   L          V  ++S +G+TLTD  RKLFFRRHYPL+S+++C  +     W  A+       ++K+FGFVARK G TT+NMCHL  E  P   + AI NF+S
Sbjct: 1374 VQDTSKYWYKPDISRDQAISLLKDKDPGAFIIRDSHSFRGAYGLAMKVATPPPNAGQPSKKGDVTNELVRHFLIETSPRGVKLKGCQNEPYFGCLSALVYQHSITPLALPCKLVIPCRDPSDETKETAVPANSASDLLKQGA-----ACNVLFINSIDMESLTGPQAIAKTIAESLAADPPPAAAIVHFKVSAQGITLTDNQRKLFFRRHYPLSSVTFCDLDPQERKWMKADG-----TQAKLFGFVARKQGSTTDNMCHLFAELDPNQPATAIVNFVS 1642          
BLAST of Tensin 3 vs. Ensembl Xenopus
Match: adamts12 (ADAM metallopeptidase with thrombospondin type 1 motif 12 [Source:Xenbase;Acc:XB-GENE-959575])

HSP 1 Score: 221.861 bits (564), Expect = 6.478e-60
Identity = 111/279 (39.78%), Postives = 175/279 (62.72%), Query Frame = 1
Query: 1270 LRKSAKIWYQPNMSREEAVKTLKGKPPGSFVVRQSHTFNNSYGLAVNVPR--------TSTVEDDDRCVRHFLIESNTKGVRIRGCSNEPYFGSLTALVHQHTLTKLALPCCLILPIXXXXXXXXXXXXXXCNKNNTPKVSSLFAPKTFSALYLGSIDTESLTGAAALSKAVEILLENKTEVKQTEVSIRISPEGLTLTDVLRKLFFRRHYPLNSISYCGTE-NSTYWDSAETRSRGFAKSKIFGFVARKTG-TTENMCHLLCEWHPQDNSRAITNFIS 2076
            ++ ++K WY+P++SR++A+  LK K PG+F++R SH+F  +YGLA+ V          +   +  +  VRHFLIE++ +GV+++GC NEPYFG L+ALV+QH++T LALPC L++P  +   + ++++  + + ++  K  +       + L++ SID ESLTG  A++K +   L          V  ++S +G+TLTD  RKLFFRRHYPL+S+++C  +     W  A+       ++K+FGFVARK G TT+NMCHL  E  P   + AI NF+S
Sbjct: 1353 VQDTSKYWYKPDISRDQAISLLKDKDPGAFIIRDSHSFRGAYGLAMKVATPPPNAGQPSKKGDVTNELVRHFLIETSPRGVKLKGCQNEPYFGCLSALVYQHSITPLALPCKLVIPCRDPSDETKETAVPANSASDLLKQGA-----ACNVLFINSIDMESLTGPQAIAKTIAESLAADPPPAAAIVHFKVSAQGITLTDNQRKLFFRRHYPLSSVTFCDLDPQERKWMKADG-----TQAKLFGFVARKQGSTTDNMCHLFAELDPNQPATAIVNFVS 1621          
BLAST of Tensin 3 vs. Ensembl Xenopus
Match: adamts12 (ADAM metallopeptidase with thrombospondin type 1 motif 12 [Source:Xenbase;Acc:XB-GENE-959575])

HSP 1 Score: 220.705 bits (561), Expect = 1.514e-59
Identity = 111/279 (39.78%), Postives = 175/279 (62.72%), Query Frame = 1
Query: 1270 LRKSAKIWYQPNMSREEAVKTLKGKPPGSFVVRQSHTFNNSYGLAVNVPR--------TSTVEDDDRCVRHFLIESNTKGVRIRGCSNEPYFGSLTALVHQHTLTKLALPCCLILPIXXXXXXXXXXXXXXCNKNNTPKVSSLFAPKTFSALYLGSIDTESLTGAAALSKAVEILLENKTEVKQTEVSIRISPEGLTLTDVLRKLFFRRHYPLNSISYCGTE-NSTYWDSAETRSRGFAKSKIFGFVARKTG-TTENMCHLLCEWHPQDNSRAITNFIS 2076
            ++ ++K WY+P++SR++A+  LK K PG+F++R SH+F  +YGLA+ V          +   +  +  VRHFLIE++ +GV+++GC NEPYFG L+ALV+QH++T LALPC L++P  +   + ++++  + + ++  K  +       + L++ SID ESLTG  A++K +   L          V  ++S +G+TLTD  RKLFFRRHYPL+S+++C  +     W  A+       ++K+FGFVARK G TT+NMCHL  E  P   + AI NF+S
Sbjct: 1436 VQDTSKYWYKPDISRDQAISLLKDKDPGAFIIRDSHSFRGAYGLAMKVATPPPNAGQPSKKGDVTNELVRHFLIETSPRGVKLKGCQNEPYFGCLSALVYQHSITPLALPCKLVIPCRDPSDETKETAVPANSASDLLKQGA-----ACNVLFINSIDMESLTGPQAIAKTIAESLAADPPPAAAIVHFKVSAQGITLTDNQRKLFFRRHYPLSSVTFCDLDPQERKWMKADG-----TQAKLFGFVARKQGSTTDNMCHLFAELDPNQPATAIVNFVS 1704          
BLAST of Tensin 3 vs. Ensembl Mouse
Match: Tns1 (tensin 1 [Source:MGI Symbol;Acc:MGI:104552])

HSP 1 Score: 223.787 bits (569), Expect = 3.259e-63
Identity = 136/375 (36.27%), Postives = 208/375 (55.47%), Query Frame = 1
Query: 1015 YPIVSRLTLSQSPSEQ--QANNKIPPLPNQRRVQHVHHRSDEMSNQNSSNISDRELDSLIGVQDPHNARSYNATVKSANHQNSQNSS---------LRKSAKIWYQPNMSREEAVKTLKGKPPGSFVVRQSHTFNNSYGLAVNV---PRTSTVEDDD-----RCVRHFLIESNTKGVRIRGCSNEPYFGSLTALVHQHTLTKLALPCCLILPIXXXXXXXXXXXXXXCNKNNTPKVSSLFAPKTFSALYLGSIDTESLTGAAALSKAVEILLENKTEVKQTEVSIRISPEGLTLTDVLRKLFFRRHYPLNSISYCGTE-NSTYWDSAETRSRGFAKSKIFGFVARKTG-TTENMCHLLCEWHPQDNSRAITNFIS 2076
            YP +S    S SP     +  +  P LP +RR+  V  R+  + N  + N          G+    +  S++ T+   +  +  ++S         ++ ++K WY+P +SRE+A+  LK + PG+F++R SH+F  +YGLA+ V   P T T +          VRHFLIE+  +GV+++GC NEP FGSL+ALV+QH++  LALPC L++P  +   + + SS  + +  +  K  +       + L++ S+D ESLTG  A+SKA    L        T V  ++S +G+TLTD  RKLFFRRHYPLN++++C  +     W     ++ G A +K+FGFVARK G TT+N CHL  E  P   + AI NF+S
Sbjct:  250 YPGLSSPATSPSPDSAAFRQGSPTPALPEKRRMS-VGDRAGSLPNYATINGKVSSSPVANGMASGSSTVSFSHTLPDFSKYSMPDNSPETRAKVKFVQDTSKYWYKPEISREQAIALLKDQEPGAFIIRDSHSFRGAYGLAMKVSSPPPTITQQGKKGDMTHELVRHFLIETGPRGVKLKGCPNEPNFGSLSALVYQHSVIPLALPCKLVIPSRDPTDESKDSSGPANSTTDLLKQGA-----ACNVLFVNSVDMESLTGPQAISKATSETLAADPTPAATIVHFKVSAQGITLTDNQRKLFFRRHYPLNTVTFCDLDPQERKW----MKTEGGAPAKLFGFVARKQGSTTDNACHLFAELDPNQPASAIVNFVS 614          
BLAST of Tensin 3 vs. Ensembl Mouse
Match: Tns1 (tensin 1 [Source:MGI Symbol;Acc:MGI:104552])

HSP 1 Score: 223.016 bits (567), Expect = 2.029e-60
Identity = 136/374 (36.36%), Postives = 208/374 (55.61%), Query Frame = 1
Query: 1015 YPIVSRLTLSQSPSEQ--QANNKIPPLPNQRRVQHVHHRSDEMSNQNSSNISDRELDSLIGVQDPHNARSYNATVKSANHQNSQNSS---------LRKSAKIWYQPNMSREEAVKTLKGKPPGSFVVRQSHTFNNSYGLAVNV---PRTSTVEDDD----RCVRHFLIESNTKGVRIRGCSNEPYFGSLTALVHQHTLTKLALPCCLILPIXXXXXXXXXXXXXXCNKNNTPKVSSLFAPKTFSALYLGSIDTESLTGAAALSKAVEILLENKTEVKQTEVSIRISPEGLTLTDVLRKLFFRRHYPLNSISYCGTE-NSTYWDSAETRSRGFAKSKIFGFVARKTG-TTENMCHLLCEWHPQDNSRAITNFIS 2076
            YP +S    S SP     +  +  P LP +RR+  V  R+  + N  + N          G+    +  S++ T+   +  +  ++S         ++ ++K WY+P +SRE+A+  LK + PG+F++R SH+F  +YGLA+ V   P T T +         VRHFLIE+  +GV+++GC NEP FGSL+ALV+QH++  LALPC L++P  +   + + SS  + +  +  K  +       + L++ S+D ESLTG  A+SKA    L        T V  ++S +G+TLTD  RKLFFRRHYPLN++++C  +     W     ++ G A +K+FGFVARK G TT+N CHL  E  P   + AI NF+S
Sbjct: 1332 YPGLSSPATSPSPDSAAFRQGSPTPALPEKRRMS-VGDRAGSLPNYATINGKVSSSPVANGMASGSSTVSFSHTLPDFSKYSMPDNSPETRAKVKFVQDTSKYWYKPEISREQAIALLKDQEPGAFIIRDSHSFRGAYGLAMKVSSPPPTITQQGKKDMTHELVRHFLIETGPRGVKLKGCPNEPNFGSLSALVYQHSVIPLALPCKLVIPSRDPTDESKDSSGPANSTTDLLKQGA-----ACNVLFVNSVDMESLTGPQAISKATSETLAADPTPAATIVHFKVSAQGITLTDNQRKLFFRRHYPLNTVTFCDLDPQERKW----MKTEGGAPAKLFGFVARKQGSTTDNACHLFAELDPNQPASAIVNFVS 1695          
BLAST of Tensin 3 vs. Ensembl Mouse
Match: Tns1 (tensin 1 [Source:MGI Symbol;Acc:MGI:104552])

HSP 1 Score: 222.631 bits (566), Expect = 2.406e-60
Identity = 136/375 (36.27%), Postives = 208/375 (55.47%), Query Frame = 1
Query: 1015 YPIVSRLTLSQSPSEQ--QANNKIPPLPNQRRVQHVHHRSDEMSNQNSSNISDRELDSLIGVQDPHNARSYNATVKSANHQNSQNSS---------LRKSAKIWYQPNMSREEAVKTLKGKPPGSFVVRQSHTFNNSYGLAVNV---PRTSTVEDDD-----RCVRHFLIESNTKGVRIRGCSNEPYFGSLTALVHQHTLTKLALPCCLILPIXXXXXXXXXXXXXXCNKNNTPKVSSLFAPKTFSALYLGSIDTESLTGAAALSKAVEILLENKTEVKQTEVSIRISPEGLTLTDVLRKLFFRRHYPLNSISYCGTE-NSTYWDSAETRSRGFAKSKIFGFVARKTG-TTENMCHLLCEWHPQDNSRAITNFIS 2076
            YP +S    S SP     +  +  P LP +RR+  V  R+  + N  + N          G+    +  S++ T+   +  +  ++S         ++ ++K WY+P +SRE+A+  LK + PG+F++R SH+F  +YGLA+ V   P T T +          VRHFLIE+  +GV+++GC NEP FGSL+ALV+QH++  LALPC L++P  +   + + SS  + +  +  K  +       + L++ S+D ESLTG  A+SKA    L        T V  ++S +G+TLTD  RKLFFRRHYPLN++++C  +     W     ++ G A +K+FGFVARK G TT+N CHL  E  P   + AI NF+S
Sbjct: 1345 YPGLSSPATSPSPDSAAFRQGSPTPALPEKRRMS-VGDRAGSLPNYATINGKVSSSPVANGMASGSSTVSFSHTLPDFSKYSMPDNSPETRAKVKFVQDTSKYWYKPEISREQAIALLKDQEPGAFIIRDSHSFRGAYGLAMKVSSPPPTITQQGKKGDMTHELVRHFLIETGPRGVKLKGCPNEPNFGSLSALVYQHSVIPLALPCKLVIPSRDPTDESKDSSGPANSTTDLLKQGA-----ACNVLFVNSVDMESLTGPQAISKATSETLAADPTPAATIVHFKVSAQGITLTDNQRKLFFRRHYPLNTVTFCDLDPQERKW----MKTEGGAPAKLFGFVARKQGSTTDNACHLFAELDPNQPASAIVNFVS 1709          
BLAST of Tensin 3 vs. Ensembl Mouse
Match: Tns1 (tensin 1 [Source:MGI Symbol;Acc:MGI:104552])

HSP 1 Score: 222.246 bits (565), Expect = 3.844e-60
Identity = 136/375 (36.27%), Postives = 208/375 (55.47%), Query Frame = 1
Query: 1015 YPIVSRLTLSQSPSEQ--QANNKIPPLPNQRRVQHVHHRSDEMSNQNSSNISDRELDSLIGVQDPHNARSYNATVKSANHQNSQNSS---------LRKSAKIWYQPNMSREEAVKTLKGKPPGSFVVRQSHTFNNSYGLAVNV---PRTSTVEDDD-----RCVRHFLIESNTKGVRIRGCSNEPYFGSLTALVHQHTLTKLALPCCLILPIXXXXXXXXXXXXXXCNKNNTPKVSSLFAPKTFSALYLGSIDTESLTGAAALSKAVEILLENKTEVKQTEVSIRISPEGLTLTDVLRKLFFRRHYPLNSISYCGTE-NSTYWDSAETRSRGFAKSKIFGFVARKTG-TTENMCHLLCEWHPQDNSRAITNFIS 2076
            YP +S    S SP     +  +  P LP +RR+  V  R+  + N  + N          G+    +  S++ T+   +  +  ++S         ++ ++K WY+P +SRE+A+  LK + PG+F++R SH+F  +YGLA+ V   P T T +          VRHFLIE+  +GV+++GC NEP FGSL+ALV+QH++  LALPC L++P  +   + + SS  + +  +  K  +       + L++ S+D ESLTG  A+SKA    L        T V  ++S +G+TLTD  RKLFFRRHYPLN++++C  +     W     ++ G A +K+FGFVARK G TT+N CHL  E  P   + AI NF+S
Sbjct: 1493 YPGLSSPATSPSPDSAAFRQGSPTPALPEKRRMS-VGDRAGSLPNYATINGKVSSSPVANGMASGSSTVSFSHTLPDFSKYSMPDNSPETRAKVKFVQDTSKYWYKPEISREQAIALLKDQEPGAFIIRDSHSFRGAYGLAMKVSSPPPTITQQGKKGDMTHELVRHFLIETGPRGVKLKGCPNEPNFGSLSALVYQHSVIPLALPCKLVIPSRDPTDESKDSSGPANSTTDLLKQGA-----ACNVLFVNSVDMESLTGPQAISKATSETLAADPTPAATIVHFKVSAQGITLTDNQRKLFFRRHYPLNTVTFCDLDPQERKW----MKTEGGAPAKLFGFVARKQGSTTDNACHLFAELDPNQPASAIVNFVS 1857          
BLAST of Tensin 3 vs. Ensembl Mouse
Match: Tns1 (tensin 1 [Source:MGI Symbol;Acc:MGI:104552])

HSP 1 Score: 221.861 bits (564), Expect = 4.563e-60
Identity = 137/375 (36.53%), Postives = 206/375 (54.93%), Query Frame = 1
Query: 1015 YPIVSRLTLSQSPSEQ--QANNKIPPLPNQRRVQHVHHRSDEMSNQNSSNISDRELDSLIGVQDPHNARSYNATVKSANHQNSQNSSLRKSAKI---------WYQPNMSREEAVKTLKGKPPGSFVVRQSHTFNNSYGLAVNV---PRTSTVEDDD-----RCVRHFLIESNTKGVRIRGCSNEPYFGSLTALVHQHTLTKLALPCCLILPIXXXXXXXXXXXXXXCNKNNTPKVSSLFAPKTFSALYLGSIDTESLTGAAALSKAVEILLENKTEVKQTEVSIRISPEGLTLTDVLRKLFFRRHYPLNSISYCGTE-NSTYWDSAETRSRGFAKSKIFGFVARKTG-TTENMCHLLCEWHPQDNSRAITNFIS 2076
            YP +S    S SP     +  +  P LP +RR+  V  R+  + N  + N          G+    +  S++ T+   +  +  ++S    AK+         WY+P +SRE+A+  LK + PG+F++R SH+F  +YGLA+ V   P T T +          VRHFLIE+  +GV+++GC NEP FGSL+ALV+QH++  LALPC L++P  +   + + SS  + +  +  K  +       + L++ S+D ESLTG  A+SKA    L        T V  ++S +G+TLTD  RKLFFRRHYPLN++++C  +     W     ++ G A +K+FGFVARK G TT+N CHL  E  P   + AI NF+S
Sbjct: 1514 YPGLSSPATSPSPDSAAFRQGSPTPALPEKRRMS-VGDRAGSLPNYATINGKVSSSPVANGMASGSSTVSFSHTLPDFSKYSMPDNSPETRAKVKFVQDTSKYWYKPEISREQAIALLKDQEPGAFIIRDSHSFRGAYGLAMKVSSPPPTITQQGKKGDMTHELVRHFLIETGPRGVKLKGCPNEPNFGSLSALVYQHSVIPLALPCKLVIPSRDPTDESKDSSGPANSTTDLLKQGA-----ACNVLFVNSVDMESLTGPQAISKATSETLAADPTPAATIVHFKVSAQGITLTDNQRKLFFRRHYPLNTVTFCDLDPQERKW----MKTEGGAPAKLFGFVARKQGSTTDNACHLFAELDPNQPASAIVNFVS 1878          
BLAST of Tensin 3 vs. UniProt/SwissProt
Match: sp|Q04205|TENS_CHICK (Tensin OS=Gallus gallus OX=9031 GN=TNS PE=1 SV=2)

HSP 1 Score: 223.402 bits (568), Expect = 1.101e-59
Identity = 115/286 (40.21%), Postives = 184/286 (64.34%), Query Frame = 1
Query: 1270 LRKSAKIWYQPNMSREEAVKTLKGKPPGSFVVRQSHTFNNSYGLAVNV--PRTSTVEDDDR------CVRHFLIESNTKGVRIRGCSNEPYFGSLTALVHQHTLTKLALPCCLILPIXXXXXXXXXXXXXXCNKNNTPKVSSLFAPKTFSALYLGSIDTESLTGAAALSKAV-EILLENKTEVKQTEVSIRISPEGLTLTDVLRKLFFRRHYPLNSISYCGTE-NSTYWDSAETRSRGFAKSKIFGFVARKTG-TTENMCHLLCEWHPQDNSRAITNFISCCVPGT 2094
            ++ ++K WY+P++SRE+A+  LK + PG+F++R SH+F  +YGLA+ V  P  + ++ + +       VRHFLIE++ +GV+++GC NEP FG L+ALV+QH++  LALPC L++P  +   + + ++  + +  +  K  +       + L++ S++ ESLTG  A+SKAV E L+ + T    T V  ++S +G+TLTD  RKLFFRRHYPLN++++C  +     W    T++ G   +K+FGFVARK G TT+N+CHL  E  P   + AI NF+S  + G+
Sbjct: 1465 VQDTSKYWYKPDISREQAIALLKDREPGAFIIRDSHSFRGAYGLAMKVASPPPTVMQQNKKGDITNELVRHFLIETSPRGVKLKGCPNEPNFGCLSALVYQHSIMPLALPCKLVIPDRDPMEEKKDAASTTNSATDLLKQGA-----ACNVLFINSVEMESLTGPQAISKAVAETLVADPTPTA-TIVHFKVSAQGITLTDNQRKLFFRRHYPLNTVTFCDLDPQERKW----TKTDGSGPAKLFGFVARKQGSTTDNVCHLFAELDPDQPAAAIVNFVSRVMLGS 1740          
BLAST of Tensin 3 vs. UniProt/SwissProt
Match: sp|Q68CZ2|TENS3_HUMAN (Tensin-3 OS=Homo sapiens OX=9606 GN=TNS3 PE=1 SV=2)

HSP 1 Score: 222.631 bits (566), Expect = 1.507e-59
Identity = 125/289 (43.25%), Postives = 179/289 (61.94%), Query Frame = 1
Query: 1270 LRKSAKIWYQPNMSREEAVKTLKGKPPGSFVVRQSHTFNNSYGLAVNV--PRTSTVEDDDRC-------VRHFLIESNTKGVRIRGCSNEPYFGSLTALVHQHTLTKLALPCCLILPIXXXXXXXXXXXXXXCNKNNTPKVSSLFAPKTFSALYLGSIDTESLTGAAALSKAVEILLENKTEVKQTEVSIRISPEGLTLTDVLRKLFFRRHYPLNSISYCGTENSTYWDSAETRSRGFAK----SKIFGFVARKTGT-TENMCHLLCEWHPQDNSRAITNFISCCVPGT 2094
            ++ ++K WY+ ++SRE+A+  LK K PGSF+VR SH+F  +YGLA+ V  P  S ++ + +        VRHFLIE   KGVR++GCSNEPYFGSLTALV QH++T LALPC L++P     L++   S      N+  ++  L      +  YL S++ ESLTG  A+ KA+ I L  +     T V  ++S +G+TLTD  RKLFFRRHYP+NS+ +C         + + + R + K    SK+FGFVARK G+ T+N+CHL  E  P+  + AI NF+S  + G+
Sbjct: 1165 VQDTSKFWYKADISREQAIAMLKDKEPGSFIVRDSHSFRGAYGLAMKVATPPPSVLQLNKKAGDLANELVRHFLIECTPKGVRLKGCSNEPYFGSLTALVCQHSITPLALPCKLLIP-ERDPLEEIAESSPQTAANSAAEL--LKQGAACNVWYLNSVEMESLTGHQAIQKALSITLVQEPPPVSTVVHFKVSAQGITLTDNQRKLFFRRHYPVNSVIFC---------ALDPQDRKWIKDGPSSKVFGFVARKQGSATDNVCHLFAEHDPEQPASAIVNFVSKVMIGS 1441          
BLAST of Tensin 3 vs. UniProt/SwissProt
Match: sp|Q9GLM4|TENS1_BOVIN (Tensin-1 OS=Bos taurus OX=9913 GN=TNS1 PE=2 SV=1)

HSP 1 Score: 221.861 bits (564), Expect = 3.413e-59
Identity = 114/279 (40.86%), Postives = 177/279 (63.44%), Query Frame = 1
Query: 1270 LRKSAKIWYQPNMSREEAVKTLKGKPPGSFVVRQSHTFNNSYGLAVNV--PRTSTVEDDDR------CVRHFLIESNTKGVRIRGCSNEPYFGSLTALVHQHTLTKLALPCCLILPIXXXXXXXXXXXXXXCNKNNTPKVSSLFAPKTFSALYLGSIDTESLTGAAALSKAVEILLENKTEVKQTEVSIRISPEGLTLTDVLRKLFFRRHYPLNSISYCGTE-NSTYWDSAETRSRGFAKSKIFGFVARKTGT-TENMCHLLCEWHPQDNSRAITNFIS 2076
            ++ ++K WY+P +SRE+A+  LK + PG+F++R SH+F  +YGLA+ V  P  + ++ + +       VRHFLIE+  +GV+++GC NEP FGSL+ALV+QH++  LALPC L++P  +   + + SS  + + ++  K  +       + L++ S+D ESLTG  A+SKA+   L        T V  ++S +G+TLTD  RKLFFRRHYPLN++++C  +     W    T++ G A +K+FGFVARK G+ T+N CHL  E  P   + AI +F+S
Sbjct: 1436 VQDTSKYWYKPEISREQAIALLKDQEPGAFIIRDSHSFRGAYGLAMKVSSPPPTIMQQNKKGDMTHELVRHFLIETGPRGVKLKGCPNEPNFGSLSALVYQHSIIPLALPCKLVIPNRDPTDESKDSSGPANSTSDLLKQGA-----ACNVLFVNSVDMESLTGPQAISKAISETLAADPTPAATIVHFKVSAQGITLTDNQRKLFFRRHYPLNTVTFCDLDPQERKW----TKTEGGAPAKLFGFVARKQGSATDNACHLFAELDPNQPASAIVSFVS 1705          
BLAST of Tensin 3 vs. UniProt/SwissProt
Match: sp|Q9HBL0|TENS1_HUMAN (Tensin-1 OS=Homo sapiens OX=9606 GN=TNS1 PE=1 SV=2)

HSP 1 Score: 221.861 bits (564), Expect = 3.437e-59
Identity = 117/279 (41.94%), Postives = 173/279 (62.01%), Query Frame = 1
Query: 1270 LRKSAKIWYQPNMSREEAVKTLKGKPPGSFVVRQSHTFNNSYGLAVNV--PRTSTVEDDDR------CVRHFLIESNTKGVRIRGCSNEPYFGSLTALVHQHTLTKLALPCCLILPIXXXXXXXXXXXXXXCNKNNTPKVSSLFAPKTFSALYLGSIDTESLTGAAALSKAVEILLENKTEVKQTEVSIRISPEGLTLTDVLRKLFFRRHYPLNSISYCGTE-NSTYWDSAETRSRGFAKSKIFGFVARKTG-TTENMCHLLCEWHPQDNSRAITNFIS 2076
            ++ ++K WY+P +SRE+A+  LK + PG+F++R SH+F  +YGLA+ V  P  + ++ + +       VRHFLIE+  +GV+++GC NEP FGSL+ALV+QH++  LALPC L++P   +     +S   S   N+T  +  L      + L++ S+D ESLTG  A+SKA    L        T V  ++S +G+TLTD  RKLFFRRHYPLN++++C  +     W     ++ G A +K+FGFVARK G TT+N CHL  E  P   + AI NF+S
Sbjct: 1456 VQDTSKYWYKPEISREQAIALLKDQEPGAFIIRDSHSFRGAYGLAMKVSSPPPTIMQQNKKGDMTHELVRHFLIETGPRGVKLKGCPNEPNFGSLSALVYQHSIIPLALPCKLVIP---NRDPTDESKDSSGPANSTADL--LKQGAACNVLFVNSVDMESLTGPQAISKATSETLAADPTPAATIVHFKVSAQGITLTDNQRKLFFRRHYPLNTVTFCDLDPQERKW----MKTEGGAPAKLFGFVARKQGSTTDNACHLFAELDPNQPASAIVNFVS 1725          
BLAST of Tensin 3 vs. UniProt/SwissProt
Match: sp|Q5SSZ5|TENS3_MOUSE (Tensin-3 OS=Mus musculus OX=10090 GN=Tns3 PE=1 SV=1)

HSP 1 Score: 219.55 bits (558), Expect = 1.836e-58
Identity = 122/295 (41.36%), Postives = 179/295 (60.68%), Query Frame = 1
Query: 1270 LRKSAKIWYQPNMSREEAVKTLKGKPPGSFVVRQSHTFNNSYGLAVNV--PRTSTVEDDDRC-------VRHFLIESNTKGVRIRGCSNEPYFGSLTALVHQHTLTKLALPCCLILPIXXXXXXXXXXXXXXCNKNNTPKVSSLFAPKTF------SALYLGSIDTESLTGAAALSKAVEILLENKTEVKQTEVSIRISPEGLTLTDVLRKLFFRRHYPLNSISYCGTENSTYWDSAETRSRGFAK----SKIFGFVARKTGT-TENMCHLLCEWHPQDNSRAITNFISCCVPGT 2094
            ++ ++K WY+ ++SRE+A+  LK K PGSF+VR SH+F  +YGLA+ V  P  S +  + +        VRHFLIE   KGVR++GCSNEPYFGSLTALV QH++T LALPC L++P  +   +            N+P+ ++  A +        +  YL S++ ESLTG  A+ KA+ + L  +     T V  ++S +G+TLTD  RKLFFRRHYP++S+ +C         + + + R + K    SK+FGFVARK G+ T+N+CHL  E  P+  + AI NF+S  + G+
Sbjct: 1160 VQDTSKFWYKADISREQAIAMLKDKAPGSFIVRDSHSFRGAYGLAMKVATPPPSVLHLNKKAGDLSNELVRHFLIECTPKGVRLKGCSNEPYFGSLTALVCQHSITPLALPCKLLIPERDPLEEIA---------ENSPQTAANSAAELLKQGAACNVWYLNSVEMESLTGHQAVQKALSMTLVQEPPPVSTVVHFKVSAQGITLTDNQRKLFFRRHYPVSSVIFC---------ALDPQDRKWIKDGPSSKVFGFVARKQGSATDNVCHLFAEHDPEQPASAIVNFVSKVMIGS 1436          
BLAST of Tensin 3 vs. TrEMBL
Match: A0A0J7KKW9 (Tensin-1 isoform x14 OS=Lasius niger OX=67767 GN=RF55_9329 PE=4 SV=1)

HSP 1 Score: 228.024 bits (580), Expect = 3.261e-64
Identity = 128/309 (41.42%), Postives = 188/309 (60.84%), Query Frame = 1
Query: 1219 YNATVKSANHQNSQNSSL--------RKSAKIWYQPNMSREEAVKTLKGKPPGSFVVRQSHTFNNSYGLAVNVPR------TSTVEDDDRCVRHFLIESNTKGVRIRGCSNEPYFGSLTALVHQHTLTKLALPCCLILPIXXXXXXXXXXXXXXCNKNNTPKVSSLFAPKTFSALYLGSIDTESLTGAAALSKAVEILLENKTEVKQTEVSIRISPEGLTLTDVLRKLFFRRHYPLNSISYCG--TENSTYWDSAETRSRGFAKSKIFGFVARKTG-TTENMCHLLCEWHPQDNSRAITNFISCCVPGT 2094
            Y  + +S+ H N++   +        R +++IWY+PN+SRE+A+  LK   PG+FVVR S++F  ++GLA+ V        +S  +     VRHFLIE  ++GVR++GC+NEP F SL+ALV+QH+L  +ALPC L+LP    + +    + DS   N+T ++  L      + LYL +IDTESLTG  A+ KA+  L E K     T V  ++S +G+TLTD  RKLFFRRHYP N+ISYCG  TE  T+  ++E   R  +  + FGFVARK    ++N CH+  E  P+  + AI NF++  + G+
Sbjct:   44 YYGSRRSSVHSNTEPQEVADANVKFVRDTSRIWYKPNISREQAISMLKDATPGTFVVRDSNSFPGAFGLALKVATPPPGAPSSPRDPSSELVRHFLIEPTSRGVRLKGCANEPVFSSLSALVYQHSLMAMALPCQLLLP----EPEAAARALDSPGTNSTQQL--LAQGAACNVLYLFTIDTESLTGPQAIKKAITNLFEQKPLPIATIVHFKVSTQGITLTDNARKLFFRRHYPTNNISYCGLDTEERTWEFASEDTGRPLSAHRCFGFVARKPAHKSDNQCHVFAELEPEQPATAIVNFVNKVMMGS 346          
BLAST of Tensin 3 vs. TrEMBL
Match: A0A1A8E650 (Tensin 3 (Fragment) OS=Nothobranchius kadleci OX=1051664 GN=TNS3 PE=4 SV=1)

HSP 1 Score: 229.95 bits (585), Expect = 9.054e-64
Identity = 126/281 (44.84%), Postives = 170/281 (60.50%), Query Frame = 1
Query: 1270 LRKSAKIWYQPNMSREEAVKTLKGKPPGSFVVRQSHTFNNSYGLAVNV--PRTSTVEDDDRC--------VRHFLIESNTKGVRIRGCSNEPYFGSLTALVHQHTLTKLALPCCLILPIXXXXXXXXXXXXXXCNKNNTPKVSSLFAPKTFSALYLGSIDTESLTGAAALSKAVEILLENKTEVKQTEVSIRISPEGLTLTDVLRKLFFRRHYPLNSISYCGTE-NSTYWDSAETRSRGFAKSKIFGFVARKTGTT-ENMCHLLCEWHPQDNSRAITNFIS 2076
            ++ ++K WY+P++SR++A+  LK K PG F+VR SH+F  +YGLA+ V  P  S  +   +         VRHFLIE   KGVR++GC NEPYFGSLTALV QH++T LALPC LI+P  +   D  +S   S   +    +    A   +   YLGS+D ESLTGA A+ KA  + L        T V  ++S +G+TLTD  RKLFFRRHY  N++ YC  +     W     +  GF  +KIFGFVARKTGT+ +N+CHL  E  P+  + AI NF+S
Sbjct:  174 VQDTSKFWYKPDISRDQAISVLKDKEPGCFIVRDSHSFKGAYGLAMKVATPPPSVFQQSKKAGGDLSTELVRHFLIECTQKGVRLKGCPNEPYFGSLTALVCQHSITPLALPCKLIIPDKDLLEDVVESPAQSVTNSAAELLKQGAACNVW---YLGSVDMESLTGAQAVQKATTMTLNADPPPNSTVVHFKVSSQGITLTDNQRKLFFRRHYNANTVIYCTLDPQDRKW-----KKDGFPSAKIFGFVARKTGTSKDNICHLFAEHDPEQPASAIVNFVS 446          
BLAST of Tensin 3 vs. TrEMBL
Match: V3ZZ48 (SH2 domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_129421 PE=4 SV=1)

HSP 1 Score: 222.246 bits (565), Expect = 4.459e-63
Identity = 118/282 (41.84%), Postives = 170/282 (60.28%), Query Frame = 1
Query: 1270 LRKSAKIWYQPNMSREEAVKTLKGKPPGSFVVRQSHTFNNSYGLAVNV----PRTSTVEDDD---RCVRHFLIESNTKGVRIRGCSNEPYFGSLTALVHQHTLTKLALPCCLILPIXXXXXXXXXXXXXXCNKNNTPKVSSLFAPKTFSALYLGSIDTESLTGAAALSKAVEILLENKTEVKQTEVSIRISPEGLTLTDVLRKLFFRRHYPLNSISYCGTENSTYWDSAETRSRGFAKSKIFGFVARKT-GTTENMCHLLCEWHPQDNSRAITNFISCCVPG 2091
            ++ ++K WY+PN++REEA+  LK K PG+FV+R S++F  ++GLA+ V    P        D     VRHFLIE   KGVR+RGCSNEP FG+L ALV+QH++T LALPC L LP      +  ++     + +     S L      + +Y+ ++DTESLTG  A+SKA+++ ++N    K T V  ++S +G+TLTD  RKLFFRRHYP+ +++YCG +                  KIFGFVARK  G ++N CHL  E  P+  + AI NF++  + G
Sbjct:    9 VKDTSKFWYKPNITREEAIVLLKDKSPGTFVIRDSNSFPGAFGLALKVATLPPNVQIKPSGDPQADLVRHFLIEPTPKGVRLRGCSNEPVFGNLAALVYQHSMTPLALPCKLALPDPVFSSESSRTMEMPSSAS-----SLLHQGAACNVIYINTVDTESLTGPQAVSKAIKMTMDNPPNHKTTVVHFKVSNQGITLTDNQRKLFFRRHYPVTAVTYCGMDPD--------------DRKIFGFVARKQGGISDNSCHLFAELDPEQPASAIVNFVTKVMIG 271          
BLAST of Tensin 3 vs. TrEMBL
Match: A0A1A8LH23 (Tensin 3 (Fragment) OS=Nothobranchius pienaari OX=704102 GN=TNS3 PE=4 SV=1)

HSP 1 Score: 228.794 bits (582), Expect = 4.780e-63
Identity = 126/287 (43.90%), Postives = 174/287 (60.63%), Query Frame = 1
Query: 1270 LRKSAKIWYQPNMSREEAVKTLKGKPPGSFVVRQSHTFNNSYGLAVNV--PRTSTVEDDDRC--------VRHFLIESNTKGVRIRGCSNEPYFGSLTALVHQHTLTKLALPCCLILPIXXXXXXXXXXXXXXCNKNNTPKVSSLFAPKTFSALYLGSIDTESLTGAAALSKAVEILLENKTEVKQTEVSIRISPEGLTLTDVLRKLFFRRHYPLNSISYCGTE-NSTYWDSAETRSRGFAKSKIFGFVARKTGTT-ENMCHLLCEWHPQDNSRAITNFISCCVPGT 2094
            ++ ++K WY+P++SR++A+  LK K PG F+VR SH+F  +YGLA+ V  P  S  +   +         VRHFLIE   KGVR++GC NEPYFGSLTALV QH++T LALPC LI+P  +   D  +S   S   +    +    A   +   YLGS++ ESLTGA A+ KA  + L        T V  ++S +G+TLTD  RKLFFRRHY +N++ YC  +     W     +  GF  +KIFGFVARKTGT+ +N+CHL  E  P+  + AI NF+S  + G+
Sbjct:  202 VQDTSKFWYKPDISRDQAISVLKDKEPGCFIVRDSHSFKGAYGLAMKVATPPPSVFQQSKKAGGDLSTELVRHFLIECTQKGVRLKGCPNEPYFGSLTALVCQHSITPLALPCKLIIPDKDLLEDVVESPAQSVTNSAAELLKQGAACNVW---YLGSVEMESLTGAQAVQKATTMTLNADPPPNSTVVHFKVSSQGITLTDNQRKLFFRRHYNVNTVIYCTLDPQDRKW-----KKDGFPSAKIFGFVARKTGTSKDNICHLFAEHDPEQPASAIVNFVSRVMIGS 480          
BLAST of Tensin 3 vs. TrEMBL
Match: A0A1A8GNN4 (Tensin 3 (Fragment) OS=Nothobranchius korthausae OX=1143690 GN=TNS3 PE=4 SV=1)

HSP 1 Score: 224.942 bits (572), Expect = 2.212e-62
Identity = 125/287 (43.55%), Postives = 173/287 (60.28%), Query Frame = 1
Query: 1270 LRKSAKIWYQPNMSREEAVKTLKGKPPGSFVVRQSHTFNNSYGLAVNV--PRTSTVEDDDRC--------VRHFLIESNTKGVRIRGCSNEPYFGSLTALVHQHTLTKLALPCCLILPIXXXXXXXXXXXXXXCNKNNTPKVSSLFAPKTFSALYLGSIDTESLTGAAALSKAVEILLENKTEVKQTEVSIRISPEGLTLTDVLRKLFFRRHYPLNSISYCGTE-NSTYWDSAETRSRGFAKSKIFGFVARKTGTT-ENMCHLLCEWHPQDNSRAITNFISCCVPGT 2094
            ++ ++K WY+P++SR++A+  LK K PG F+VR SH+F  +YGLA+ V  P  S  +   +         VRHFLIE   KGVR++GC NEPYFGSLTALV QH++T LALPC LI+P  +   D  +S   S + +    +    A   +   YLGS++ ESLTGA A+ KA  + L        T V  ++S +G+TLTD  RKLFFRRHY  N++ YC  +     W     +  GF  +KIFGFVARKT T+ +N+CHL  E  P+  + AI NF+S  + G+
Sbjct:  133 VQDTSKFWYKPDISRDQAISVLKDKEPGCFIVRDSHSFKGAYGLAMKVATPPPSVFQQSKKAGGDLSAELVRHFLIECTQKGVRLKGCPNEPYFGSLTALVCQHSITPLALPCKLIIPDKDLLEDVVESPAQSVSNSAAELLKQGAACNVW---YLGSVEMESLTGAQAVQKATTMTLNADPPPNSTVVHFKVSSQGITLTDNQRKLFFRRHYNANTVIYCTLDPQDRKW-----KKDGFPSAKIFGFVARKTDTSKDNICHLFAEHDPEQPASAIVNFVSRVMIGS 411          
BLAST of Tensin 3 vs. Ensembl Cavefish
Match: ENSAMXT00000049936.1 (pep primary_assembly:Astyanax_mexicanus-2.0:13:8188442:8199496:-1 gene:ENSAMXG00000013421.2 transcript:ENSAMXT00000049936.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 225.328 bits (573), Expect = 1.438e-64
Identity = 120/280 (42.86%), Postives = 178/280 (63.57%), Query Frame = 1
Query: 1270 LRKSAKIWYQPNMSREEAVKTLKGKPPGSFVVRQSHTFNNSYGLAVNV---PRTSTVEDDD---RCVRHFLIESNTKGVRIRGCSNEPYFGSLTALVHQHTLTKLALPCCLILPIXXXXXXXXXXXXXXCNKNNTPKVSSLFAPKTFSA---LYLGSIDTESLTGAAALSKAVEILLENKTEVKQTEVSIRISPEGLTLTDVLRKLFFRRHYPLNSISYCGTE-NSTYWDSAETRSRGFAKSKIFGFVARKTG-TTENMCHLLCEWHPQDNSRAITNFIS 2076
            ++ ++K WY+P++SRE+A+  LK + PG+FV+R SH+F  +YGLA+ V   P T      D     VRHFLIE+++KGVR++GC NEP+FG L+ALV+QH++T LALPC L++P  + + +  +          TP  S++   K  +A   LY+ S+D ESLTG  A++KA+   L     +  T V  ++S +G+TLTD  RK+FFRRHYP+N+++YC  +     W+ A+    G A  K+FGFVARK G TT+N+ HL  E  P   + AI N++S
Sbjct:  277 VQDTSKFWYKPDISREQAITLLKDREPGAFVIRDSHSFRGAYGLAMKVACPPPTVQQNKKDMTNELVRHFLIETSSKGVRLKGCPNEPHFGCLSALVYQHSITPLALPCKLMIPTRDPNEEALELV--------TPTSSAMDLLKQGAACNVLYINSVDMESLTGPQAVAKAISETLAANPPLSATVVHFKVSLQGITLTDNQRKVFFRRHYPINTVTYCNIDPQERKWNKADG---GLA--KLFGFVARKQGSTTDNVSHLFAELEPDQPATAIVNYVS 543          
BLAST of Tensin 3 vs. Ensembl Cavefish
Match: TNS3 (tensin-3 [Source:NCBI gene;Acc:103027377])

HSP 1 Score: 228.794 bits (582), Expect = 1.143e-62
Identity = 125/285 (43.86%), Postives = 177/285 (62.11%), Query Frame = 1
Query: 1270 LRKSAKIWYQPNMSREEAVKTLKGKPPGSFVVRQSHTFNNSYGLAVNV--PRTSTVEDDDRC-------VRHFLIESNTKGVRIRGCSNEPYFGSLTALVHQHTLTKLALPCCLILPIXXXXXXXXXXXXXXCNKNNTPKVSSLFAPKTFSALYLGSIDTESLTGAAALSKAVEILLENKTEVKQTEVSIRISPEGLTLTDVLRKLFFRRHYPLNSISYCGTENSTYWDSAETRSRGFAKSKIFGFVARKTG-TTENMCHLLCEWHPQDNSRAITNFISCCVPGT 2094
            ++ ++K WY+P++SRE+A+  LK K PGSF+VR SH+F  +YGLA+ V  P  S ++   +        VRHFLIE   KGVR++GC NEPYFGSLTALV QH++T LALPC LI+P  +   D  +S   +   + T  +    A   +   +LGS++ ESLTG  A+ KA  ++L        T V  ++S +G+TLTD  RKLFFRRHY +N++ +C  +     D   T+  G   +KIFGFVARK+G +TEN+CHL  E  P+  + AI NF+S  + G+
Sbjct:  918 VQDTSKFWYKPDISREQAITVLKDKEPGSFIVRDSHSFRGAYGLAMKVATPPPSILQQSKKVGDLTNELVRHFLIECTQKGVRLKGCPNEPYFGSLTALVCQHSITPLALPCKLIIPSRDPLEDLTESQQQTSTNSATELLKQGAACNVW---FLGSVELESLTGVQAIQKASTVILGQNPPATSTIVHFKVSAQGITLTDNQRKLFFRRHYAVNTVIFCALDPQ---DRRWTKD-GCLAAKIFGFVARKSGSSTENVCHLFAEHDPEQPASAIVNFVSKVMIGS 1195          
BLAST of Tensin 3 vs. Ensembl Cavefish
Match: tns1b (tensin 1b [Source:ZFIN;Acc:ZDB-GENE-030131-6933])

HSP 1 Score: 225.713 bits (574), Expect = 1.991e-61
Identity = 116/292 (39.73%), Postives = 174/292 (59.59%), Query Frame = 1
Query: 1270 LRKSAKIWYQPNMSREEAVKTLKGKPPGSFVVRQSHTFNNSYGLAVNV----PRTSTVEDDD---RCVRHFLIESNTKGVRIRGCSNEPYFGSLTALVHQHTLTKLALPCCLILPIXXXXXXXXXXXXXXCNKNNTPKVSSLFAPKT--------FSALYLGSIDTESLTGAAALSKAVEILLENKTEVKQTEVSIRISPEGLTLTDVLRKLFFRRHYPLNSISYCGTE-NSTYWDSAETRSRGFAKSKIFGFVARKTG-TTENMCHLLCEWHPQDNSRAITNFISCCVPGT 2094
            ++ ++K WY+P++SRE+A+  LK + PG+F++R SH+F  +YGLA+ V    P     +  D     VRHFLIE++ KGV+++GC NEPYFG L+ALV+QH++T LALPC L++P  +                  P+V++   P T         + LY+ S+D ESLTG  A++KA+   +        T V  ++S +G+TLTD  RKLFFRRHYP++++++C  +     W+ AE        +K FGFVARK G TT+N+ HL  E  P   + AI NF+S  + G+
Sbjct: 1434 VQDTSKFWYKPDISREQAINILKEREPGAFIIRDSHSFRGAYGLAMKVSSPPPTAQQAKKGDITNELVRHFLIETSPKGVKLKGCPNEPYFGCLSALVYQHSITPLALPCKLVIPTKDP-------------HEEVPEVATPVNPATELLKQGAACNVLYINSVDMESLTGPQAVAKAISETMAASPMPTATTVHFKVSSQGITLTDNQRKLFFRRHYPISTVTFCDLDPQERKWNKAEG-----GTAKFFGFVARKQGSTTDNVSHLFAEMDPDQPATAIVNFVSKVMIGS 1707          
BLAST of Tensin 3 vs. Ensembl Cavefish
Match: ENSAMXT00000013817.2 (pep primary_assembly:Astyanax_mexicanus-2.0:13:8188442:8217069:-1 gene:ENSAMXG00000013421.2 transcript:ENSAMXT00000013817.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 224.942 bits (572), Expect = 2.198e-61
Identity = 118/278 (42.45%), Postives = 172/278 (61.87%), Query Frame = 1
Query: 1270 LRKSAKIWYQPNMSREEAVKTLKGKPPGSFVVRQSHTFNNSYGLAVNV---PRTSTVEDDD---RCVRHFLIESNTKGVRIRGCSNEPYFGSLTALVHQHTLTKLALPCCLILPIXXXXXXXXXXXXXXCNKNNTPKVSS-LFAPKTFSALYLGSIDTESLTGAAALSKAVEILLENKTEVKQTEVSIRISPEGLTLTDVLRKLFFRRHYPLNSISYCGTE-NSTYWDSAETRSRGFAKSKIFGFVARKTG-TTENMCHLLCEWHPQDNSRAITNFIS 2076
            ++ ++K WY+P++SRE+A+  LK + PG+FV+R SH+F  +YGLA+ V   P T      D     VRHFLIE+++KGVR++GC NEP+FG L+ALV+QH++T LALPC L++P                 +  T   S  L +    + LY+ S+D ESLTG  A++KA+   L     +  T V  ++S +G+TLTD  RK+FFRRHYP+N+++YC  +     W+ A+    G A  K+FGFVARK G TT+N+ HL  E  P   + AI N++S
Sbjct:  888 VQDTSKFWYKPDISREQAITLLKDREPGAFVIRDSHSFRGAYGLAMKVACPPPTVQQNKKDMTNELVRHFLIETSSKGVRLKGCPNEPHFGCLSALVYQHSITPLALPCKLMIP----------------TRGETLSFSHFLISSAACNVLYINSVDMESLTGPQAVAKAISETLAANPPLSATVVHFKVSLQGITLTDNQRKVFFRRHYPINTVTYCNIDPQERKWNKADG---GLA--KLFGFVARKQGSTTDNVSHLFAELEPDQPATAIVNYVS 1144          
BLAST of Tensin 3 vs. Ensembl Cavefish
Match: tns2b (tensin 2b [Source:ZFIN;Acc:ZDB-GENE-101001-5])

HSP 1 Score: 204.142 bits (518), Expect = 2.190e-56
Identity = 111/280 (39.64%), Postives = 167/280 (59.64%), Query Frame = 1
Query: 1270 LRKSAKIWYQPNMSREEAVKTLKGKPPGSFVVRQSHTFNNSYGLA--VNVPRTSTVE------DDDRCVRHFLIESNTKGVRIRGCSNEPYFGSLTALVHQHTLTKLALPCCLILPIXXXXXXXXXXXXXXCNKNNTPKVSSLF---APKTFSALYLGSIDTESLTGAAALSKAVEILLENKTEVKQTEVSIRISPEGLTLTDVLRKLFFRRHYPLNSISYCGTENSTYWDSAETRSRGFAKSKIFGFVARKTGTTE-NMCHLLCEWHPQDNSRAITNFI 2073
            ++ S+K WY+P +SR++A+  LK K PG F++R S +F  +YGLA  V +P +  +         +  VRHFLIES  KGV+I+GC NE YFGSL+ALV+ H++  ++LPC L +P                +K +T   + L    A ++ + LYL S+D ESLTG  A+SKA++  L        T V  ++S +G+TLTD  R+LFFRRHYP++S+++    N  +      + R F   ++FGFVAR++G+++ N CHL  E  P+  + AI NFI
Sbjct:  346 VQDSSKFWYKPGISRDQAIAVLKDKDPGCFLIRDSKSFQGAYGLALKVAIPPSHVINHVNNHNSQEHLVRHFLIESGAKGVKIKGCHNETYFGSLSALVYHHSIVPVSLPCTLRIP----------------DKGHT--AADLLKQGAGESCNVLYLNSVDIESLTGPQAISKAIKSTLNQDPCPSATTVHFKVSTQGITLTDNQRRLFFRRHYPIHSVTFILMSNQRW-----KKYRKFVI-EMFGFVARRSGSSQGNACHLFAELDPEQPATAIVNFI 601          
BLAST of Tensin 3 vs. Ensembl Sea Lamprey
Match: TNS1 (tensin 1 [Source:HGNC Symbol;Acc:HGNC:11973])

HSP 1 Score: 222.631 bits (566), Expect = 3.743e-61
Identity = 120/285 (42.11%), Postives = 175/285 (61.40%), Query Frame = 1
Query: 1255 SQNSSLRKSAKIWYQPNMSREEAVKTLKGKPPGSFVVRQSHTFNNSYGLAV-------NVPRTSTVEDD--DRCVRHFLIESNTKGVRIRGCSNEPYFGSLTALVHQHTLTKLALPCCLILPIXXXXXXXXXXXXXXCNKNNTPKVSSLFAPKTFSALYLGSIDTESLTGAAALSKAVEILLENKTEVKQTEVSIRISPEGLTLTDVLRKLFFRRHYPLNSISYCGTE-NSTYWDSAETRSRGFAKSKIFGFVARKTGT-TENMCHLLCEWHPQDNSRAITNFIS 2076
            +Q   ++ + K WY+  +SR++A+  LK K PGSFV+R SH+F  +YGLA+       N+P+    + D     VRH+LIE  +KGVR++GC NEPYFGSL+ALV+QH++T LALPC +++P  +     +  S  S   N TP++  L      + LYLGS++ ESLTG  A++KAV   L        T+V  ++S +G+TLTD  RKLFFRRHYP ++++YC  +  +  W      S     + IFGFVA+K G+ T+N CHL  E  P+  + AI +FI+
Sbjct: 1391 AQVKFVQDTTKYWYKKEISRDQAIALLKDKEPGSFVIRDSHSFRGAYGLAMKVSSPPPNIPQQGKKKGDVSSELVRHYLIECTSKGVRLKGCPNEPYFGSLSALVYQHSITPLALPCKIVIPHEDPLEHSEVDSIQSHPVNATPEL--LKQGAACNVLYLGSVEMESLTGPQAVAKAVGQALSGSAPPSPTQVHFKVSQQGVTLTDNQRKLFFRRHYPADTVTYCDQDPQNRKWKKDSGSS-----ANIFGFVAKKQGSVTDNQCHLFAELDPKQPASAIVSFIT 1668          
BLAST of Tensin 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001958.1 (pep scaffold:Pmarinus_7.0:GL480048:14054:23824:1 gene:ENSPMAG00000001775.1 transcript:ENSPMAT00000001958.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 204.142 bits (518), Expect = 2.209e-60
Identity = 110/266 (41.35%), Postives = 163/266 (61.28%), Query Frame = 1
Query: 1264 SSLRKSAKIWYQPNMSREEAVKTLKGKPPGSFVVRQSHTFNNSYGLAV-------NVPRTSTVEDDDRCVRHFLIESNTKGVRIRGCSNEPYFGSLTALVHQHTLTKLALPCCLILPIXXXXXXXXXXXXXXCNKNNTPKVSSLFAPKTF-SALYLGSIDTESLTGAAALSKAVEILLENKTEVKQTEVSIRISPEGLTLTDVLRKLFFRRHYPLNSISYCG-TENSTYWDSAETRSRGFAKSKIFGFVARKTGT-TENMCHLLCE 2031
            S ++ ++K WY+P ++RE+AV  L  +  G+FV+R S +F+  +GLA+        VP  +  +  D  VRHFLIE+  +GVR++GC NEP+FGSL+ALV+QHT+T LALP CL LP       D   ++D C+        S   P+   +A +L S++ ESLTG  A+++A  +++   T      V +R++ +G+TLTD+ RK FFRRHYP  SIS+C    + T W  AE +      +K+FGFVARK G+ + N+CHL  E
Sbjct:    2 SFVQDTSKFWYKPGITREQAVTLLCPREAGAFVIRNSSSFHGDFGLAMKVENLPPGVPVQAGRDTVDELVRHFLIETKAQGVRLKGCPNEPFFGSLSALVNQHTVTPLALPGCLRLP---DRDFDLTKAHDLCDALTGGSTGSSQPPEAVGTAFFLDSVEMESLTGPQAVARATSVIMGMATRSMPIHVHLRVTGQGITLTDIYRKRFFRRHYPAESISFCAMVPDVTRWPMAEDKP----AAKMFGFVARKAGSVSHNVCHLFAE 260          
BLAST of Tensin 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005743.1 (pep scaffold:Pmarinus_7.0:GL478791:187748:191319:1 gene:ENSPMAG00000005205.1 transcript:ENSPMAT00000005743.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 199.904 bits (507), Expect = 4.727e-59
Identity = 114/273 (41.76%), Postives = 167/273 (61.17%), Query Frame = 1
Query: 1321 AVKTLKGKPPGSFVVRQSHTFNNSYGLAVNV--PRTSTVEDDDR------CVRHFLIESNTKGVRIRGCSNEPYFGSLTALVHQHTLTKLALPCCLILPIXXXXXXXXXXXXXXCNKNNTPKVSSLFAPKTFSALYLGSIDTESLTGAAALSKAV-EILLENKTEVKQTEVSIRISPEGLTLTDVLRKLFFRRHYPLNSISYCGTE-NSTYWDSAETRSRGFAKSKIFGFVARKTG-TTENMCHLLCEWHPQDNSRAITNFISCCVPGT*EVS 2106
            A+  LK   PGSF++R SH+F  +YGLAV V  P  S ++   +       VRH+LIES  KGVR++GC NEP+FGSL+ALV+QH++T LALPC LI+P  +     +  S ++   N+  ++  L      + L+LGS++ ESLTG  A++KAV E+L  +      T V  ++S +G+TLTD  RKLFFRRHYP  ++++C  +     W     ++ G   + IFGFVA+K   TT+N+CHL  E  P+  + AI NF++  + G+  VS
Sbjct:    1 AIAVLKDSEPGSFIIRDSHSFRGAYGLAVKVAMPPPSVLQQTKKGDLANELVRHYLIESTPKGVRLKGCPNEPFFGSLSALVYQHSITPLALPCQLIIPDKDPMECSETDSSEANTANSASEL--LKQGAACNVLFLGSVEMESLTGPQAIAKAVGEVLEASAATPAATAVHFKVSAQGITLTDNQRKLFFRRHYPSITVTFCDLDPQERKW-----QNNGSNSANIFGFVAKKQASTTDNLCHLFAELEPEQPAGAIVNFVTKVMLGSQNVS 266          
BLAST of Tensin 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003653.1 (pep scaffold:Pmarinus_7.0:GL476944:428913:445548:-1 gene:ENSPMAG00000003337.1 transcript:ENSPMAT00000003653.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 211.846 bits (538), Expect = 1.401e-58
Identity = 112/278 (40.29%), Postives = 168/278 (60.43%), Query Frame = 1
Query: 1270 LRKSAKIWYQPNMSREEAVKTLKGKPPGSFVVRQSHTFNNSYGLAVNV-----PRTSTVEDD--DRCVRHFLIESNTKGVRIRGCSNEPYFGSLTALVHQHTLTKLALPCCLILPIXXXXXXXXXXXXXXCNKNNTPKVSSLFAPKTFSALYLGSIDTESLTGAAALSKAVEILLENKTEVKQTEVSIRISPEGLTLTDVLRKLFFRRHYPLNSISYCGTENST-YWDSAETRSRGFAKSKIFGFVARKTG-TTENMCHLLCEWHPQDNSRAITNFIS 2076
            ++ ++K WY+P++SR++A+  LKG+ PG+FV+R S +F  +YGLA+ V     P   + + D     VRHFLIES  KGVR++GCSNEP FGSL+ALV+QH++T LALPC L++P  +       +S     K               + L+LGS++ ESLTG  A+ KA   +L+ K     T V  ++S +G+TLTD  R +    H P++++++C  +  T  W  AE    G   S++FGFVARK G +++N+CHL  E  P+  + AI NF+S
Sbjct:  526 VQDTSKYWYKPDISRDQAITMLKGRDPGAFVIRDSSSFRGAYGLALKVATPPGPSLDSKKGDPASELVRHFLIESTPKGVRLKGCSNEPVFGSLSALVYQHSITPLALPCKLLVPEHDPLDTSSVNSASELLKQGA----------ACNVLFLGSVEMESLTGPQAIGKATAEILDMKPRPVATTVHFKVSAQGITLTDNQRSILPPTHNPVSTVTFCNVDPETRTWVQAE----GTPGSRVFGFVARKPGSSSDNLCHLFAELDPEQPAAAIVNFVS 789          
BLAST of Tensin 3 vs. Ensembl Nematostella
Match: EDO45783 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRM1])

HSP 1 Score: 184.496 bits (467), Expect = 4.433e-53
Identity = 103/274 (37.59%), Postives = 152/274 (55.47%), Query Frame = 1
Query: 1282 AKIWYQPNMSREEAVKTLKGKPPGSFVVRQSHTFNNSYGLAVNV--PRTSTVEDD-------DRCVRHFLIESNTKGVRIRGCSNEPYFGSLTALVHQHTLTKLALPCCLILPIXXXXXXXXXXXXXXCNKNNTPKVSSLFAPKTFSALYLGSIDTESLTGAAALSKAVEILLENKTEVKQTEVSIRISPEGLTLTDVLRKLFFRRHYPLNSISYCGTEN-STYWDSAETRSRGFAKSKIFGFVARKTGTTENMCHLLCEWHPQDNSRAITNFI 2073
            ++ WY+P ++R++A+  LK K PG FVVR S +F  +YGLAV V  P    ++ D       +  +RHFLIES  KGV+++GC NEP FGSL A V QHT+T L+LP  L++P   +      S       N    V S F       +++G  + E L+G+ A+ + VE LL+ K   + T  S +++ EG+T+TD+ RK+FFR+H+P+ SI +CG +     WD       G  KS+ FG V R+ G   N CHL  E     +   + N +
Sbjct:    1 SEFWYKPKITRDQAINVLKDKEPGLFVVRDSQSFPGAYGLAVKVAIPPPHVLQGDLTKVDLANEKIRHFLIESTKKGVKLKGCDNEPVFGSLAAFVFQHTITPLSLPLRLVIPNEGTWPRRCFSLTFMYAVN----VVSFFL--AMKVMFVGESNVEMLSGSTAVQRTVEDLLKYKATPRFTPASFKVTREGVTITDLERKVFFRKHFPMTSILHCGIDPLDQRWDLHLPDYTG--KSRTFGMVVRRIGEAGNDCHLFAEVDDDHSVNTVINLV 266          
BLAST of Tensin 3 vs. Ensembl Nematostella
Match: EDO27682 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T8K3])

HSP 1 Score: 49.2914 bits (116), Expect = 3.557e-6
Identity = 31/100 (31.00%), Postives = 47/100 (47.00%), Query Frame = 1
Query: 1291 WYQPNMSREEAVKTLKGKPPGSFVVRQSHTFNNSYGLAVNVPRTSTVEDDDRCVRHFLIESNTKGVRIRGCSNEPYFGSLTALVHQHTLTKLALPCCLIL 1590
            WY P + RE  ++ L+    GSF VR S +    + L V VP     E       ++LI    +GV++ G S    F  L +L+  ++     LPC L+L
Sbjct:  270 WYMPGIPREFIMEMLQASEEGSFFVRDSQSKPGCHALTVRVP----TEVHASGFGNYLITPIPEGVKLEGFSRT--FTDLVSLIEYYSYHADGLPCRLLL 363          
BLAST of Tensin 3 vs. Ensembl Medaka
Match: ENSORLT00000002849.2 (pep primary_assembly:ASM223467v1:2:14075704:14085025:-1 gene:ENSORLG00000002301.2 transcript:ENSORLT00000002849.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 223.016 bits (567), Expect = 1.389e-62
Identity = 114/279 (40.86%), Postives = 171/279 (61.29%), Query Frame = 1
Query: 1270 LRKSAKIWYQPNMSREEAVKTLKGKPPGSFVVRQSHTFNNSYGLAVNVP-RTSTVEDDDRC-------VRHFLIESNTKGVRIRGCSNEPYFGSLTALVHQHTLTKLALPCCLILPIXXXXXXXXXXXXXXCNKNNTPKVSSLFAPKTFSALYLGSIDTESLTGAAALSKAVEILLENKTEVKQTEVSIRISPEGLTLTDVLRKLFFRRHYPLNSISYCGTE-NSTYWDSAETRSRGFAKSKIFGFVARKTG-TTENMCHLLCEWHPQDNSRAITNFIS 2076
            ++ ++K WY+P++SRE+A+  LK + PG+FV+R SH+F  +YGLA+ V     T++ + +        VRHFLIE++ KGVR++GC NEPYFG L+ALV+QH++T LALPC L++P  + + +  + +         P V  L      + LY+ S+D ESLTG  A++KA+   L        T V  +++ +G+TLTD  RK+FFRRHYP+++I+YC  +  +  W        G    K+FGFVARK G TT+N  HL  E  P   + AI +F+S
Sbjct:  402 VQDTSKFWYKPDISREQAINLLKDREPGAFVIRDSHSFRGAYGLAMKVACPPPTIQQNKKVGDLTNELVRHFLIETSPKGVRLKGCPNEPYFGCLSALVYQHSMTPLALPCKLMIPTKDPNEEALELATP-----TDPVVELLKQEAACNVLYINSVDMESLTGPQAIAKAISQTLATSPLPAATTVHFKVTTQGITLTDSQRKIFFRRHYPISTITYCDMDPQNRKWG-----KEGGGSVKLFGFVARKQGSTTDNASHLFAELDPDQPASAIVSFVS 670          
BLAST of Tensin 3 vs. Ensembl Medaka
Match: tns1b (tensin-1 [Source:NCBI gene;Acc:101155555])

HSP 1 Score: 225.328 bits (573), Expect = 2.872e-61
Identity = 117/281 (41.64%), Postives = 171/281 (60.85%), Query Frame = 1
Query: 1270 LRKSAKIWYQPNMSREEAVKTLKGKPPGSFVVRQSHTFNNSYGLAVNV----PRTSTVEDDD---RCVRHFLIESNTKGVRIRGCSNEPYFGSLTALVHQHTLTKLALPCCLILPIXXXXXXXXXXXXXXCNKNNTPKVSSLFAPKTFSALYLGSIDTESLTGAAALSKAVEILLENKTEVKQTEVSIRISPEGLTLTDVLRKLFFRRHYPLNSISYCGTE-NSTYWDSAETRSRGFAKSKIFGFVARKTG-TTENMCHLLCEWHPQDNSRAITNFISCCV 2085
            ++ ++K WY+P +SRE+A+  LK + PG+FV+R SH+F  +YGLA+ V    P     +  D     VRHFLIES+ KGV+++GC NEPYFG L+ALV+QH +T LALPC LI+P ++   +  +      + +  P +  L      + LY+ S++ ESLTG  A++KA+   L        T V  ++S +G+TLTD  RKLFFRRHYP N++++C T+     W+  E        +K+FGFVARK G TT+N+ HL  E  P   + AI NF+S  +
Sbjct: 1448 VQDTSKFWYKPEISREQAISLLKDREPGAFVIRDSHSFRGAYGLAMKVATPPPSVQQSKKGDITNELVRHFLIESSPKGVKLKGCPNEPYFGCLSALVYQHAITPLALPCKLIIPATDLIDEVPE------DTSTNPMMERLKQGAACNVLYVNSVEMESLTGPQAVAKAISETLAAAAPPTATIVHFKVSSQGITLTDNQRKLFFRRHYPTNTVTFCDTDPQDRKWNKPEG-----GVAKLFGFVARKQGSTTDNVTHLFAELEPGQPASAIVNFVSKMI 1717          
BLAST of Tensin 3 vs. Ensembl Medaka
Match: ENSORLT00000002851.2 (pep primary_assembly:ASM223467v1:2:14075704:14087112:-1 gene:ENSORLG00000002301.2 transcript:ENSORLT00000002851.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 223.402 bits (568), Expect = 3.014e-61
Identity = 114/279 (40.86%), Postives = 171/279 (61.29%), Query Frame = 1
Query: 1270 LRKSAKIWYQPNMSREEAVKTLKGKPPGSFVVRQSHTFNNSYGLAVNVP-RTSTVEDDDRC-------VRHFLIESNTKGVRIRGCSNEPYFGSLTALVHQHTLTKLALPCCLILPIXXXXXXXXXXXXXXCNKNNTPKVSSLFAPKTFSALYLGSIDTESLTGAAALSKAVEILLENKTEVKQTEVSIRISPEGLTLTDVLRKLFFRRHYPLNSISYCGTE-NSTYWDSAETRSRGFAKSKIFGFVARKTG-TTENMCHLLCEWHPQDNSRAITNFIS 2076
            ++ ++K WY+P++SRE+A+  LK + PG+FV+R SH+F  +YGLA+ V     T++ + +        VRHFLIE++ KGVR++GC NEPYFG L+ALV+QH++T LALPC L++P  + + +  + +         P V  L      + LY+ S+D ESLTG  A++KA+   L        T V  +++ +G+TLTD  RK+FFRRHYP+++I+YC  +  +  W        G    K+FGFVARK G TT+N  HL  E  P   + AI +F+S
Sbjct:  708 VQDTSKFWYKPDISREQAINLLKDREPGAFVIRDSHSFRGAYGLAMKVACPPPTIQQNKKVGDLTNELVRHFLIETSPKGVRLKGCPNEPYFGCLSALVYQHSMTPLALPCKLMIPTKDPNEEALELATP-----TDPVVELLKQEAACNVLYINSVDMESLTGPQAIAKAISQTLATSPLPAATTVHFKVTTQGITLTDSQRKIFFRRHYPISTITYCDMDPQNRKWG-----KEGGGSVKLFGFVARKQGSTTDNASHLFAELDPDQPASAIVSFVS 976          
BLAST of Tensin 3 vs. Ensembl Medaka
Match: tns1b (tensin-1 [Source:NCBI gene;Acc:101155555])

HSP 1 Score: 225.328 bits (573), Expect = 3.106e-61
Identity = 117/281 (41.64%), Postives = 171/281 (60.85%), Query Frame = 1
Query: 1270 LRKSAKIWYQPNMSREEAVKTLKGKPPGSFVVRQSHTFNNSYGLAVNV----PRTSTVEDDD---RCVRHFLIESNTKGVRIRGCSNEPYFGSLTALVHQHTLTKLALPCCLILPIXXXXXXXXXXXXXXCNKNNTPKVSSLFAPKTFSALYLGSIDTESLTGAAALSKAVEILLENKTEVKQTEVSIRISPEGLTLTDVLRKLFFRRHYPLNSISYCGTE-NSTYWDSAETRSRGFAKSKIFGFVARKTG-TTENMCHLLCEWHPQDNSRAITNFISCCV 2085
            ++ ++K WY+P +SRE+A+  LK + PG+FV+R SH+F  +YGLA+ V    P     +  D     VRHFLIES+ KGV+++GC NEPYFG L+ALV+QH +T LALPC LI+P ++   +  +      + +  P +  L      + LY+ S++ ESLTG  A++KA+   L        T V  ++S +G+TLTD  RKLFFRRHYP N++++C T+     W+  E        +K+FGFVARK G TT+N+ HL  E  P   + AI NF+S  +
Sbjct: 1462 VQDTSKFWYKPEISREQAISLLKDREPGAFVIRDSHSFRGAYGLAMKVATPPPSVQQSKKGDITNELVRHFLIESSPKGVKLKGCPNEPYFGCLSALVYQHAITPLALPCKLIIPATDLIDEVPE------DTSTNPMMERLKQGAACNVLYVNSVEMESLTGPQAVAKAISETLAAAAPPTATIVHFKVSSQGITLTDNQRKLFFRRHYPTNTVTFCDTDPQDRKWNKPEG-----GVAKLFGFVARKQGSTTDNVTHLFAELEPGQPASAIVNFVSKMI 1731          
BLAST of Tensin 3 vs. Ensembl Medaka
Match: TNS3 (tensin-3 [Source:NCBI gene;Acc:101166465])

HSP 1 Score: 221.861 bits (564), Expect = 2.783e-60
Identity = 124/286 (43.36%), Postives = 174/286 (60.84%), Query Frame = 1
Query: 1270 LRKSAKIWYQPNMSREEAVKTLKGKPPGSFVVRQSHTFNNSYGLAVNV--PRTSTVEDDDR-------CVRHFLIESNTKGVRIRGCSNEPYFGSLTALVHQHTLTKLALPCCLILPIXXXXXXXXXXXXXXCNKNNTPKVSSLFAPKTFSALYLGSIDTESLTGAAALSKAVEILLENKTEVKQTEVSIRISPEGLTLTDVLRKLFFRRHYPLNSISYCGTE-NSTYWDSAETRSRGFAKSKIFGFVARKTGT-TENMCHLLCEWHPQDNSRAITNFISCCVPGT 2094
            ++ ++K WY+P++SR++A+  LK K PGSF+VR SH+F  +YGLA+ V  P  + ++   +        VRHFLIE   KGVR++GC NEPYFGSLTALV QH++T LALPC LILP  +   +   S   +   +    +    A   +   YLGS++ ESLTG  A+ KA  + L        T V  ++S +G+TLTD  RKLFFRRHY +N++ +C  +     W    TR  G + +KIFGFVARK+ + TENMCHL  E  P+  + AI NF+S  + G+
Sbjct:  948 VQDTSKFWYKPDISRDQAIAVLKDKEPGSFIVRDSHSFRGAYGLAMKVATPPPTVLQHSKKGGDLSNELVRHFLIECTPKGVRLKGCPNEPYFGSLTALVCQHSITPLALPCRLILPDRDPVEELSDSPAQTATNSAADLLKQGAACNVW---YLGSVELESLTGHQAVQKATTVTLTMDPPPPSTVVHFKVSAQGITLTDNQRKLFFRRHYAVNTVIFCSLDPQGRKW----TRDSG-STAKIFGFVARKSQSDTENMCHLFAEHDPEQPASAIVNFVSKVMIGS 1225          
BLAST of Tensin 3 vs. Planmine SMEST
Match: SMESG000019881.1 (SMESG000019881.1)

HSP 1 Score: 1419.83 bits (3674), Expect = 0.000e+0
Identity = 696/698 (99.71%), Postives = 696/698 (99.71%), Query Frame = 1
Query:    1 MMITASLARAPLVERSNSQSNLEMTPRHARNTNWHSEEKKRLQRTRSLLDEKDKYLTEQLRRIQARSGVRDIRDGSAMSPIGRPGSSHQILSDMVARYNSGTGKEYATASDWEEVRLFSDQHSSTSTRRATSEMEYPLRDMSVDRRNNSPVVGATSRRRPLIRHYSDRDEFSFARQRHNSDNHASRTGPSNRSYSPITNYRHLNGSPAQPDLPFDAPDDIPLMQRRNIRTNIHSARLPANNLINNEAAVGAKMRDRNIESLPMCHVPKVGGPLSPMTSNIDLPMMPVANLKESERARATPDMINKTRNSGFQIRADNSTRASGISYHDPDEAYLSSDSYPIVSRLTLSQSPSEQQANNKIPPLPNQRRVQHVHHRSDEMSNQNSSNISDRELDSLIGVQDPHNARSYNATVKSANHQNSQNSSLRKSAKIWYQPNMSREEAVKTLKGKPPGSFVVRQSHTFNNSYGLAVNVPRTSTVEDDDRCVRHFLIESNTKGVRIRGCSNEPYFGSLTALVHQHTLTKLALPCCLILPIXXXXXXXXXXXXXXCNKNNTPKVSSLFAPKTFSALYLGSIDTESLTGAAALSKAVEILLENKTEVKQTEVSIRISPEGLTLTDVLRKLFFRRHYPLNSISYCGTENSTYWDSAETRSRGFAKSKIFGFVARKTGTTENMCHLLCEWHPQDNSRAITNFISCCVPGT 2094
            MMITASLARAPLVERSNSQSNLEMTPRHARNTNWHSEEKKRLQRTRSLLDEKDKYLTEQLRRIQARSGVRDIRDGSAMSPIGRPGSS QILSDMVARYNSGTGKEY TASDWEEVRLFSDQHSSTSTRRATSEMEYPLRDMSVDRRNNSPVVGATSRRRPLIRHYSDRDEFSFARQRHNSDNHASRTGPSNRSYSPITNYRHLNGSPAQPDLPFDAPDDIPLMQRRNIRTNIHSARLPANNLINNEAAVGAKMRDRNIESLPMCHVPKVGGPLSPMTSNIDLPMMPVANLKESERARATPDMINKTRNSGFQIRADNSTRASGISYHDPDEAYLSSDSYPIVSRLTLSQSPSEQQANNKIPPLPNQRRVQHVHHRSDEMSNQNSSNISDRELDSLIGVQDPHNARSYNATVKSANHQNSQNSSLRKSAKIWYQPNMSREEAVKTLKGKPPGSFVVRQSHTFNNSYGLAVNVPRTSTVEDDDRCVRHFLIESNTKGVRIRGCSNEPYFGSLTALVHQHTLTKLALPCCLILPISESDLDDQQSSYDSCNKNNTPKVSSLFAPKTFSALYLGSIDTESLTGAAALSKAVEILLENKTEVKQTEVSIRISPEGLTLTDVLRKLFFRRHYPLNSISYCGTENSTYWDSAETRSRGFAKSKIFGFVARKTGTTENMCHLLCEWHPQDNSRAITNFISCCVPGT
Sbjct:  239 MMITASLARAPLVERSNSQSNLEMTPRHARNTNWHSEEKKRLQRTRSLLDEKDKYLTEQLRRIQARSGVRDIRDGSAMSPIGRPGSSQQILSDMVARYNSGTGKEYTTASDWEEVRLFSDQHSSTSTRRATSEMEYPLRDMSVDRRNNSPVVGATSRRRPLIRHYSDRDEFSFARQRHNSDNHASRTGPSNRSYSPITNYRHLNGSPAQPDLPFDAPDDIPLMQRRNIRTNIHSARLPANNLINNEAAVGAKMRDRNIESLPMCHVPKVGGPLSPMTSNIDLPMMPVANLKESERARATPDMINKTRNSGFQIRADNSTRASGISYHDPDEAYLSSDSYPIVSRLTLSQSPSEQQANNKIPPLPNQRRVQHVHHRSDEMSNQNSSNISDRELDSLIGVQDPHNARSYNATVKSANHQNSQNSSLRKSAKIWYQPNMSREEAVKTLKGKPPGSFVVRQSHTFNNSYGLAVNVPRTSTVEDDDRCVRHFLIESNTKGVRIRGCSNEPYFGSLTALVHQHTLTKLALPCCLILPISESDLDDQQSSYDSCNKNNTPKVSSLFAPKTFSALYLGSIDTESLTGAAALSKAVEILLENKTEVKQTEVSIRISPEGLTLTDVLRKLFFRRHYPLNSISYCGTENSTYWDSAETRSRGFAKSKIFGFVARKTGTTENMCHLLCEWHPQDNSRAITNFISCCVPGT 936          
BLAST of Tensin 3 vs. Planmine SMEST
Match: SMESG000060707.1 (SMESG000060707.1)

HSP 1 Score: 184.111 bits (466), Expect = 6.941e-49
Identity = 112/294 (38.10%), Postives = 160/294 (54.42%), Query Frame = 1
Query: 1240 ANHQNSQNSSLRKSAKIWYQPNMSREEAVKTLKGKPPGSFVVRQSHTFNNSYGLAVNV---PRTSTVEDDD---RCVRHFLIE-SNTKGVRIRGCSNEPYFGSLTALVHQHTLTKLALPCCLILP-----IXXXXXXXXXXXXXXCNKNNTPKVSSLFAPKT--FSALYLGSIDTESLTGAAALSKAVEILLENKTEVKQTEVSIRI-SPEGLTLTDVLRKLFFRRHYPLNSISYCGTENSTYWDSAET-RSRGFAKSKIFGFVARKTGTTENMCHLLCEWHPQDNSRAITNFI 2073
               QN    S+ +  K WYQP++SREEA+  LK   PG+F++R S+T++ +YGLA+ V   P+  TV+ DD     VRH+LIE S  +GV  +G   EP F SL+ LV  +T     LPC L+LP      +++    +          ++PK++SL       +S  YLG  D E +TG + ++KA+E LL N      TE  +RI S EG+ LTD+ RKLFFRRH+P +SI+YC  +        E  +S+G  K+KIFG + +     EN C L  E  P   +  I   I
Sbjct:  393 GQQQNLTLQSVEEKMKYWYQPHISREEAIAILKNCNPGNFLIRDSNTYSGAYGLAIKVAMIPQNVTVKSDDLESEKVRHYLIELSGNQGVSFKGFPEEPIFPSLSHLVLYYTHAASVLPCFLVLPDRPLDQTDNGKGIKTHVSSHSVIISSPKLNSLKKSDETGYSVYYLGCYDVEYITGPSVINKAIERLLGNIDARSFTECQMRINSGEGIVLTDLERKLFFRRHHPFSSITYCALDPKDRKIELEVCKSKGVKKTKIFGIIVKAYMAGENKCFLFGELDPSHKAHLIVKII 686          
BLAST of Tensin 3 vs. Planmine SMEST
Match: SMESG000060707.1 (SMESG000060707.1)

HSP 1 Score: 182.185 bits (461), Expect = 2.528e-47
Identity = 112/294 (38.10%), Postives = 160/294 (54.42%), Query Frame = 1
Query: 1240 ANHQNSQNSSLRKSAKIWYQPNMSREEAVKTLKGKPPGSFVVRQSHTFNNSYGLAVNV---PRTSTVEDDD---RCVRHFLIE-SNTKGVRIRGCSNEPYFGSLTALVHQHTLTKLALPCCLILP-----IXXXXXXXXXXXXXXCNKNNTPKVSSLFAPKT--FSALYLGSIDTESLTGAAALSKAVEILLENKTEVKQTEVSIRI-SPEGLTLTDVLRKLFFRRHYPLNSISYCGTENSTYWDSAET-RSRGFAKSKIFGFVARKTGTTENMCHLLCEWHPQDNSRAITNFI 2073
               QN    S+ +  K WYQP++SREEA+  LK   PG+F++R S+T++ +YGLA+ V   P+  TV+ DD     VRH+LIE S  +GV  +G   EP F SL+ LV  +T     LPC L+LP      +++    +          ++PK++SL       +S  YLG  D E +TG + ++KA+E LL N      TE  +RI S EG+ LTD+ RKLFFRRH+P +SI+YC  +        E  +S+G  K+KIFG + +     EN C L  E  P   +  I   I
Sbjct:  818 GQQQNLTLQSVEEKMKYWYQPHISREEAIAILKNCNPGNFLIRDSNTYSGAYGLAIKVAMIPQNVTVKSDDLESEKVRHYLIELSGNQGVSFKGFPEEPIFPSLSHLVLYYTHAASVLPCFLVLPDRPLDQTDNGKGIKTHVSSHSVIISSPKLNSLKKSDETGYSVYYLGCYDVEYITGPSVINKAIERLLGNIDARSFTECQMRINSGEGIVLTDLERKLFFRRHHPFSSITYCALDPKDRKIELEVCKSKGVKKTKIFGIIVKAYMAGENKCFLFGELDPSHKAHLIVKII 1111          
BLAST of Tensin 3 vs. Planmine SMEST
Match: SMESG000029243.1 (SMESG000029243.1)

HSP 1 Score: 114.775 bits (286), Expect = 6.754e-26
Identity = 71/218 (32.57%), Postives = 113/218 (51.83%), Query Frame = 1
Query: 1288 IWYQPNMSREEAVKTLKGKPPGSFVVRQSHTFNNSYGLAVNVPRT---STVEDDDRCVRHFLIESNTKGVRIRGCSNEPYFGSLTALVHQHTLTKLALPCCLILPIXXXXXXXXXXXXXXCNKNNTPKVSSLFAPKTFSALYLGSIDTESLTGAAALSKAVEILLENKT-------EVKQTEVSIRISPEGLTLTDVLRKLFFRRHYPLNSISYCGTE 1911
            +WY+   +R+ A   L  KP G+FV+R S +   S  +A+    +   ST  DDD+ ++HF+I+ NT+G RIRG  NE Y+ +L  LV  HT   L LPC LILP +  D D    +   C ++ +   S L     F  +YLGS    + T  A ++ A++ L E  T       +    +++++   + +  TD+ +K F R++   N I YCG +
Sbjct:  722 LWYRHYFTRQTATMYLLNKPVGNFVIRPSTSLWKSLSIALKYSTSIFNSTNSDDDKHIKHFIIDINTEGYRIRGFVNEKYYKTLPMLVQDHTENHLGLPCNLILPENNCDDDFNVHNNFECAEHYSL-TSDL---NDFQVIYLGSFILSNTTENATIASAIDKLQEKFTHFPISLNDFPHNKLNLKFRTDRIIFTDIKKKFFLRKYCKFNDIIYCGVD 935          
BLAST of Tensin 3 vs. Planmine SMEST
Match: SMESG000033851.1 (SMESG000033851.1)

HSP 1 Score: 108.227 bits (269), Expect = 6.229e-24
Identity = 91/311 (29.26%), Postives = 141/311 (45.34%), Query Frame = 1
Query: 1288 IWYQPNMSREEAVKTLKGKPPGSFVVRQSHTFNNSYGLAVNV---PRTSTVEDDDR--CVRHFLI----ESNTKGVRIRGCSNEPYFGSLTALVHQHTLTKLALPCCLILPIXXX-----------XXXXXXXXXXXCNKNNTPKVSSL-FAPKTFSALYLGSIDTES--------LTGAAALSKAVEILLENKTEVKQ-------------TEVSIRI-SPEGLTLTDVLRKLFFRRHYPLNSISYCGTENST-YWDSAETRSRGFAKSKIFGFVARKTGTT--ENMCHLLCEWHPQDNSRAITNFISCC 2082
            +WYQP+++RE+ +  L+ K  GSF++R S TF  +YGLA+ V   P  +   +D +   +RHFLI    ES+  GVR++G  NEP + SL  LV  H     +LP  LI+    S                Q      +++ + +   L  A ++ S+  +  ID+          +T A  L K     LE K  + Q             T V IR+ S  G+T TD ++ LF+ R +P   +     ++    + S   ++ G  + +I G V RK      EN  HLLCE    D S  ++N I+  
Sbjct:  516 LWYQPHLNREDVINALRDKETGSFIIRNSSTFVGAYGLALKVASLPENAIRTNDSQGDLIRHFLIETVEESSGSGVRLKGLPNEPIYPSLAHLVQDHCQNARSLPTKLIVSSQSSIRLDQVDGGGMAQSHYQYESQQKHQSGSSRAQMLSTAHRSMSSPGVNFIDSNHPNPLHQCLVTTALYLGKFDVDRLEGKAAIDQAINKLFGKKNPKTTTVEIRLDSTNGITFTDKVQLLFYTRQFPAQHVLSADYDSQLREFSSPILQNNGLNRGRIIGIVIRKNKIILRENAVHLLCEL---DRSNDVSNIITFI 823          
The following BLAST results are available for this feature:
BLAST of Tensin 3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TNS13.656e-6141.94tensin 1 [Source:HGNC Symbol;Acc:HGNC:11973][more]
TNS11.160e-6041.94tensin 1 [Source:HGNC Symbol;Acc:HGNC:11973][more]
TNS33.137e-6043.25tensin 3 [Source:HGNC Symbol;Acc:HGNC:21616][more]
TNS15.021e-6042.09tensin 1 [Source:HGNC Symbol;Acc:HGNC:11973][more]
TNS15.021e-6042.09tensin 1 [Source:HGNC Symbol;Acc:HGNC:11973][more]
back to top
BLAST of Tensin 3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tns-13.960e-5637.46TeNSin homolog [Source:UniProtKB/TrEMBL;Acc:H2L04... [more]
tns-13.434e-5537.46TeNSin homolog [Source:UniProtKB/TrEMBL;Acc:H2L04... [more]
tns-13.434e-5537.46TeNSin homolog [Source:UniProtKB/TrEMBL;Acc:H2L04... [more]
tns-14.275e-5437.05TeNSin homolog [Source:UniProtKB/TrEMBL;Acc:H2L04... [more]
tns-11.856e-5237.81TeNSin homolog [Source:UniProtKB/TrEMBL;Acc:H2L04... [more]
back to top
BLAST of Tensin 3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
by6.198e-5038.32gene:FBgn0000244 transcript:FBtr0302382[more]
by6.198e-5038.32gene:FBgn0000244 transcript:FBtr0082119[more]
by6.198e-5038.32gene:FBgn0000244 transcript:FBtr0301093[more]
CG339931.332e-1035.64gene:FBgn0053993 transcript:FBtr0301034[more]
CG339932.923e-1035.64gene:FBgn0053993 transcript:FBtr0100046[more]
back to top
BLAST of Tensin 3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tns3.21.739e-6142.66tensin 3, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-... [more]
tns1b2.199e-6139.79tensin 1b [Source:ZFIN;Acc:ZDB-GENE-030131-6933][more]
tns1b1.113e-6040.14tensin 1b [Source:ZFIN;Acc:ZDB-GENE-030131-6933][more]
tns1a3.700e-5940.91tensin 1a [Source:ZFIN;Acc:ZDB-GENE-120215-32][more]
tns1a3.908e-5940.91tensin 1a [Source:ZFIN;Acc:ZDB-GENE-120215-32][more]
back to top
BLAST of Tensin 3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
adamts128.579e-6140.07ADAM metallopeptidase with thrombospondin type 1 m... [more]
TNS33.317e-6036.31tensin 3 [Source:NCBI gene;Acc:100492216][more]
adamts126.294e-6039.78ADAM metallopeptidase with thrombospondin type 1 m... [more]
adamts126.478e-6039.78ADAM metallopeptidase with thrombospondin type 1 m... [more]
adamts121.514e-5939.78ADAM metallopeptidase with thrombospondin type 1 m... [more]
back to top
BLAST of Tensin 3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tns13.259e-6336.27tensin 1 [Source:MGI Symbol;Acc:MGI:104552][more]
Tns12.029e-6036.36tensin 1 [Source:MGI Symbol;Acc:MGI:104552][more]
Tns12.406e-6036.27tensin 1 [Source:MGI Symbol;Acc:MGI:104552][more]
Tns13.844e-6036.27tensin 1 [Source:MGI Symbol;Acc:MGI:104552][more]
Tns14.563e-6036.53tensin 1 [Source:MGI Symbol;Acc:MGI:104552][more]
back to top
BLAST of Tensin 3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q04205|TENS_CHICK1.101e-5940.21Tensin OS=Gallus gallus OX=9031 GN=TNS PE=1 SV=2[more]
sp|Q68CZ2|TENS3_HUMAN1.507e-5943.25Tensin-3 OS=Homo sapiens OX=9606 GN=TNS3 PE=1 SV=2[more]
sp|Q9GLM4|TENS1_BOVIN3.413e-5940.86Tensin-1 OS=Bos taurus OX=9913 GN=TNS1 PE=2 SV=1[more]
sp|Q9HBL0|TENS1_HUMAN3.437e-5941.94Tensin-1 OS=Homo sapiens OX=9606 GN=TNS1 PE=1 SV=2[more]
sp|Q5SSZ5|TENS3_MOUSE1.836e-5841.36Tensin-3 OS=Mus musculus OX=10090 GN=Tns3 PE=1 SV=... [more]
back to top
BLAST of Tensin 3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0J7KKW93.261e-6441.42Tensin-1 isoform x14 OS=Lasius niger OX=67767 GN=R... [more]
A0A1A8E6509.054e-6444.84Tensin 3 (Fragment) OS=Nothobranchius kadleci OX=1... [more]
V3ZZ484.459e-6341.84SH2 domain-containing protein OS=Lottia gigantea O... [more]
A0A1A8LH234.780e-6343.90Tensin 3 (Fragment) OS=Nothobranchius pienaari OX=... [more]
A0A1A8GNN42.212e-6243.55Tensin 3 (Fragment) OS=Nothobranchius korthausae O... [more]
back to top
BLAST of Tensin 3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000049936.11.438e-6442.86pep primary_assembly:Astyanax_mexicanus-2.0:13:818... [more]
TNS31.143e-6243.86tensin-3 [Source:NCBI gene;Acc:103027377][more]
tns1b1.991e-6139.73tensin 1b [Source:ZFIN;Acc:ZDB-GENE-030131-6933][more]
ENSAMXT00000013817.22.198e-6142.45pep primary_assembly:Astyanax_mexicanus-2.0:13:818... [more]
tns2b2.190e-5639.64tensin 2b [Source:ZFIN;Acc:ZDB-GENE-101001-5][more]
back to top
BLAST of Tensin 3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
TNS13.743e-6142.11tensin 1 [Source:HGNC Symbol;Acc:HGNC:11973][more]
ENSPMAT00000001958.12.209e-6041.35pep scaffold:Pmarinus_7.0:GL480048:14054:23824:1 g... [more]
ENSPMAT00000005743.14.727e-5941.76pep scaffold:Pmarinus_7.0:GL478791:187748:191319:1... [more]
ENSPMAT00000003653.11.401e-5840.29pep scaffold:Pmarinus_7.0:GL476944:428913:445548:-... [more]
back to top
BLAST of Tensin 3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tensin 3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO457834.433e-5337.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO276823.557e-631.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tensin 3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000002849.21.389e-6240.86pep primary_assembly:ASM223467v1:2:14075704:140850... [more]
tns1b2.872e-6141.64tensin-1 [Source:NCBI gene;Acc:101155555][more]
ENSORLT00000002851.23.014e-6140.86pep primary_assembly:ASM223467v1:2:14075704:140871... [more]
tns1b3.106e-6141.64tensin-1 [Source:NCBI gene;Acc:101155555][more]
TNS32.783e-6043.36tensin-3 [Source:NCBI gene;Acc:101166465][more]
back to top
BLAST of Tensin 3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000019881.10.000e+099.71SMESG000019881.1[more]
SMESG000060707.16.941e-4938.10SMESG000060707.1[more]
SMESG000060707.12.528e-4738.10SMESG000060707.1[more]
SMESG000029243.16.754e-2632.57SMESG000029243.1[more]
SMESG000033851.16.229e-2429.26SMESG000033851.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011961 ID=SMED30011961|Name=Tensin 3|organism=Schmidtea mediterranea sexual|type=transcript|length=2247bp
ATGATGATTACAGCTTCCTTAGCAAGAGCACCGCTGGTTGAGCGCTCCAA
TAGCCAATCTAATTTAGAAATGACGCCAAGACATGCTAGAAATACTAACT
GGCATTCTGAAGAAAAAAAACGCTTGCAAAGAACAAGATCATTACTGGAT
GAAAAAGACAAATATCTTACAGAGCAACTAAGGAGAATTCAGGCGAGATC
TGGAGTGAGGGATATCAGAGATGGAAGTGCTATGTCTCCGATTGGACGGC
CGGGTAGTAGTCATCAAATACTTAGTGATATGGTTGCCCGTTATAATAGT
GGTACAGGTAAGGAATATGCTACCGCTTCAGATTGGGAAGAAGTCAGATT
ATTCTCTGATCAGCATTCCTCTACTAGCACTAGAAGAGCTACGTCCGAAA
TGGAATATCCTCTACGTGACATGTCTGTCGATAGAAGAAACAATAGTCCA
GTAGTTGGAGCTACCTCAAGGCGTAGGCCACTTATACGCCACTATTCTGA
TAGAGATGAATTCTCCTTTGCTCGTCAGCGACACAATTCGGATAACCACG
CCTCTCGGACTGGACCAAGCAATCGATCTTACAGTCCCATCACAAATTAC
CGGCATTTGAATGGATCTCCGGCACAACCAGATTTACCATTTGATGCTCC
AGACGATATTCCATTAATGCAGAGACGTAATATTCGCACAAATATCCACT
CAGCTCGACTCCCGGCTAATAATCTCATTAACAATGAAGCTGCAGTTGGG
GCTAAAATGAGAGATCGAAACATTGAAAGTCTTCCTATGTGTCATGTTCC
CAAAGTCGGGGGACCCTTGTCTCCTATGACATCAAACATTGATTTACCAA
TGATGCCTGTTGCAAACCTCAAAGAATCAGAACGAGCACGAGCAACTCCG
GATATGATAAATAAAACAAGAAATTCAGGTTTTCAAATTAGAGCAGACAA
TTCAACCAGAGCCAGTGGAATTTCTTACCATGATCCGGATGAAGCTTATT
TATCCAGTGACAGCTATCCTATCGTTTCCCGGTTGACACTTTCTCAATCT
CCTTCCGAACAGCAGGCTAACAACAAGATTCCACCGCTTCCAAACCAACG
AAGAGTCCAGCATGTCCATCACAGATCAGATGAAATGTCTAATCAAAATT
CAAGCAATATCAGTGACAGAGAGTTGGACAGTCTGATTGGTGTACAAGAT
CCACACAATGCTCGATCATACAATGCCACAGTGAAATCAGCAAATCACCA
GAATTCTCAGAACTCATCTCTTAGAAAATCTGCCAAAATTTGGTATCAGC
CAAATATGTCGCGAGAGGAAGCTGTGAAAACCTTGAAAGGGAAACCGCCA
GGCAGTTTCGTTGTCCGCCAAAGTCATACGTTCAACAACTCGTATGGTCT
CGCCGTCAATGTTCCAAGAACCAGCACCGTGGAAGACGATGACAGATGCG
TCAGACACTTTCTAATCGAATCTAACACAAAAGGCGTTCGAATTAGAGGA
TGTTCTAACGAGCCTTATTTCGGATCTTTGACGGCATTAGTCCATCAGCA
TACCCTCACCAAACTTGCGTTACCATGTTGCCTAATTCTGCCAATATCTG
AATCAGACCTTGATGATCAGCAATCCTCATATGACTCCTGCAATAAAAAT
AATACTCCTAAAGTTTCATCATTATTTGCTCCGAAAACTTTCTCTGCTTT
GTATTTGGGAAGCATTGACACGGAATCACTGACTGGGGCGGCAGCCCTGA
GCAAAGCTGTTGAAATTCTGTTAGAGAATAAGACCGAAGTGAAACAGACT
GAAGTCAGTATTCGAATATCTCCGGAAGGATTGACTTTAACAGATGTTTT
ACGGAAGTTGTTCTTCCGCCGACATTATCCACTGAATTCAATCTCTTATT
GTGGAACAGAAAATTCGACTTATTGGGATTCAGCTGAGACCAGATCCAGA
GGCTTCGCAAAATCAAAAATATTTGGCTTCGTGGCTAGGAAGACGGGCAC
TACTGAGAACATGTGCCACCTATTGTGTGAATGGCACCCACAAGACAATT
CAAGAGCAATTACAAATTTCATTTCTTGTTGTGTTCCAGGAACGTGAGAA
GTTTCCAGCATGCGTGTCATGCATGATTTGTCTTCTCCAGCCTCGTGCCT
CTATGTATTATCTAATGAACTGGGAGCTCCTTCTAATTGCAAACGGTCCC
AGTTGTCAATAATTCCTAACCTAGAGTCCTATTAACAAAAAAATAGA
back to top

protein sequence of SMED30011961-orf-1

>SMED30011961-orf-1 ID=SMED30011961-orf-1|Name=SMED30011961-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=699bp
MMITASLARAPLVERSNSQSNLEMTPRHARNTNWHSEEKKRLQRTRSLLD
EKDKYLTEQLRRIQARSGVRDIRDGSAMSPIGRPGSSHQILSDMVARYNS
GTGKEYATASDWEEVRLFSDQHSSTSTRRATSEMEYPLRDMSVDRRNNSP
VVGATSRRRPLIRHYSDRDEFSFARQRHNSDNHASRTGPSNRSYSPITNY
RHLNGSPAQPDLPFDAPDDIPLMQRRNIRTNIHSARLPANNLINNEAAVG
AKMRDRNIESLPMCHVPKVGGPLSPMTSNIDLPMMPVANLKESERARATP
DMINKTRNSGFQIRADNSTRASGISYHDPDEAYLSSDSYPIVSRLTLSQS
PSEQQANNKIPPLPNQRRVQHVHHRSDEMSNQNSSNISDRELDSLIGVQD
PHNARSYNATVKSANHQNSQNSSLRKSAKIWYQPNMSREEAVKTLKGKPP
GSFVVRQSHTFNNSYGLAVNVPRTSTVEDDDRCVRHFLIESNTKGVRIRG
CSNEPYFGSLTALVHQHTLTKLALPCCLILPISESDLDDQQSSYDSCNKN
NTPKVSSLFAPKTFSALYLGSIDTESLTGAAALSKAVEILLENKTEVKQT
EVSIRISPEGLTLTDVLRKLFFRRHYPLNSISYCGTENSTYWDSAETRSR
GFAKSKIFGFVARKTGTTENMCHLLCEWHPQDNSRAITNFISCCVPGT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
GO:0005829cytosol
GO:0005925focal adhesion
GO:0030054cell junction
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR036860SH2_dom_sf
IPR033929Tensin_PTB
IPR000980SH2
IPR006020PTB/PI_dom
IPR011993PH-like_dom_sf
IPR013625PTB
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: biological process
TermDefinition
GO:0008284positive regulation of cell proliferation
GO:0016477cell migration
GO:0048286lung alveolus development
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006020PTB/PI domainSMARTSM00462PTB_9coord: 559..698
e-value: 8.5E-5
score: 31.9
IPR000980SH2 domainSMARTSM00252SH2_5coord: 429..523
e-value: 5.6E-20
score: 82.4
IPR000980SH2 domainPFAMPF00017SH2coord: 431..517
e-value: 3.1E-11
score: 43.2
IPR000980SH2 domainPROSITEPS50001SH2coord: 431..532
score: 14.957
IPR036860SH2 domain superfamilyGENE3DG3DSA:3.30.505.10coord: 427..529
e-value: 8.1E-32
score: 111.8
IPR036860SH2 domain superfamilySUPERFAMILYSSF55550SH2 domaincoord: 429..537
IPR011993PH-like domain superfamilyGENE3DG3DSA:2.30.29.30coord: 556..698
e-value: 1.3E-42
score: 147.0
IPR013625Tensin/EPS8 phosphotyrosine-binding domainPFAMPF08416PTBcoord: 567..695
e-value: 5.0E-19
score: 68.8
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 16..40
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 173..193
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 347..364
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 347..389
NoneNo IPR availablePANTHERPTHR45734FAMILY NOT NAMEDcoord: 43..693
NoneNo IPR availableSUPERFAMILYSSF50729PH domain-likecoord: 563..691
IPR033929Tensin, phosphotyrosine-binding domainCDDcd01213PTB_tensincoord: 564..692
e-value: 1.10489E-45
score: 157.019