SMED30011955

Overview
NameSMED30011955
Smed IDSMED30011955
Length (bp)2008
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30011955 (SMED30011955) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30011955 (SMED30011955) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30011955 (SMED30011955) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30011955 (SMED30011955) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011955

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30011955 dd_Smed_v4_13986_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30011955 vs. Ensembl Human
Match: REXO4 (REX4 homolog, 3'-5' exonuclease [Source:HGNC Symbol;Acc:HGNC:12820])

HSP 1 Score: 37.7354 bits (86), Expect = 6.230e-7
Identity = 21/81 (25.93%), Postives = 41/81 (50.62%), Query Frame = 1
Query:  859 GVNEKNEMVLLL-VCLIQYTGKIIFNSLITPRDKLKNYVTHVHGITEKMSRNQKDQYKSMEKIHELTTRKILVNHDLRNEL 1098
            GV  K E  +   V ++   GK +++  + P + + +Y T V GI  +  +  ++     +++ E+   +ILV H L N+L
Sbjct:  252 GVGPKGEESMAARVSIVNQYGKCVYDKYVKPTEPVTDYRTAVSGIRPENLKQGEELEVVQKEVAEMLKGRILVGHALHNDL 332          

HSP 2 Score: 36.5798 bits (83), Expect = 6.230e-7
Identity = 11/48 (22.92%), Postives = 31/48 (64.58%), Query Frame = 3
Query: 1203 LSILANEVWGIKMQKDNHSALEDTEAIRRIYLRIENDWKDGINNNEPI 1346
            L +L+ ++ G+++Q+  H +++D +A  R+Y+ ++ +W+    +  P+
Sbjct:  364 LRLLSEKILGLQVQQAEHCSIQDAQAAMRLYVMVKKEWESMARDRRPL 411          
BLAST of SMED30011955 vs. Ensembl Human
Match: REXO4 (REX4 homolog, 3'-5' exonuclease [Source:HGNC Symbol;Acc:HGNC:12820])

HSP 1 Score: 37.7354 bits (86), Expect = 6.230e-7
Identity = 21/81 (25.93%), Postives = 41/81 (50.62%), Query Frame = 1
Query:  859 GVNEKNEMVLLL-VCLIQYTGKIIFNSLITPRDKLKNYVTHVHGITEKMSRNQKDQYKSMEKIHELTTRKILVNHDLRNEL 1098
            GV  K E  +   V ++   GK +++  + P + + +Y T V GI  +  +  ++     +++ E+   +ILV H L N+L
Sbjct:  252 GVGPKGEESMAARVSIVNQYGKCVYDKYVKPTEPVTDYRTAVSGIRPENLKQGEELEVVQKEVAEMLKGRILVGHALHNDL 332          

HSP 2 Score: 36.5798 bits (83), Expect = 6.230e-7
Identity = 11/48 (22.92%), Postives = 31/48 (64.58%), Query Frame = 3
Query: 1203 LSILANEVWGIKMQKDNHSALEDTEAIRRIYLRIENDWKDGINNNEPI 1346
            L +L+ ++ G+++Q+  H +++D +A  R+Y+ ++ +W+    +  P+
Sbjct:  364 LRLLSEKILGLQVQQAEHCSIQDAQAAMRLYVMVKKEWESMARDRRPL 411          
BLAST of SMED30011955 vs. Ensembl Fly
Match: CG6833 (gene:FBgn0036405 transcript:FBtr0075774)

HSP 1 Score: 45.8246 bits (107), Expect = 3.489e-8
Identity = 34/125 (27.20%), Postives = 63/125 (50.40%), Query Frame = 1
Query:  805 RIAREEIRKSIIFINAEY---GVNEKNEMVLLLVCLIQYTGKIIFNSLITPRDKLKNYVTHVHGITEKMSRNQKDQYKSMEKIHELTTRKILVNHDLRNELLYSGVQANDLWGIQDIVIAKALIK 1170
            R+ ++  R  I+ ++ E    G N +++M L  V ++   G ++ +  + PR ++ +Y T V GI  +   N +D      ++ +L   +ILV H LRN+L   G++ +    I+D    K L K
Sbjct:  107 RMKKKAHRNRILAMDCEMVGVGHNTRDDM-LARVSIVNRMGHVLLDKYVKPRKEVTDYRTSVSGIRPQDIANGEDFAAVQNEVMKLIHGRILVGHGLRNDLAVLGIR-HPFHDIRDTSHYKPLCK 229          

HSP 2 Score: 31.9574 bits (71), Expect = 3.489e-8
Identity = 16/44 (36.36%), Postives = 22/44 (50.00%), Query Frame = 3
Query: 1185 NGHWFKLSILANEVWGIKMQKDNHSALEDTEAIRRIYLRIENDW 1316
            N H   L  L   V G ++Q   H+++ED  A   IY R+  DW
Sbjct:  233 NTHTPSLKRLTKAVLGQEIQTGEHNSVEDARAAMGIYNRVAVDW 276          
BLAST of SMED30011955 vs. Ensembl Fly
Match: CG6833 (gene:FBgn0036405 transcript:FBtr0302433)

HSP 1 Score: 45.8246 bits (107), Expect = 3.489e-8
Identity = 34/125 (27.20%), Postives = 63/125 (50.40%), Query Frame = 1
Query:  805 RIAREEIRKSIIFINAEY---GVNEKNEMVLLLVCLIQYTGKIIFNSLITPRDKLKNYVTHVHGITEKMSRNQKDQYKSMEKIHELTTRKILVNHDLRNELLYSGVQANDLWGIQDIVIAKALIK 1170
            R+ ++  R  I+ ++ E    G N +++M L  V ++   G ++ +  + PR ++ +Y T V GI  +   N +D      ++ +L   +ILV H LRN+L   G++ +    I+D    K L K
Sbjct:  107 RMKKKAHRNRILAMDCEMVGVGHNTRDDM-LARVSIVNRMGHVLLDKYVKPRKEVTDYRTSVSGIRPQDIANGEDFAAVQNEVMKLIHGRILVGHGLRNDLAVLGIR-HPFHDIRDTSHYKPLCK 229          

HSP 2 Score: 31.9574 bits (71), Expect = 3.489e-8
Identity = 16/44 (36.36%), Postives = 22/44 (50.00%), Query Frame = 3
Query: 1185 NGHWFKLSILANEVWGIKMQKDNHSALEDTEAIRRIYLRIENDW 1316
            N H   L  L   V G ++Q   H+++ED  A   IY R+  DW
Sbjct:  233 NTHTPSLKRLTKAVLGQEIQTGEHNSVEDARAAMGIYNRVAVDW 276          
BLAST of SMED30011955 vs. Ensembl Zebrafish
Match: rexo4 (REX4 homolog, 3'-5' exonuclease [Source:ZFIN;Acc:ZDB-GENE-050411-124])

HSP 1 Score: 45.8246 bits (107), Expect = 9.164e-8
Identity = 29/103 (28.16%), Postives = 52/103 (50.49%), Query Frame = 1
Query:  793 FLKKRIAREEIRKSIIFINAEYGVNEKNE-MVLLLVCLIQYTGKIIFNSLITPRDKLKNYVTHVHGITEKMSRNQKDQYKSMEKIHELTTRKILVNHDLRNEL 1098
             L K  A E + +++       GV  K E  +L  V L+ + GK I++  + P +K+ +Y T V GI     +N +D     +++ ++   +ILV H + N+L
Sbjct:   72 MLVKEHAFEGVTRAVAMDCEMVGVGYKGEDSILARVSLVNHFGKCIYDKYVKPTEKVTDYRTAVSGIRPDDIKNGEDIKTVQKEVAQILKGRILVGHAIHNDL 174          

HSP 2 Score: 30.8018 bits (68), Expect = 9.164e-8
Identity = 14/58 (24.14%), Postives = 30/58 (51.72%), Query Frame = 3
Query: 1212 LANEVWGIKMQKDNHSALEDTEAIRRIYLRIENDWKDGINNNEPIAKRVGSLEGYQRK 1385
            L  ++  +++Q+  HS+++D +A  R+Y  +   W+  +      A R G+ +   RK
Sbjct:  209 LCRQILNVQVQQGEHSSVQDAQATMRLYTMVRKQWEAELK-----AMRGGTFKKSPRK 261          
BLAST of SMED30011955 vs. Ensembl Zebrafish
Match: rexo4 (REX4 homolog, 3'-5' exonuclease [Source:ZFIN;Acc:ZDB-GENE-050411-124])

HSP 1 Score: 44.2838 bits (103), Expect = 2.995e-7
Identity = 29/103 (28.16%), Postives = 52/103 (50.49%), Query Frame = 1
Query:  793 FLKKRIAREEIRKSIIFINAEYGVNEKNE-MVLLLVCLIQYTGKIIFNSLITPRDKLKNYVTHVHGITEKMSRNQKDQYKSMEKIHELTTRKILVNHDLRNEL 1098
             L K  A E + +++       GV  K E  +L  V L+ + GK I++  + P +K+ +Y T V GI     +N +D     +++ ++   +ILV H + N+L
Sbjct:  220 MLVKEHAFEGVTRAVAMDCEMVGVGYKGEDSILARVSLVNHFGKCIYDKYVKPTEKVTDYRTAVSGIRPDDIKNGEDIKTVQKEVAQILKGRILVGHAIHNDL 322          

HSP 2 Score: 30.4166 bits (67), Expect = 2.995e-7
Identity = 10/38 (26.32%), Postives = 22/38 (57.89%), Query Frame = 3
Query: 1203 LSILANEVWGIKMQKDNHSALEDTEAIRRIYLRIENDW 1316
            L  L  ++  +++Q+  HS+++D +A  R+Y  +   W
Sbjct:  354 LRNLCRQILNVQVQQGEHSSVQDAQATMRLYTMVRKQW 391          
BLAST of SMED30011955 vs. Ensembl Mouse
Match: Rexo4 (REX4, 3'-5' exonuclease [Source:MGI Symbol;Acc:MGI:2684957])

HSP 1 Score: 40.0466 bits (92), Expect = 9.099e-8
Identity = 29/109 (26.61%), Postives = 55/109 (50.46%), Query Frame = 1
Query:  778 KYRKFFLKKRIAREEIRKSIIFINAEYGVNEKNE-MVLLLVCLIQYTGKIIFNSLITPRDKLKNYVTHVHGITEKMSRNQKDQYKSMEK-IHELTTRKILVNHDLRNEL 1098
            K R   L+K  A   + K++       GV  K E  +   V ++   GK +++  + P + + +Y T V GI  + +  Q ++++ ++K + E+   +ILV H L N+L
Sbjct:  235 KKRTISLEKEQAFGGLTKALALDCEMVGVGPKGEESIAARVSIVNQYGKCVYDKYVKPTEPVTDYRTAVSGIRPE-NLKQGEEFEVVKKEVAEMLKGRILVGHALHNDL 342          

HSP 2 Score: 36.5798 bits (83), Expect = 9.099e-8
Identity = 12/44 (27.27%), Postives = 28/44 (63.64%), Query Frame = 3
Query: 1203 LSILANEVWGIKMQKDNHSALEDTEAIRRIYLRIENDWKDGINN 1334
            L  L+ ++ GI++Q+  H +++D +A  R+Y+ ++ +W+    N
Sbjct:  374 LKRLSEKILGIRVQQAEHCSIQDAQAAMRLYVMVKREWESSTAN 417          
BLAST of SMED30011955 vs. Ensembl Mouse
Match: Rexo4 (REX4, 3'-5' exonuclease [Source:MGI Symbol;Acc:MGI:2684957])

HSP 1 Score: 39.6614 bits (91), Expect = 1.593e-7
Identity = 29/109 (26.61%), Postives = 55/109 (50.46%), Query Frame = 1
Query:  778 KYRKFFLKKRIAREEIRKSIIFINAEYGVNEKNE-MVLLLVCLIQYTGKIIFNSLITPRDKLKNYVTHVHGITEKMSRNQKDQYKSMEK-IHELTTRKILVNHDLRNEL 1098
            K R   L+K  A   + K++       GV  K E  +   V ++   GK +++  + P + + +Y T V GI  + +  Q ++++ ++K + E+   +ILV H L N+L
Sbjct:  212 KKRTISLEKEQAFGGLTKALALDCEMVGVGPKGEESIAARVSIVNQYGKCVYDKYVKPTEPVTDYRTAVSGIRPE-NLKQGEEFEVVKKEVAEMLKGRILVGHALHNDL 319          

HSP 2 Score: 36.1946 bits (82), Expect = 1.593e-7
Identity = 12/44 (27.27%), Postives = 28/44 (63.64%), Query Frame = 3
Query: 1203 LSILANEVWGIKMQKDNHSALEDTEAIRRIYLRIENDWKDGINN 1334
            L  L+ ++ GI++Q+  H +++D +A  R+Y+ ++ +W+    N
Sbjct:  351 LKRLSEKILGIRVQQAEHCSIQDAQAAMRLYVMVKREWESSTAN 394          
BLAST of SMED30011955 vs. Ensembl Mouse
Match: Rexo4 (REX4, 3'-5' exonuclease [Source:MGI Symbol;Acc:MGI:2684957])

HSP 1 Score: 40.0466 bits (92), Expect = 3.132e-7
Identity = 29/109 (26.61%), Postives = 55/109 (50.46%), Query Frame = 1
Query:  778 KYRKFFLKKRIAREEIRKSIIFINAEYGVNEKNE-MVLLLVCLIQYTGKIIFNSLITPRDKLKNYVTHVHGITEKMSRNQKDQYKSMEK-IHELTTRKILVNHDLRNEL 1098
            K R   L+K  A   + K++       GV  K E  +   V ++   GK +++  + P + + +Y T V GI  + +  Q ++++ ++K + E+   +ILV H L N+L
Sbjct:  212 KKRTISLEKEQAFGGLTKALALDCEMVGVGPKGEESIAARVSIVNQYGKCVYDKYVKPTEPVTDYRTAVSGIRPE-NLKQGEEFEVVKKEVAEMLKGRILVGHALHNDL 319          

HSP 2 Score: 34.6538 bits (78), Expect = 3.132e-7
Identity = 11/38 (28.95%), Postives = 26/38 (68.42%), Query Frame = 3
Query: 1203 LSILANEVWGIKMQKDNHSALEDTEAIRRIYLRIENDW 1316
            L  L+ ++ GI++Q+  H +++D +A  R+Y+ ++ +W
Sbjct:  326 LKRLSEKILGIRVQQAEHCSIQDAQAAMRLYVMVKREW 363          
BLAST of SMED30011955 vs. UniProt/SwissProt
Match: sp|Q4WHF8|REXO4_ASPFU (RNA exonuclease 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=rex4 PE=3 SV=1)

HSP 1 Score: 48.1358 bits (113), Expect = 5.764e-8
Identity = 21/80 (26.25%), Postives = 44/80 (55.00%), Query Frame = 1
Query:  859 GVNEKNEMVLLLVCLIQYTGKIIFNSLITPRDKLKNYVTHVHGITEKMSRNQKDQYKSMEKIHELTTRKILVNHDLRNEL 1098
            G N  N+  L  V ++ + G+ +++S + P++ + ++ THV GI+ K     +   +  + + E+   +ILV H + N+L
Sbjct:  127 GPNPDNDSALARVSIVNFNGEQVYDSYVRPKEMITDWRTHVSGISPKHMAEARSLEQVQKDVAEILDGRILVGHAVSNDL 206          

HSP 2 Score: 31.9574 bits (71), Expect = 5.764e-8
Identity = 15/38 (39.47%), Postives = 23/38 (60.53%), Query Frame = 3
Query: 1188 GHWFKLSILANEVWGIKMQKDNHSALEDTEAIRRIYLR 1301
            G   +L ILA+E  G+ +Q   HS++ED +A   +Y R
Sbjct:  233 GGSPRLKILASEFLGLNIQDGAHSSVEDAKATMLLYRR 270          
BLAST of SMED30011955 vs. UniProt/SwissProt
Match: sp|Q4IEV5|REXO4_GIBZE (RNA exonuclease 4 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) OX=229533 GN=REX4 PE=3 SV=1)

HSP 1 Score: 50.0618 bits (118), Expect = 6.661e-8
Identity = 25/75 (33.33%), Postives = 46/75 (61.33%), Query Frame = 1
Query:  874 NEMVLLLVCLIQYTGKIIFNSLITPRDKLKNYVTHVHGITEKMSRNQKDQYKSMEKIHELTTRKILVNHDLRNEL 1098
            +E  L  V ++ + G  I++S + P++K+ N+ T V GI++K  R  +D  +   +I +L   +ILV HDL+++L
Sbjct:  148 HESALARVSIVDFHGVQIYDSYVKPKEKVTNWRTAVSGISQKSMRFARDFEEVQAEIDKLLRGRILVGHDLKHDL 222          

HSP 2 Score: 30.0314 bits (66), Expect = 6.661e-8
Identity = 12/37 (32.43%), Postives = 22/37 (59.46%), Query Frame = 3
Query: 1185 NGHWFKLSILANEVWGIKMQKDNHSALEDTEAIRRIY 1295
            NG    L +LA ++ G+++Q   HS++ED  A   ++
Sbjct:  248 NGRKPSLRVLAQQLLGVEIQGGEHSSIEDARATMLLF 284          
BLAST of SMED30011955 vs. UniProt/SwissProt
Match: sp|Q6PAQ4|REXO4_MOUSE (RNA exonuclease 4 OS=Mus musculus OX=10090 GN=Rexo4 PE=2 SV=2)

HSP 1 Score: 40.0466 bits (92), Expect = 5.528e-7
Identity = 29/109 (26.61%), Postives = 55/109 (50.46%), Query Frame = 1
Query:  778 KYRKFFLKKRIAREEIRKSIIFINAEYGVNEKNE-MVLLLVCLIQYTGKIIFNSLITPRDKLKNYVTHVHGITEKMSRNQKDQYKSMEK-IHELTTRKILVNHDLRNEL 1098
            K R   L+K  A   + K++       GV  K E  +   V ++   GK +++  + P + + +Y T V GI  + +  Q ++++ ++K + E+   +ILV H L N+L
Sbjct:  235 KKRTISLEKEQAFGGLTKALALDCEMVGVGPKGEESIAARVSIVNQYGKCVYDKYVKPTEPVTDYRTAVSGIRPE-NLKQGEEFEVVKKEVAEMLKGRILVGHALHNDL 342          

HSP 2 Score: 36.5798 bits (83), Expect = 5.528e-7
Identity = 12/44 (27.27%), Postives = 28/44 (63.64%), Query Frame = 3
Query: 1203 LSILANEVWGIKMQKDNHSALEDTEAIRRIYLRIENDWKDGINN 1334
            L  L+ ++ GI++Q+  H +++D +A  R+Y+ ++ +W+    N
Sbjct:  374 LKRLSEKILGIRVQQAEHCSIQDAQAAMRLYVMVKREWESSTAN 417          
BLAST of SMED30011955 vs. UniProt/SwissProt
Match: sp|Q9GZR2|REXO4_HUMAN (RNA exonuclease 4 OS=Homo sapiens OX=9606 GN=REXO4 PE=1 SV=2)

HSP 1 Score: 37.7354 bits (86), Expect = 2.741e-6
Identity = 21/81 (25.93%), Postives = 41/81 (50.62%), Query Frame = 1
Query:  859 GVNEKNEMVLLL-VCLIQYTGKIIFNSLITPRDKLKNYVTHVHGITEKMSRNQKDQYKSMEKIHELTTRKILVNHDLRNEL 1098
            GV  K E  +   V ++   GK +++  + P + + +Y T V GI  +  +  ++     +++ E+   +ILV H L N+L
Sbjct:  252 GVGPKGEESMAARVSIVNQYGKCVYDKYVKPTEPVTDYRTAVSGIRPENLKQGEELEVVQKEVAEMLKGRILVGHALHNDL 332          

HSP 2 Score: 36.5798 bits (83), Expect = 2.741e-6
Identity = 11/48 (22.92%), Postives = 31/48 (64.58%), Query Frame = 3
Query: 1203 LSILANEVWGIKMQKDNHSALEDTEAIRRIYLRIENDWKDGINNNEPI 1346
            L +L+ ++ G+++Q+  H +++D +A  R+Y+ ++ +W+    +  P+
Sbjct:  364 LRLLSEKILGLQVQQAEHCSIQDAQAAMRLYVMVKKEWESMARDRRPL 411          
BLAST of SMED30011955 vs. TrEMBL
Match: A0A1L9TEM6 (Exonuclease domain-containing protein OS=Aspergillus sydowii CBS 593.65 OX=1036612 GN=ASPSYDRAFT_203580 PE=4 SV=1)

HSP 1 Score: 53.1434 bits (126), Expect = 6.185e-8
Identity = 25/80 (31.25%), Postives = 45/80 (56.25%), Query Frame = 1
Query:  859 GVNEKNEMVLLLVCLIQYTGKIIFNSLITPRDKLKNYVTHVHGITEKMSRNQKDQYKSMEKIHELTTRKILVNHDLRNEL 1098
            G N  N+ VL  + ++ Y G  +++S + P++ + ++ THV GIT K     +      +++ E+   +ILV H LRN+L
Sbjct:  555 GPNPDNDSVLARISIVNYNGDQVYDSYVRPKEMVTDWRTHVSGITPKHMVEARSLELVQKEVAEILDGRILVGHALRNDL 634          

HSP 2 Score: 34.6538 bits (78), Expect = 6.185e-8
Identity = 16/43 (37.21%), Postives = 29/43 (67.44%), Query Frame = 3
Query: 1188 GHWFKLSILANEVWGIKMQKDNHSALEDTEAIRRIYLRIENDW 1316
            G   +L ILA+E  G+K+Q+  HS++ED +A   +Y R ++++
Sbjct:  661 GGSPRLKILASEFLGLKIQEGAHSSVEDAKATMLLYRRDKDEF 703          
BLAST of SMED30011955 vs. TrEMBL
Match: F6YYD7 (Exonuclease domain-containing protein OS=Ornithorhynchus anatinus OX=9258 PE=4 SV=2)

HSP 1 Score: 46.2098 bits (108), Expect = 9.206e-8
Identity = 26/81 (32.10%), Postives = 43/81 (53.09%), Query Frame = 1
Query:  859 GVNEKNE-MVLLLVCLIQYTGKIIFNSLITPRDKLKNYVTHVHGITEKMSRNQKDQYKSMEKIHELTTRKILVNHDLRNEL 1098
            GV  + E  VL  V ++   GK +++  + P +K+ +Y T V GI  +  RN +D     +++  L   +ILV H L N+L
Sbjct:  220 GVGAQGEESVLARVSIVNQFGKCVYDKFVKPTEKVTDYRTTVSGIRPEDVRNGEDYRVVQQEVANLLKGRILVGHALHNDL 300          

HSP 2 Score: 41.2022 bits (95), Expect = 9.206e-8
Identity = 15/52 (28.85%), Postives = 30/52 (57.69%), Query Frame = 3
Query: 1203 LSILANEVWGIKMQKDNHSALEDTEAIRRIYLRIENDWKDGINNNEPIAKRV 1358
            L +L  ++ G+K+QK  H +++D +A  R+Y  ++  W+  + N   + KR 
Sbjct:  332 LKLLCEKLLGVKVQKAEHCSVQDAQAAMRLYTMVKRQWETAVQNRYKVGKRA 383          
BLAST of SMED30011955 vs. TrEMBL
Match: A0A1L9SLG0 (Exonuclease domain-containing protein OS=Penicilliopsis zonata CBS 506.65 OX=1073090 GN=ASPZODRAFT_158807 PE=4 SV=1)

HSP 1 Score: 55.4546 bits (132), Expect = 1.157e-7
Identity = 24/80 (30.00%), Postives = 46/80 (57.50%), Query Frame = 1
Query:  859 GVNEKNEMVLLLVCLIQYTGKIIFNSLITPRDKLKNYVTHVHGITEKMSRNQKDQYKSMEKIHELTTRKILVNHDLRNEL 1098
            G N  N+  L  V ++ Y G+ +++S + P++ + ++ THV GI+ K   N +   +  + + E+   ++LV H LRN+L
Sbjct:  547 GPNPDNDSALARVSIVNYNGEQVYDSYVRPKEMVTDWRTHVSGISPKHMVNARSLEQVQKDVAEILDGRVLVGHALRNDL 626          

HSP 2 Score: 31.5722 bits (70), Expect = 1.157e-7
Identity = 15/38 (39.47%), Postives = 23/38 (60.53%), Query Frame = 3
Query: 1188 GHWFKLSILANEVWGIKMQKDNHSALEDTEAIRRIYLR 1301
            G   +L ILA+E  G+ +Q+  HS++ED  A   +Y R
Sbjct:  653 GGSPRLKILASEFLGLTIQEGAHSSVEDARATMLLYRR 690          
BLAST of SMED30011955 vs. TrEMBL
Match: A0A0W4ZVC4 (Exonuclease domain-containing protein OS=Pneumocystis jirovecii (strain RU7) OX=1408657 GN=T551_00416 PE=4 SV=1)

HSP 1 Score: 58.151 bits (139), Expect = 1.731e-7
Identity = 25/82 (30.49%), Postives = 50/82 (60.98%), Query Frame = 1
Query:  853 EYGVNEKNEMVLLLVCLIQYTGKIIFNSLITPRDKLKNYVTHVHGITEKMSRNQKDQYKSMEKIHELTTRKILVNHDLRNEL 1098
            + G + K + VL  + ++ Y G +IF++ + P++++ +Y TH++GIT+   +N     +   K+ +L   +ILV H L+N+L
Sbjct:  105 QVGPSNKKDRVLARISIVNYYGNVIFDTFVKPKERVIDYKTHINGITQADLKNAPSFEEVQSKVADLLKNRILVGHSLKNDL 186          

HSP 2 Score: 28.4906 bits (62), Expect = 1.731e-7
Identity = 13/37 (35.14%), Postives = 22/37 (59.46%), Query Frame = 3
Query: 1203 LSILANEVWGIKMQKDNHSALEDTEAIRRIYLRIEND 1313
            L  LA E+  + +Q D HS++ED  A   +Y R +++
Sbjct:  218 LKKLAKEILNMTIQNDVHSSIEDARAAMLLYRRYKHE 254          
BLAST of SMED30011955 vs. TrEMBL
Match: L0PF05 (Exonuclease domain-containing protein OS=Pneumocystis jirovecii (strain SE8) OX=1209962 GN=PNEJI1_000452 PE=4 SV=1)

HSP 1 Score: 57.7658 bits (138), Expect = 1.834e-7
Identity = 25/82 (30.49%), Postives = 50/82 (60.98%), Query Frame = 1
Query:  853 EYGVNEKNEMVLLLVCLIQYTGKIIFNSLITPRDKLKNYVTHVHGITEKMSRNQKDQYKSMEKIHELTTRKILVNHDLRNEL 1098
            + G + K + VL  + ++ Y G +IF++ + P++++ +Y TH++GIT+   +N     +   K+ +L   +ILV H L+N+L
Sbjct:   34 QVGPSNKKDRVLARISIVNYYGNVIFDTFVKPKERVIDYKTHINGITQADLKNAPSFEEVQSKVADLLKNRILVGHSLKNDL 115          

HSP 2 Score: 28.4906 bits (62), Expect = 1.834e-7
Identity = 13/38 (34.21%), Postives = 22/38 (57.89%), Query Frame = 3
Query: 1203 LSILANEVWGIKMQKDNHSALEDTEAIRRIYLRIENDW 1316
            L  LA E+  + +Q D HS++ED  A   +Y R +++ 
Sbjct:  147 LKKLAKEILNMTIQNDVHSSIEDARAAMLLYRRYKHEM 184          
BLAST of SMED30011955 vs. Ensembl Cavefish
Match: rexo4 (REX4 homolog, 3'-5' exonuclease [Source:NCBI gene;Acc:103042424])

HSP 1 Score: 38.1206 bits (87), Expect = 1.204e-7
Identity = 24/91 (26.37%), Postives = 47/91 (51.65%), Query Frame = 1
Query:  832 SIIFINAEY-GVN-EKNEMVLLLVCLIQYTGKIIFNSLITPRDKLKNYVTHVHGITEKMSRNQKDQYKSMEKIHELTTRKILVNHDLRNEL 1098
            S + ++ E  GV  +  E ++  V ++   GK +++  + P +K+ +Y T V GI  K   N +      +++ E+   +ILV H + N+L
Sbjct:  246 SAVAMDCEMVGVGPDGEESIVARVSIVNLFGKCVYDKYVKPTEKVTDYRTAVSGIRPKDIENGESFNTVQKEVAEILKGRILVGHAVHNDL 336          

HSP 2 Score: 38.1206 bits (87), Expect = 1.204e-7
Identity = 18/54 (33.33%), Postives = 32/54 (59.26%), Query Frame = 3
Query: 1203 LSILANEVWGIKMQKDNHSALEDTEAIRRIYLRIENDW----KDGINNNEPIAK 1352
            L +L  EV  +K+Q+  HS+++D +A  R+Y  +++ W    K    +N+P AK
Sbjct:  368 LRVLCQEVLHVKVQQGEHSSVQDAQATMRLYTLVKSQWEAELKASRGSNKPGAK 421          
BLAST of SMED30011955 vs. Ensembl Medaka
Match: rexo4 (REX4 homolog, 3'-5' exonuclease [Source:NCBI gene;Acc:101158141])

HSP 1 Score: 41.9726 bits (97), Expect = 4.852e-8
Identity = 23/81 (28.40%), Postives = 44/81 (54.32%), Query Frame = 1
Query:  859 GVNEKNE-MVLLLVCLIQYTGKIIFNSLITPRDKLKNYVTHVHGITEKMSRNQKDQYKSMEKIHELTTRKILVNHDLRNEL 1098
            GV    E  +L  V ++   GK I++  + P +K+ +Y T V GI  +  +N +D +   +++ E+   +I+V H + N+L
Sbjct:  265 GVGPDGEDSILARVSIVNQFGKCIYDKYVKPTEKVTDYRTAVSGIRPEHIKNGEDVHVVQKEVAEILQGRIVVGHAIHNDL 345          

HSP 2 Score: 35.4242 bits (80), Expect = 4.852e-8
Identity = 13/46 (28.26%), Postives = 26/46 (56.52%), Query Frame = 3
Query: 1179 TINGHWFKLSILANEVWGIKMQKDNHSALEDTEAIRRIYLRIENDW 1316
            T+      L +L  E+  +K+Q+  HS+++D +A  R+Y  ++  W
Sbjct:  369 TVGSGRPSLKLLCREILHVKVQQGEHSSVQDAQATMRLYTLVKKQW 414          
BLAST of SMED30011955 vs. Ensembl Medaka
Match: rexo4 (REX4 homolog, 3'-5' exonuclease [Source:NCBI gene;Acc:101158141])

HSP 1 Score: 41.9726 bits (97), Expect = 6.100e-8
Identity = 23/81 (28.40%), Postives = 44/81 (54.32%), Query Frame = 1
Query:  859 GVNEKNE-MVLLLVCLIQYTGKIIFNSLITPRDKLKNYVTHVHGITEKMSRNQKDQYKSMEKIHELTTRKILVNHDLRNEL 1098
            GV    E  +L  V ++   GK I++  + P +K+ +Y T V GI  +  +N +D +   +++ E+   +I+V H + N+L
Sbjct:  241 GVGPDGEDSILARVSIVNQFGKCIYDKYVKPTEKVTDYRTAVSGIRPEHIKNGEDVHVVQKEVAEILQGRIVVGHAIHNDL 321          

HSP 2 Score: 35.4242 bits (80), Expect = 6.100e-8
Identity = 13/46 (28.26%), Postives = 26/46 (56.52%), Query Frame = 3
Query: 1179 TINGHWFKLSILANEVWGIKMQKDNHSALEDTEAIRRIYLRIENDW 1316
            T+      L +L  E+  +K+Q+  HS+++D +A  R+Y  ++  W
Sbjct:  345 TVGSGRPSLKLLCREILHVKVQQGEHSSVQDAQATMRLYTLVKKQW 390          
BLAST of SMED30011955 vs. Planmine SMEST
Match: SMESG000065022.1 (SMESG000065022.1)

HSP 1 Score: 110.538 bits (275), Expect = 3.635e-35
Identity = 62/161 (38.51%), Postives = 100/161 (62.11%), Query Frame = 1
Query:  622 SKEIWQRQITAANGVACLILECRVKSSINYEVKRKFSIKEDNEFIPITVNMLKYRKFFLKKRIAREEIRKSIIFINAEYGVNEKNEMVLLLVCLIQYTGKIIFNSLITPRDKLKNYVTHVHGITEKMSRNQKDQYKSMEKIHELTTRKILVNHDLRNELLY 1104
            SKE+ ++ I AA   A + +E R+ + IN +V +   I ++  F+ I   +L+ +  FL+  +  +EIR+ I+FI+AEYG +E  EM+ L + +I Y  K++ +  I PR ++++YV+  +GI E  SRNQ DQY  + +I +LT  KILV +DL  EL Y
Sbjct:  193 SKELRKKTIRAAYDKATIAVELRIPNPIN-DVPKNEPIIDEPGFLSINDEILRQKHSFLRNSMTLDEIRQRILFIDAEYGTSETREMIPLSIPIIHYDRKVLKDVYIKPRMRIQHYVSFCNGINEVTSRNQLDQYTEIREIQKLTVWKILVEYDLHAELQY 352          

HSP 2 Score: 57.7658 bits (138), Expect = 3.635e-35
Identity = 27/45 (60.00%), Postives = 30/45 (66.67%), Query Frame = 3
Query: 1188 GHWFKLSILANEVWGIKMQKDNHSALEDTEAIRRIYLRIENDWKD 1322
            G WFKL  LA E+ G K Q   HS  EDT++IRRIY  IEN WKD
Sbjct:  358 GQWFKLQTLAEEICGEKTQPGFHSVKEDTKSIRRIYKTIENQWKD 402          
BLAST of SMED30011955 vs. Planmine SMEST
Match: SMESG000065022.1 (SMESG000065022.1)

HSP 1 Score: 105.531 bits (262), Expect = 1.391e-33
Identity = 58/151 (38.41%), Postives = 93/151 (61.59%), Query Frame = 1
Query:  652 AANGVACLILECRVKSSINYEVKRKFSIKEDNEFIPITVNMLKYRKFFLKKRIAREEIRKSIIFINAEYGVNEKNEMVLLLVCLIQYTGKIIFNSLITPRDKLKNYVTHVHGITEKMSRNQKDQYKSMEKIHELTTRKILVNHDLRNELLY 1104
            AA   A + +E R+ + IN +V +   I ++  F+ I   +L+ +  FL+  +  +EIR+ I+FI+AEYG +E  EM+ L + +I Y  K++ +  I PR ++++YV+  +GI E  SRNQ DQY  + +I +LT  KILV +DL  EL Y
Sbjct:   69 AAYDKATIAVELRIPNPIN-DVPKNEPIIDEPGFLSINDEILRQKHSFLRNSMTLDEIRQRILFIDAEYGTSETREMIPLSIPIIHYDRKVLKDVYIKPRMRIQHYVSFCNGINEVTSRNQLDQYTEIREIQKLTVWKILVEYDLHAELQY 218          

HSP 2 Score: 57.7658 bits (138), Expect = 1.391e-33
Identity = 27/45 (60.00%), Postives = 30/45 (66.67%), Query Frame = 3
Query: 1188 GHWFKLSILANEVWGIKMQKDNHSALEDTEAIRRIYLRIENDWKD 1322
            G WFKL  LA E+ G K Q   HS  EDT++IRRIY  IEN WKD
Sbjct:  224 GQWFKLQTLAEEICGEKTQPGFHSVKEDTKSIRRIYKTIENQWKD 268          
BLAST of SMED30011955 vs. Planmine SMEST
Match: SMESG000013248.1 (SMESG000013248.1)

HSP 1 Score: 126.716 bits (317), Expect = 5.886e-32
Identity = 69/170 (40.59%), Postives = 107/170 (62.94%), Query Frame = 1
Query:  652 AANGVACLILECRVKSSINYEVKRKFSIKED-NEFIPITVNMLKYRKFFLKKRIAREEIRKSIIFINAEYGVNEKNEMVLLLVCLIQYTGKIIFNSLITPRDKLKNYVTHVHGITEKMSRNQKDQYKSMEKIHELTTRKILVNHDLRNELLYSGVQANDLWGIQDIVIAK 1158
            AAN    LI E   +S+   EV   +S++      +PI+  MLK +  F++KR+  +EIR+ I+F++AEYG++E +EM+ L V ++ Y G++I +  IT R KL+ +   +HGITE+ S NQ+DQY+ M+ I  LT  KIL+ HDL+ E  Y  +  N L+GI+D   A+
Sbjct:    7 AAND-DVLIAEIARRSNSEGEVPSAYSVEYSYPRLLPISEEMLKRKLLFIRKRLTIDEIREKILFMDAEYGISEAHEMIQLSVAIMDYYGRVIEDVYITTRIKLQYFNASIHGITERNSPNQQDQYEEMKSIQNLTRGKILIGHDLQAERKYLKIWVNHLYGIRDFAAAQ 175          
BLAST of SMED30011955 vs. Planmine SMEST
Match: SMESG000031866.1 (SMESG000031866.1)

HSP 1 Score: 124.02 bits (310), Expect = 2.257e-29
Identity = 70/209 (33.49%), Postives = 127/209 (60.77%), Query Frame = 1
Query:  385 KDVKLLENLKVPNWARRGDEEMRVCLFEIERNRXXXXXXXXXXXXXXTWQLHVIRGTIEILNNDGTIWNEMPKRTSWKISKEIWQRQITAANGVACLILECRVKSSINYEVKRKFSIKEDNEFIPITVNMLKYRKFFLKKRIAREEIRKSIIFINAEYGVNEKNEMVLLLVCLIQYTGKIIFNSLITPRDKLKNYVTHVHGITEKMSRN 1011
            KD K + N  +PN+ R  D +M++ + ++ R  +LKL++E+   + +   +H++R TIE+LN +  +W E+ K TSWKI +E   + + AAN    + +E R +S  +   K   +   D+  +PI+ +++K +  F++K +  EEIR   +F++AEYG +E  +M+ L V ++ Y G ++ N+ +TP  +++++   VHGITE  SRN
Sbjct:  420 KDSKSIPN--IPNYLRIDDRKMKMKILKVHRQVELKLSKEIQISRREKGYVHIMRRTIEVLNGENQLWMELKKLTSWKIQRESVTKTMRAANEEVIIAIESRTESKAHEVPKAHPAENGDSTLLPISEDIVKKKMSFIRKEMGLEEIRDKKLFVDAEYGTSETGKMIPLTVAIMNYHGGVVKNTYLTPGRRIRHFNLRVHGITETSSRN 626          
BLAST of SMED30011955 vs. Planmine SMEST
Match: SMESG000034928.1 (SMESG000034928.1)

HSP 1 Score: 104.76 bits (260), Expect = 2.655e-26
Identity = 53/123 (43.09%), Postives = 80/123 (65.04%), Query Frame = 1
Query:  802 KRIAREEIRKSIIFINAEYGVNEKNEMVLLLVCLIQYTGKIIFNSLITPRDKLKNYVTHVHGITEKMSRNQKDQYKSMEKIHELTTRKILVNHDLRNELLYSGVQANDLWGIQDIVIAKALIK 1170
            K + +EEIR  I+FI+AEYG ++  +MV L   ++ Y GK I +  +TPR  L ++ + +HGITE  SRNQ DQY  M+++ +L   KIL++HDL  E+ Y  +  + L GI+D+  A+AL K
Sbjct: 1207 KEMNQEEIRSKILFIDAEYGSSKSKQMVPLSTAIMNYYGKTIKDVYLTPRGNLWHFNSQIHGITEVASRNQYDQYAIMKEVQKLVVGKILIDHDLHAEIQYLKLWIDHLHGIRDLATAQALEK 1329          

HSP 2 Score: 33.8834 bits (76), Expect = 2.655e-26
Identity = 17/44 (38.64%), Postives = 26/44 (59.09%), Query Frame = 3
Query: 1158 SINKKGVTINGHWFKLSILANEVWGIKMQKDNHSALEDTEAIRR 1289
            ++ K G+   G +FKL  +  E++G +M    HSALED   IR+
Sbjct: 1326 ALEKIGMFRRGEFFKLKTVVQEMFGDQMWVAIHSALEDVRNIRK 1369          
The following BLAST results are available for this feature:
BLAST of SMED30011955 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
REXO46.230e-725.93REX4 homolog, 3'-5' exonuclease [Source:HGNC Symbo... [more]
REXO46.230e-725.93REX4 homolog, 3'-5' exonuclease [Source:HGNC Symbo... [more]
back to top
BLAST of SMED30011955 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30011955 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG68333.489e-827.20gene:FBgn0036405 transcript:FBtr0075774[more]
CG68333.489e-827.20gene:FBgn0036405 transcript:FBtr0302433[more]
back to top
BLAST of SMED30011955 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rexo49.164e-828.16REX4 homolog, 3'-5' exonuclease [Source:ZFIN;Acc:Z... [more]
rexo42.995e-728.16REX4 homolog, 3'-5' exonuclease [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of SMED30011955 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30011955 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Rexo49.099e-826.61REX4, 3'-5' exonuclease [Source:MGI Symbol;Acc:MGI... [more]
Rexo41.593e-726.61REX4, 3'-5' exonuclease [Source:MGI Symbol;Acc:MGI... [more]
Rexo43.132e-726.61REX4, 3'-5' exonuclease [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of SMED30011955 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|Q4WHF8|REXO4_ASPFU5.764e-826.25RNA exonuclease 4 OS=Neosartorya fumigata (strain ... [more]
sp|Q4IEV5|REXO4_GIBZE6.661e-833.33RNA exonuclease 4 OS=Gibberella zeae (strain PH-1 ... [more]
sp|Q6PAQ4|REXO4_MOUSE5.528e-726.61RNA exonuclease 4 OS=Mus musculus OX=10090 GN=Rexo... [more]
sp|Q9GZR2|REXO4_HUMAN2.741e-625.93RNA exonuclease 4 OS=Homo sapiens OX=9606 GN=REXO4... [more]
back to top
BLAST of SMED30011955 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1L9TEM66.185e-831.25Exonuclease domain-containing protein OS=Aspergill... [more]
F6YYD79.206e-832.10Exonuclease domain-containing protein OS=Ornithorh... [more]
A0A1L9SLG01.157e-730.00Exonuclease domain-containing protein OS=Penicilli... [more]
A0A0W4ZVC41.731e-730.49Exonuclease domain-containing protein OS=Pneumocys... [more]
L0PF051.834e-730.49Exonuclease domain-containing protein OS=Pneumocys... [more]
back to top
BLAST of SMED30011955 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rexo41.204e-726.37REX4 homolog, 3'-5' exonuclease [Source:NCBI gene;... [more]
back to top
BLAST of SMED30011955 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30011955 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30011955 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30011955 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rexo44.852e-828.40REX4 homolog, 3'-5' exonuclease [Source:NCBI gene;... [more]
rexo46.100e-828.40REX4 homolog, 3'-5' exonuclease [Source:NCBI gene;... [more]
back to top
BLAST of SMED30011955 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000065022.13.635e-3538.51SMESG000065022.1[more]
SMESG000065022.11.391e-3338.41SMESG000065022.1[more]
SMESG000013248.15.886e-3240.59SMESG000013248.1[more]
SMESG000031866.12.257e-2933.49SMESG000031866.1[more]
SMESG000034928.12.655e-2643.09SMESG000034928.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011955 ID=SMED30011955|Name=SMED30011955|organism=Schmidtea mediterranea sexual|type=transcript|length=2008bp
ATCATGAACCAGATACCCTTCAGGATATAGAGACATGGGTGTAGTAAGAT
GATTTTATTATGCATGATATTTATTATTAGTATTACTATTATTATTTTAT
CTATCATTCATCCTTTTGATAGATCTTAAAGAAATGTACTTTTCATTCAT
AATCTGAAATTTGTTTAAATATTTAAAATTAAATTTTGTTATCGTGTAAA
TTGATTGGATGAATGATCACATGACTGCGGCGGTGGAATTTCGTGTATAA
AAGAGATGGTTGCTTCTGAAATGCTTTGATTCAAAAAAAATTTGTATTCA
AAACTATTATCGACAATGGAGAAGATTTCAAAAGGAACCAGGTTATATAA
CGATTATTTCAGAGAAAAAAGGAGTCGAATGGAGAAGGATGTCAAATTAT
TGGAAAATCTAAAAGTACCTAATTGGGCAAGAAGGGGAGATGAAGAAATG
AGAGTGTGTTTATTTGAAATCGAACGAAACAGAAAATTGAAATTGGCTGA
AGAATTATTGAGCAAGAAGGAAAAAACATGGCAGTTACATGTAATTAGAG
GGACAATCGAAATATTAAACAATGACGGAACGATATGGAATGAAATGCCA
AAAAGAACATCATGGAAAATTTCAAAGGAAATATGGCAAAGGCAAATAAC
AGCAGCCAACGGGGTTGCGTGTTTAATCCTAGAATGCAGAGTAAAAAGTT
CCATAAATTATGAGGTGAAAAGAAAATTCTCAATCAAGGAAGATAATGAG
TTTATTCCAATAACGGTGAATATGTTGAAATACAGAAAATTCTTTCTGAA
AAAACGAATCGCAAGGGAAGAAATCAGAAAATCTATCATATTTATAAACG
CGGAATATGGCGTAAATGAGAAAAATGAAATGGTCCTGCTATTAGTATGC
CTAATACAATATACTGGCAAAATTATATTCAATTCATTGATAACTCCAAG
AGATAAATTAAAAAATTATGTCACGCATGTACATGGGATCACGGAAAAAA
TGTCAAGAAATCAGAAAGATCAGTACAAAAGTATGGAAAAAATTCATGAG
TTAACGACCCGGAAAATTTTGGTTAACCATGATTTAAGAAACGAGTTGTT
GTATAGTGGAGTACAAGCAAATGATCTATGGGGAATACAAGATATAGTGA
TAGCTAAAGCATTAATAAAAAGGGAGTAACAATAAATGGTCATTGGTTCA
AACTATCTATTTTGGCAAACGAAGTGTGGGGAATTAAAATGCAAAAAGAT
AATCATTCTGCTCTCGAAGATACTGAGGCTATTAGAAGAATTTATTTGAG
AATTGAAAATGATTGGAAAGACGGCATAAATAATAATGAACCAATAGCAA
AAAGAGTTGGCTCATTGGAAGGATATCAGAGGAAGACAGCCCTACCAATA
GTGAAGGAGTTTGATGAGTTACAAAAAGGGATTATGTTGCAAACAATGGA
ACAAACATTCCACGCATTTTCAGAAACTCCAACAATCAGGAAAAAAAGGC
TCAGTTGCAAAATGAAAATAAATTAAATTCGGCAATAAATACCACAATTC
GGGTACAATCAGCACTCAAAAGAAAAATGCGAAGTGCAAAAAGAAACTCA
AACAATGAAAGAAATTTCGATAAAAACGAAAATTACAATCGATGGAAAAG
AACTTCAGTTATCAAAAATTGTGGTGATTTATAAAAATGGAAATCAAAAA
GTCAAAATTGTAGATCCTCAATAAATATTTGCGAGTTACTCTGATTTGTT
TCACCCAGTTAAAAAAAATAATAAAATAGAATAAAAAATAAATAGGTAAA
AAAAATCAAATAAATAAAAAGAATTAAAATTAGGTAATATAATAATCCAA
TAATGAATAAAAGTTATGAATGAAAATAAATAAATTAAATTAAATAAATT
AAAAATAATCAAATTATAATAAATTGAATGAGTATAGTAGTGATAGTTGA
AATACTAATACACTCTGTAGTAAAAACCCAATAAGGAGTTACTCAGAATA
TAAATAAA
back to top

protein sequence of SMED30011955-orf-1

>SMED30011955-orf-1 ID=SMED30011955-orf-1|Name=SMED30011955-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=288bp
MEKISKGTRLYNDYFREKRSRMEKDVKLLENLKVPNWARRGDEEMRVCLF
EIERNRKLKLAEELLSKKEKTWQLHVIRGTIEILNNDGTIWNEMPKRTSW
KISKEIWQRQITAANGVACLILECRVKSSINYEVKRKFSIKEDNEFIPIT
VNMLKYRKFFLKKRIAREEIRKSIIFINAEYGVNEKNEMVLLLVCLIQYT
GKIIFNSLITPRDKLKNYVTHVHGITEKMSRNQKDQYKSMEKIHELTTRK
ILVNHDLRNELLYSGVQANDLWGIQDIVIAKALIKRE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036397RNaseH_sf
IPR012337RNaseH-like_sf
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0004518nuclease activity
GO:0004527exonuclease activity
GO:0016787hydrolase activity
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
Vocabulary: biological process
TermDefinition
GO:0006364rRNA processing
GO:0090305nucleic acid phosphodiester bond hydrolysis
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR036397Ribonuclease H superfamilyGENE3DG3DSA:3.30.420.10coord: 149..264
e-value: 3.6E-12
score: 48.1
IPR012337Ribonuclease H-like superfamilySUPERFAMILYSSF53098Ribonuclease H-likecoord: 161..240