Transcription factor GATA-3

Overview
NameTranscription factor GATA-3
Smed IDSMED30011950
Length (bp)1478
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Transcription factor GATA-3 (SMED30011950) t-SNE clustered cells

Violin plots show distribution of expression levels for Transcription factor GATA-3 (SMED30011950) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Transcription factor GATA-3 (SMED30011950) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Transcription factor GATA-3 (SMED30011950) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011950

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30011950h1SMcG0009369 SmedASXL_006281SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30011950h1SMcG0009369 SMED30011950smed_20140614PMID:29100657
Cheng et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
X1 cellSMED30011950h1SMcG0009369 SMED30011950smed_20140614PMID:29100657
Cheng et al., 2018
FACS sorted cell population asexual adult RNA-sequencing evidence
parenchymaSMED30011950h1SMcG0009369 dd_Smed_v4_17393_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30011950h1SMcG0009369 dd_Smed_v4_17393_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Transcription factor GATA-3 vs. Ensembl Human
Match: GATA3 (GATA binding protein 3 [Source:HGNC Symbol;Acc:HGNC:4172])

HSP 1 Score: 216.853 bits (551), Expect = 1.649e-64
Identity = 132/280 (47.14%), Postives = 158/280 (56.43%), Query Frame = 1
Query:  253 QTISPWNFSSFSQTSAQSNWLNSMAPGSVVEHEKVISTEPFKIEYSPYLSSHNPT--KYLSSKSLLLGQKPLSPS-----------YDSCLTNQSSLGFTFDYPSLDVQSGALRNQIFPTNPYYGYFCAMSDYSKHTFANSS--QGNMLNFQNFNKVMRSKSKNSPNLDMSTEGRECVNCGATQTPLWRRDGTGHYLCNACGLYHKMNGTNRPLIKPKRRLSSARKVGTTCINCGTNHTTLWRRNQQGDSVCNACGLYYKLHHISRPISMKKDLIQTRNR 1047
             T SPWN S FS+TS     ++  +PG +  +    S+       SP+L +  PT  K +S    L    P S             Y   L +   L  +    S+    GA  +   P   Y  Y   + +YS   F  SS   G+   F           K+ P    STEGRECVNCGAT TPLWRRDGTGHYLCNACGLYHKMNG NRPLIKPKRRLS+AR+ GT+C NC T  TTLWRRN  GD VCNACGLYYKLH+I+RP++MKK+ IQTRNR
Sbjct:  107 HTASPWNLSPFSKTS-----IHHGSPGPLSVYPPASSSSLSGGHASPHLFTFPPTPPKDVSPDPSL--STPGSAGSARQDEKECLKYQVPLPDSMKLESSHSRGSMTALGGASSSTHHPITTYPPY---VPEYSSGLFPPSSLLGGSPTGF---------GCKSRPKARSSTEGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEGIQTRNR 367          
BLAST of Transcription factor GATA-3 vs. Ensembl Human
Match: GATA3 (GATA binding protein 3 [Source:HGNC Symbol;Acc:HGNC:4172])

HSP 1 Score: 211.075 bits (536), Expect = 2.826e-62
Identity = 129/278 (46.40%), Postives = 157/278 (56.47%), Query Frame = 1
Query:  253 QTISPWNFSSFSQTSAQSNWLNSMAPGSVVEHEKVISTEPFKIEYSPYLSSHNPT--KYLSSKSLLLGQKPLSPS-----------YDSCLTNQSSLGFTFDYPSLDVQSGALRNQIFPTNPYYGYFCAMSDYSKHTFANSSQGNMLNFQNFNKVMRSKSKNSPNLDMSTEGRECVNCGATQTPLWRRDGTGHYLCNACGLYHKMNGTNRPLIKPKRRLSSARKVGTTCINCGTNHTTLWRRNQQGDSVCNACGLYYKLHHISRPISMKKDLIQTRNR 1047
             T SPWN S FS+TS     ++  +PG +  +    S+       SP+L +  PT  K +S    L    P S             Y   L +   L  +    S+    GA  +   P   Y  Y   + +YS   F  SS   +L         +S+ K       S+ GRECVNCGAT TPLWRRDGTGHYLCNACGLYHKMNG NRPLIKPKRRLS+AR+ GT+C NC T  TTLWRRN  GD VCNACGLYYKLH+I+RP++MKK+ IQTRNR
Sbjct:  107 HTASPWNLSPFSKTS-----IHHGSPGPLSVYPPASSSSLSGGHASPHLFTFPPTPPKDVSPDPSL--STPGSAGSARQDEKECLKYQVPLPDSMKLESSHSRGSMTALGGASSSTHHPITTYPPY---VPEYSSGLFPPSS---LLGGSPTGFGCKSRPK-----ARSSTGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEGIQTRNR 366          
BLAST of Transcription factor GATA-3 vs. Ensembl Human
Match: GATA2 (GATA binding protein 2 [Source:HGNC Symbol;Acc:HGNC:4171])

HSP 1 Score: 209.149 bits (531), Expect = 3.635e-61
Identity = 103/163 (63.19%), Postives = 116/163 (71.17%), Query Frame = 1
Query:  565 FPTNPYYGYFCAMSDYSKHTFANSSQGNMLN--FQNFNKVMRSKSKNSPNLDMSTEGRECVNCGATQTPLWRRDGTGHYLCNACGLYHKMNGTNRPLIKPKRRLSSARKVGTTCINCGTNHTTLWRRNQQGDSVCNACGLYYKLHHISRPISMKKDLIQTRNR 1047
             PT P Y    A  DYS   F     G  L     +F    RSK+++       +EGRECVNCGAT TPLWRRDGTGHYLCNACGLYHKMNG NRPLIKPKRRLS+AR+ GT C NC T  TTLWRRN  GD VCNACGLYYKLH+++RP++MKK+ IQTRNR
Sbjct:  246 IPTYPSY-VPAAAHDYSSGLF---HPGGFLGGPASSFTPKQRSKARSC------SEGRECVNCGATATPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTCCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNVNRPLTMKKEGIQTRNR 398          
BLAST of Transcription factor GATA-3 vs. Ensembl Human
Match: GATA2 (GATA binding protein 2 [Source:HGNC Symbol;Acc:HGNC:4171])

HSP 1 Score: 209.149 bits (531), Expect = 3.635e-61
Identity = 103/163 (63.19%), Postives = 116/163 (71.17%), Query Frame = 1
Query:  565 FPTNPYYGYFCAMSDYSKHTFANSSQGNMLN--FQNFNKVMRSKSKNSPNLDMSTEGRECVNCGATQTPLWRRDGTGHYLCNACGLYHKMNGTNRPLIKPKRRLSSARKVGTTCINCGTNHTTLWRRNQQGDSVCNACGLYYKLHHISRPISMKKDLIQTRNR 1047
             PT P Y    A  DYS   F     G  L     +F    RSK+++       +EGRECVNCGAT TPLWRRDGTGHYLCNACGLYHKMNG NRPLIKPKRRLS+AR+ GT C NC T  TTLWRRN  GD VCNACGLYYKLH+++RP++MKK+ IQTRNR
Sbjct:  246 IPTYPSY-VPAAAHDYSSGLF---HPGGFLGGPASSFTPKQRSKARSC------SEGRECVNCGATATPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTCCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNVNRPLTMKKEGIQTRNR 398          
BLAST of Transcription factor GATA-3 vs. Ensembl Human
Match: GATA4 (GATA binding protein 4 [Source:HGNC Symbol;Acc:HGNC:4173])

HSP 1 Score: 199.904 bits (507), Expect = 4.601e-58
Identity = 86/118 (72.88%), Postives = 99/118 (83.90%), Query Frame = 1
Query:  703 PNLDMS---TEGRECVNCGATQTPLWRRDGTGHYLCNACGLYHKMNGTNRPLIKPKRRLSSARKVGTTCINCGTNHTTLWRRNQQGDSVCNACGLYYKLHHISRPISMKKDLIQTRNR 1047
            PNLDM    +EGRECVNCGA  TPLWRRDGTGHYLCNACGLYHKMNG NRPLIKP+RRLS++R+VG +C NC T  TTLWRRN +G+ VCNACGLY KLH + RP++M+K+ IQTR R
Sbjct:  203 PNLDMFDDFSEGRECVNCGAMSTPLWRRDGTGHYLCNACGLYHKMNGINRPLIKPQRRLSASRRVGLSCANCQTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMRKEGIQTRKR 320          
BLAST of Transcription factor GATA-3 vs. Ensembl Celegans
Match: elt-1 (Transcription factor elt-1 [Source:UniProtKB/Swiss-Prot;Acc:P28515])

HSP 1 Score: 179.104 bits (453), Expect = 6.854e-51
Identity = 77/114 (67.54%), Postives = 90/114 (78.95%), Query Frame = 1
Query:  706 NLDMSTEGRECVNCGATQTPLWRRDGTGHYLCNACGLYHKMNGTNRPLIKPKRRLSSARKVGTTCINCGTNHTTLWRRNQQGDSVCNACGLYYKLHHISRPISMKKDLIQTRNR 1047
            N   STE RECVNCG   TPLWRRDG+G+YLCNACGLY KMN   RPL+KPK+R ++ ++ G  C+NC TN TTLWRRN +G  VCNACGLY+KLH + RPI+MKKD IQTRNR
Sbjct:  207 NSQFSTEDRECVNCGVHNTPLWRRDGSGNYLCNACGLYFKMNHHARPLVKPKKRQNAQKRTGIECVNCRTNTTTLWRRNGEGHPVCNACGLYFKLHKVERPITMKKDGIQTRNR 320          
BLAST of Transcription factor GATA-3 vs. Ensembl Celegans
Match: elt-1 (Transcription factor elt-1 [Source:UniProtKB/Swiss-Prot;Acc:P28515])

HSP 1 Score: 179.104 bits (453), Expect = 2.851e-50
Identity = 78/119 (65.55%), Postives = 92/119 (77.31%), Query Frame = 1
Query:  691 SKNSPNLDMSTEGRECVNCGATQTPLWRRDGTGHYLCNACGLYHKMNGTNRPLIKPKRRLSSARKVGTTCINCGTNHTTLWRRNQQGDSVCNACGLYYKLHHISRPISMKKDLIQTRNR 1047
            S  + N   STE RECVNCG   TPLWRRDG+G+YLCNACGLY KMN   RPL+KPK+R ++ ++ G  C+NC TN TTLWRRN +G  VCNACGLY+KLH + RPI+MKKD IQTRNR
Sbjct:  274 SGGANNSQFSTEDRECVNCGVHNTPLWRRDGSGNYLCNACGLYFKMNHHARPLVKPKKRQNAQKRTGIECVNCRTNTTTLWRRNGEGHPVCNACGLYFKLHKVERPITMKKDGIQTRNR 392          
BLAST of Transcription factor GATA-3 vs. Ensembl Celegans
Match: elt-1 (Transcription factor elt-1 [Source:UniProtKB/Swiss-Prot;Acc:P28515])

HSP 1 Score: 176.022 bits (445), Expect = 8.075e-50
Identity = 79/115 (68.70%), Postives = 90/115 (78.26%), Query Frame = 1
Query:  706 NLDMSTEGRECVNCGATQTPLWRRDGTGHYLCNACGLYHKMNGTNRPLIKPKRRLSSARK-VGTTCINCGTNHTTLWRRNQQGDSVCNACGLYYKLHHISRPISMKKDLIQTRNR 1047
            N   STE RECVNCG   TPLWRRDG+G+YLCNACGLY KMN   RPL+KPK+R  +A+K  G  C+NC TN TTLWRRN +G  VCNACGLY+KLH + RPI+MKKD IQTRNR
Sbjct:  207 NSQFSTEDRECVNCGVHNTPLWRRDGSGNYLCNACGLYFKMNHHARPLVKPKKRQQNAQKRTGIECVNCRTNTTTLWRRNGEGHPVCNACGLYFKLHKVERPITMKKDGIQTRNR 321          
BLAST of Transcription factor GATA-3 vs. Ensembl Celegans
Match: elt-1 (Transcription factor elt-1 [Source:UniProtKB/Swiss-Prot;Acc:P28515])

HSP 1 Score: 176.407 bits (446), Expect = 2.894e-49
Identity = 80/120 (66.67%), Postives = 92/120 (76.67%), Query Frame = 1
Query:  691 SKNSPNLDMSTEGRECVNCGATQTPLWRRDGTGHYLCNACGLYHKMNGTNRPLIKPKRRLSSARK-VGTTCINCGTNHTTLWRRNQQGDSVCNACGLYYKLHHISRPISMKKDLIQTRNR 1047
            S  + N   STE RECVNCG   TPLWRRDG+G+YLCNACGLY KMN   RPL+KPK+R  +A+K  G  C+NC TN TTLWRRN +G  VCNACGLY+KLH + RPI+MKKD IQTRNR
Sbjct:  273 SGGANNSQFSTEDRECVNCGVHNTPLWRRDGSGNYLCNACGLYFKMNHHARPLVKPKKRQQNAQKRTGIECVNCRTNTTTLWRRNGEGHPVCNACGLYFKLHKVERPITMKKDGIQTRNR 392          
BLAST of Transcription factor GATA-3 vs. Ensembl Celegans
Match: elt-1 (Transcription factor elt-1 [Source:UniProtKB/Swiss-Prot;Acc:P28515])

HSP 1 Score: 176.407 bits (446), Expect = 2.950e-49
Identity = 80/120 (66.67%), Postives = 92/120 (76.67%), Query Frame = 1
Query:  691 SKNSPNLDMSTEGRECVNCGATQTPLWRRDGTGHYLCNACGLYHKMNGTNRPLIKPKRRLSSARK-VGTTCINCGTNHTTLWRRNQQGDSVCNACGLYYKLHHISRPISMKKDLIQTRNR 1047
            S  + N   STE RECVNCG   TPLWRRDG+G+YLCNACGLY KMN   RPL+KPK+R  +A+K  G  C+NC TN TTLWRRN +G  VCNACGLY+KLH + RPI+MKKD IQTRNR
Sbjct:  274 SGGANNSQFSTEDRECVNCGVHNTPLWRRDGSGNYLCNACGLYFKMNHHARPLVKPKKRQQNAQKRTGIECVNCRTNTTTLWRRNGEGHPVCNACGLYFKLHKVERPITMKKDGIQTRNR 393          
BLAST of Transcription factor GATA-3 vs. Ensembl Fly
Match: pnr (gene:FBgn0003117 transcript:FBtr0335426)

HSP 1 Score: 195.282 bits (495), Expect = 1.045e-55
Identity = 81/108 (75.00%), Postives = 92/108 (85.19%), Query Frame = 1
Query:  724 EGRECVNCGATQTPLWRRDGTGHYLCNACGLYHKMNGTNRPLIKPKRRLSSARKVGTTCINCGTNHTTLWRRNQQGDSVCNACGLYYKLHHISRPISMKKDLIQTRNR 1047
            EGRECVNCGA  TPLWRRDGTGHYLCNACGLYHKMNG NRPLIKP +RL++ R++G  C NCGT  TTLWRRN  G+ VCNACGLYYKLH ++RP++M+KD IQTR R
Sbjct:  165 EGRECVNCGAISTPLWRRDGTGHYLCNACGLYHKMNGMNRPLIKPSKRLTATRRMGLCCTNCGTRTTTLWRRNNDGEPVCNACGLYYKLHGVNRPLAMRKDGIQTRKR 272          
BLAST of Transcription factor GATA-3 vs. Ensembl Fly
Match: grn (gene:FBgn0001138 transcript:FBtr0300040)

HSP 1 Score: 197.593 bits (501), Expect = 1.613e-55
Identity = 96/152 (63.16%), Postives = 114/152 (75.00%), Query Frame = 1
Query:  613 SKHTFANSSQG-NMLNFQNFNKVMRSKSKNSPNLDMSTEGRECVNCGATQTPLWRRDGTGHYLCNACGLYHKMNGTNRPLIKPKRRL------SSARKVGTTCINCGTNHTTLWRRNQQGDSVCNACGLYYKLHHISRPISMKKDLIQTRNR 1047
            S H+ A S+ G N L+     K +R+K + S       EGRECVNCGAT TPLWRRDGTGHYLCNACGLY+KMNG NRPLIKPKRRL      S+A++ GT+C NC T  TTLWRRN  G+ VCNACGLYYKLH+++RP++MKK+ IQTRNR
Sbjct:  442 SGHSGAGSNAGSNCLDV----KPVRTKPRTS------AEGRECVNCGATSTPLWRRDGTGHYLCNACGLYYKMNGQNRPLIKPKRRLTLQSLQSAAKRAGTSCANCKTTTTTLWRRNASGEPVCNACGLYYKLHNVNRPLTMKKEGIQTRNR 583          
BLAST of Transcription factor GATA-3 vs. Ensembl Fly
Match: grn (gene:FBgn0001138 transcript:FBtr0330188)

HSP 1 Score: 197.208 bits (500), Expect = 2.929e-55
Identity = 96/152 (63.16%), Postives = 114/152 (75.00%), Query Frame = 1
Query:  613 SKHTFANSSQG-NMLNFQNFNKVMRSKSKNSPNLDMSTEGRECVNCGATQTPLWRRDGTGHYLCNACGLYHKMNGTNRPLIKPKRRL------SSARKVGTTCINCGTNHTTLWRRNQQGDSVCNACGLYYKLHHISRPISMKKDLIQTRNR 1047
            S H+ A S+ G N L+     K +R+K + S       EGRECVNCGAT TPLWRRDGTGHYLCNACGLY+KMNG NRPLIKPKRRL      S+A++ GT+C NC T  TTLWRRN  G+ VCNACGLYYKLH+++RP++MKK+ IQTRNR
Sbjct:  442 SGHSGAGSNAGSNCLDV----KPVRTKPRTS------AEGRECVNCGATSTPLWRRDGTGHYLCNACGLYYKMNGQNRPLIKPKRRLTLQSLQSAAKRAGTSCANCKTTTTTLWRRNASGEPVCNACGLYYKLHNVNRPLTMKKEGIQTRNR 583          
BLAST of Transcription factor GATA-3 vs. Ensembl Fly
Match: grn (gene:FBgn0001138 transcript:FBtr0081808)

HSP 1 Score: 192.586 bits (488), Expect = 3.098e-55
Identity = 85/114 (74.56%), Postives = 97/114 (85.09%), Query Frame = 1
Query:  724 EGRECVNCGATQTPLWRRDGTGHYLCNACGLYHKMNGTNRPLIKPKRRL------SSARKVGTTCINCGTNHTTLWRRNQQGDSVCNACGLYYKLHHISRPISMKKDLIQTRNR 1047
            EGRECVNCGAT TPLWRRDGTGHYLCNACGLY+KMNG NRPLIKPKRRL      S+A++ GT+C NC T  TTLWRRN  G+ VCNACGLYYKLH+++RP++MKK+ IQTRNR
Sbjct:  257 EGRECVNCGATSTPLWRRDGTGHYLCNACGLYYKMNGQNRPLIKPKRRLTLQSLQSAAKRAGTSCANCKTTTTTLWRRNASGEPVCNACGLYYKLHNVNRPLTMKKEGIQTRNR 370          

HSP 2 Score: 58.9214 bits (141), Expect = 5.111e-9
Identity = 24/48 (50.00%), Postives = 32/48 (66.67%), Query Frame = 1
Query:  880 RKVGTTCINCGTNHTTLWRRNQQGDSVCNACGLYYKLHHISRPISMKK 1023
            R+ G  C+NCG   T LWRR+  G  +CNACGLYYK++  +RP+   K
Sbjct:  255 REEGRECVNCGATSTPLWRRDGTGHYLCNACGLYYKMNGQNRPLIKPK 302          
BLAST of Transcription factor GATA-3 vs. Ensembl Fly
Match: pnr (gene:FBgn0003117 transcript:FBtr0335427)

HSP 1 Score: 191.43 bits (485), Expect = 9.586e-55
Identity = 83/111 (74.77%), Postives = 92/111 (82.88%), Query Frame = 1
Query:  724 EGRECVNCGATQTPLWRRDGTGHYLCNACGLYHKMNGTNRPLIKPKRRLSSA---RKVGTTCINCGTNHTTLWRRNQQGDSVCNACGLYYKLHHISRPISMKKDLIQTRNR 1047
            EGRECVNCGA  TPLWRRDGTGHYLCNACGLYHKMNG NRPLIKP +RL SA   R++G  C NCGT  TTLWRRN  G+ VCNACGLYYKLH ++RP++M+KD IQTR R
Sbjct:  113 EGRECVNCGAISTPLWRRDGTGHYLCNACGLYHKMNGMNRPLIKPSKRLVSATATRRMGLCCTNCGTRTTTLWRRNNDGEPVCNACGLYYKLHGVNRPLAMRKDGIQTRKR 223          
BLAST of Transcription factor GATA-3 vs. Ensembl Zebrafish
Match: gata3 (GATA binding protein 3 [Source:NCBI gene;Acc:30458])

HSP 1 Score: 210.69 bits (535), Expect = 2.447e-62
Identity = 136/300 (45.33%), Postives = 171/300 (57.00%), Query Frame = 1
Query:  241 LNPLQTISPWNFSSFSQTSAQSNWLNSMAPGSVVEHEKVISTEPFKIEYSPYLSSHNPT--KYLSSKSLLL---GQKPLSPSYDSCLTNQSSLGFTFDYPSLDVQS----GALRNQIFPTNPYYGYFCAMSDYSKHTFANSSQGNMLNFQNFNKVMRSKSKNSPNLDMSTEGRECVNCGATQTPLWRRDGTGHYLCNACGLYHKMNGTNRPLIKPKRRLSSARKVGTTCINCGTNHTTLWRRNQQGDSVCNACGLYYKLHHISRPISMKKDLIQTRNRXX--XXXXXXXEFDPISDFIKS 1107
            + P  + SPWN   F +TS     L+  +PG +  +    S+       SP+L +  PT  K +S    +        +      C+  Q SL  +    S   +S    GA  +     +P   Y   + DY    F  SS     +    +K  R K+++S      +EGRECVNCGAT TPLWRRDGTGHYLCNACGLYHKMNG NRPLIKPKRRLS+AR+ GT+C NC T  TTLWRRN  GD VCNACGLYYKLH+I+RP++MKK+ IQTRNRK+     K KK  D + DF KS
Sbjct:   96 IGPHHSTSPWNLGPFPKTS-----LHHSSPGPLSVYPPASSSSLSAGHSSPHLFTFPPTPPKDVSPDPAISTSGSGSSVRQEDKECIKYQVSLAESMKLDSAHSRSMASIGAGASSAH--HPIATYPSYVPDYGPGLFPPSSLIGGSSSSYGSKT-RPKTRSS------SEGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEGIQTRNRKMSSKSKKSKKSHDSMEDFSKS 381          
BLAST of Transcription factor GATA-3 vs. Ensembl Zebrafish
Match: gata2a (GATA binding protein 2a [Source:ZFIN;Acc:ZDB-GENE-980526-260])

HSP 1 Score: 208.379 bits (529), Expect = 3.089e-61
Identity = 106/190 (55.79%), Postives = 123/190 (64.74%), Query Frame = 1
Query:  475 DSCLTNQSSLGFTFDYPSLDVQSGALRNQIFPTNPYYGYFCAMSDYSKHTFANSSQGNMLNFQNFNKVMRSKSKNSPNLDMSTEGRECVNCGATQTPLWRRDGTGHYLCNACGLYHKMNGTNRPLIKPKRRLSSARKVGTTCINCGTNHTTLWRRNQQGDSVCNACGLYYKLHHISRPISMKKDLIQTRN 1044
            + C   + SL  +   PS         +   PT P Y    A  DY    F     G +L+    +   + KSK     +  TEGRECVNCGAT TPLWRRDGTGHYLCNACGLYHKMNG NRPLIKPKRRLS+AR+ GT C NC T  TTLWRRN  GD VCNACGLYYKLH+++RP++MKK+ IQTRN
Sbjct:  200 EGCSPLRGSLAMSAQTPST--------HHPIPTYPTYS-LPAPHDYGGGLF---HPGTLLSGSASSFTPKCKSKTRSCSEFCTEGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTCCANCQTTTTTLWRRNGNGDPVCNACGLYYKLHNVNRPLTMKKEGIQTRN 377          
BLAST of Transcription factor GATA-3 vs. Ensembl Zebrafish
Match: gata1a (GATA binding protein 1a [Source:ZFIN;Acc:ZDB-GENE-980526-268])

HSP 1 Score: 203.756 bits (517), Expect = 5.969e-60
Identity = 93/158 (58.86%), Postives = 116/158 (73.42%), Query Frame = 1
Query:  574 NPYYGYFCAMSDYSKHTFANSSQGNMLNFQNFNKVMRSKSKNSPNLDMSTEGRECVNCGATQTPLWRRDGTGHYLCNACGLYHKMNGTNRPLIKPKRRLSSARKVGTTCINCGTNHTTLWRRNQQGDSVCNACGLYYKLHHISRPISMKKDLIQTRNR 1047
            +PY  Y     DYS      S+ G  ++  +++  +R+K + SP      E RECVNCGAT TPLWRRDGTGHYLCNACGLYHKMNG NRPLI+PK+RL  +++ GT C NC T+ TTLWRRN  G+ VCNACGLY+KLH+++RP++MKKD IQTRNR
Sbjct:  190 SPYGSYMSTSQDYSSAALY-STGGPWMSPSSYSPKLRNKMRLSP-----PEARECVNCGATATPLWRRDGTGHYLCNACGLYHKMNGQNRPLIRPKKRLIVSKRAGTQCANCHTSTTTLWRRNASGEPVCNACGLYFKLHNVNRPLTMKKDGIQTRNR 341          
BLAST of Transcription factor GATA-3 vs. Ensembl Zebrafish
Match: gata1a (GATA binding protein 1a [Source:ZFIN;Acc:ZDB-GENE-980526-268])

HSP 1 Score: 203.756 bits (517), Expect = 5.969e-60
Identity = 93/158 (58.86%), Postives = 116/158 (73.42%), Query Frame = 1
Query:  574 NPYYGYFCAMSDYSKHTFANSSQGNMLNFQNFNKVMRSKSKNSPNLDMSTEGRECVNCGATQTPLWRRDGTGHYLCNACGLYHKMNGTNRPLIKPKRRLSSARKVGTTCINCGTNHTTLWRRNQQGDSVCNACGLYYKLHHISRPISMKKDLIQTRNR 1047
            +PY  Y     DYS      S+ G  ++  +++  +R+K + SP      E RECVNCGAT TPLWRRDGTGHYLCNACGLYHKMNG NRPLI+PK+RL  +++ GT C NC T+ TTLWRRN  G+ VCNACGLY+KLH+++RP++MKKD IQTRNR
Sbjct:  190 SPYGSYMSTSQDYSSAALY-STGGPWMSPSSYSPKLRNKMRLSP-----PEARECVNCGATATPLWRRDGTGHYLCNACGLYHKMNGQNRPLIRPKKRLIVSKRAGTQCANCHTSTTTLWRRNASGEPVCNACGLYFKLHNVNRPLTMKKDGIQTRNR 341          
BLAST of Transcription factor GATA-3 vs. Ensembl Zebrafish
Match: gata2a (GATA binding protein 2a [Source:ZFIN;Acc:ZDB-GENE-980526-260])

HSP 1 Score: 203.371 bits (516), Expect = 2.038e-59
Identity = 105/192 (54.69%), Postives = 125/192 (65.10%), Query Frame = 1
Query:  475 DSCLTNQSSLGFTFDYPSLDVQSGALRNQIFPTNPYYGYFCAMSDYSKHTFANSSQGNMLN--FQNFNKVMRSKSKNSPNLDMSTEGRECVNCGATQTPLWRRDGTGHYLCNACGLYHKMNGTNRPLIKPKRRLSSARKVGTTCINCGTNHTTLWRRNQQGDSVCNACGLYYKLHHISRPISMKKDLIQTRN 1044
            + C   + SL  +   PS         +   PT P Y    A  DY    F     G +L+    +F    +SK+++       +EGRECVNCGAT TPLWRRDGTGHYLCNACGLYHKMNG NRPLIKPKRRLS+AR+ GT C NC T  TTLWRRN  GD VCNACGLYYKLH+++RP++MKK+ IQTRN
Sbjct:  200 EGCSPLRGSLAMSAQTPST--------HHPIPTYPTYS-LPAPHDYGGGLF---HPGTLLSGSASSFTPKCKSKTRSC------SEGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTCCANCQTTTTTLWRRNGNGDPVCNACGLYYKLHNVNRPLTMKKEGIQTRN 373          
BLAST of Transcription factor GATA-3 vs. Ensembl Xenopus
Match: gata3 (GATA binding protein 3 [Source:NCBI gene;Acc:448391])

HSP 1 Score: 212.231 bits (539), Expect = 8.664e-63
Identity = 111/193 (57.51%), Postives = 135/193 (69.95%), Query Frame = 1
Query:  691 SKNSPNLDMSTEGRECVNCGATQTPLWRRDGTGHYLCNACGLYHKMNGTNRPLIKPKRRLSSARKVGTTCINCGTNHTTLWRRNQQGDSVCNACGLYYKLHHISRPISMKKDLIQTRNRXXXXXXXXXE--FDPISDFIKSDTAMMNLLQEANTLQPISSLTNRLVAGNQTYQLHSTSQAHHDTQQPNNLDFG 1263
            SK  P    STEGRECVNCGAT TPLWRRDGTGHYLCNACGLYHKMNG NRPLIKPKRRLS+AR+ GT+C NC T  TTLWRRN  GD VCNACGLYYKLH+I+RP++MKK+ IQTRNRK++   KK +   D + D+ KS +        A   + +SSL++     + ++ L + +  H     P+ L FG
Sbjct:  242 SKPRPKTRSSTEGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEGIQTRNRKMSSKSKKSKKIHDSLEDYPKSSS-----FSPAALSRHMSSLSHISPFSHSSHMLTTPTPMH----APSGLSFG 425          
BLAST of Transcription factor GATA-3 vs. Ensembl Xenopus
Match: gata3 (GATA binding protein 3 [Source:NCBI gene;Acc:448391])

HSP 1 Score: 212.231 bits (539), Expect = 1.134e-62
Identity = 111/193 (57.51%), Postives = 135/193 (69.95%), Query Frame = 1
Query:  691 SKNSPNLDMSTEGRECVNCGATQTPLWRRDGTGHYLCNACGLYHKMNGTNRPLIKPKRRLSSARKVGTTCINCGTNHTTLWRRNQQGDSVCNACGLYYKLHHISRPISMKKDLIQTRNRXXXXXXXXXE--FDPISDFIKSDTAMMNLLQEANTLQPISSLTNRLVAGNQTYQLHSTSQAHHDTQQPNNLDFG 1263
            SK  P    STEGRECVNCGAT TPLWRRDGTGHYLCNACGLYHKMNG NRPLIKPKRRLS+AR+ GT+C NC T  TTLWRRN  GD VCNACGLYYKLH+I+RP++MKK+ IQTRNRK++   KK +   D + D+ KS +        A   + +SSL++     + ++ L + +  H     P+ L FG
Sbjct:  242 SKPRPKTRSSTEGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEGIQTRNRKMSSKSKKSKKIHDSLEDYPKSSS-----FSPAALSRHMSSLSHISPFSHSSHMLTTPTPMH----APSGLSFG 425          
BLAST of Transcription factor GATA-3 vs. Ensembl Xenopus
Match: GATA2 (GATA binding protein 2 [Source:NCBI gene;Acc:100487142])

HSP 1 Score: 209.534 bits (532), Expect = 1.834e-61
Identity = 104/167 (62.28%), Postives = 117/167 (70.06%), Query Frame = 1
Query:  568 PTNPYYGYFCAMSDYSKHTFANSSQGNMLN--FQNFNKVMRSKSK-----NSPNLDMSTEGRECVNCGATQTPLWRRDGTGHYLCNACGLYHKMNGTNRPLIKPKRRLSSARKVGTTCINCGTNHTTLWRRNQQGDSVCNACGLYYKLHHISRPISMKKDLIQTRNR 1047
            P   Y  Y  A  DYS   F     G++L     +F    RSKS+     N  +     EGRECVNCGAT TPLWRRDGTGHYLCNACGLYHKMNG NRPLIKPKRRLS+AR+ GT C NC T  TTLWRRN  GD VCNACGLYYKLH+++RP++MKK+ IQTRNR
Sbjct:  217 PIPTYPSYVPAPHDYSSGLF---HPGSLLGGPASSFTPKQRSKSRSCSERNPVSSSFHLEGRECVNCGATATPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTCCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNVNRPLTMKKEGIQTRNR 380          
BLAST of Transcription factor GATA-3 vs. Ensembl Xenopus
Match: mcm4 (minichromosome maintenance complex component 4 [Source:Xenbase;Acc:XB-GENE-1011481])

HSP 1 Score: 200.675 bits (509), Expect = 7.076e-59
Identity = 95/160 (59.38%), Postives = 112/160 (70.00%), Query Frame = 1
Query:  571 TNPYYGYFCAMSDYSKHTFANSSQGNML-NFQNFNKVMRSKSKNSPNLDMSTEGRECVNCGATQTPLWRRDGTGHYLCNACGLYHKMNGTNRPLIKPKRRLSSARKVGTTCINCGTNHTTLWRRNQQGDSVCNACGLYYKLHHISRPISMKKDLIQTRNR 1047
            ++PY  Y     D      A+    +ML N QN      S+  N    D  +EGRECVNCGA  TPLWRRDGTGHYLCNACGLYHKMNG NRPLIKP+RRLS++R+VG +C NC T  TTLWRRN +G+ VCNACGLY KLH + RP++MKK+ IQTR R
Sbjct:  132 SSPYPAYMSP--DMGATWTASPFDSSMLHNLQNRAGPAASRHPNIEFFDDFSEGRECVNCGAMSTPLWRRDGTGHYLCNACGLYHKMNGINRPLIKPQRRLSASRRVGLSCANCHTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMKKEGIQTRKR 289          
BLAST of Transcription factor GATA-3 vs. Ensembl Xenopus
Match: ENSXETT00000034979.1 (GATA binding protein 1 [Source:NCBI gene;Acc:100497467])

HSP 1 Score: 194.512 bits (493), Expect = 6.101e-57
Identity = 85/116 (73.28%), Postives = 99/116 (85.34%), Query Frame = 1
Query:  700 SPNLDMSTEGRECVNCGATQTPLWRRDGTGHYLCNACGLYHKMNGTNRPLIKPKRRLSSARKVGTTCINCGTNHTTLWRRNQQGDSVCNACGLYYKLHHISRPISMKKDLIQTRNR 1047
            SP+L  STE RECVNCGAT TPLWRRD +GHYLCNACGLYHKMNG NRPLI+PK+RL  +++ GT C NC T+ TTLWRRN  GD VCNACGLYYKLH+++RP++MKK+ IQTRNR
Sbjct:  168 SPSLFQSTEDRECVNCGATVTPLWRRDLSGHYLCNACGLYHKMNGQNRPLIRPKKRLIVSKRAGTQCSNCHTSTTTLWRRNASGDPVCNACGLYYKLHNVNRPLTMKKEGIQTRNR 283          
BLAST of Transcription factor GATA-3 vs. Ensembl Mouse
Match: Gata3 (GATA binding protein 3 [Source:MGI Symbol;Acc:MGI:95663])

HSP 1 Score: 218.779 bits (556), Expect = 2.248e-65
Identity = 150/354 (42.37%), Postives = 191/354 (53.95%), Query Frame = 1
Query:  253 QTISPWNFSSFSQTSAQSNWLNSMAPGSVVEHEKVISTEPFKIEYSPYLSSHNPT--KYLSSKSLLLGQKPLSPS-----------YDSCLTNQSSLGFTFDYPSLDVQSGALRNQIFPTNPYYGYFCAMSDYSKHTFANSS--QGNMLNFQNFNKVMRSKSKNSPNLDMSTEGRECVNCGATQTPLWRRDGTGHYLCNACGLYHKMNGTNRPLIKPKRRLSSARKVGTTCINCGTNHTTLWRRNQQGDSVCNACGLYYKLHHISRPISMKKDLIQTRNRXXXXXXXXXE--FDPISDFIKSDTAMMNLLQEANTLQPISSLTNRLVAGNQTYQLHSTSQAHHDTQQPNNLDFG 1263
             T SPWN S FS+TS     ++  +PG +  +    S+       SP+L +  PT  K +S    L    P S             Y   L +   L  +    S+    GA  +   P   Y  Y   + +YS   F  SS   G+   F           K+ P    STEGRECVNCGAT TPLWRRDGTGHYLCNACGLYHKMNG NRPLIKPKRRLS+AR+ GT+C NC T  TTLWRRN  GD VCNACGLYYKLH+I+RP++MKK+ IQTRNRK++   KK +   D + DF KS +        A   + +SSL++     + ++ L + +  H     P+ L FG
Sbjct:  106 HTASPWNLSPFSKTS-----IHHGSPGPLSVYPPASSSSLAAGHSSPHLFTFPPTPPKDVSPDPSL--STPGSAGSARQDEKECLKYQVQLPDSMKLETSHSRGSMTTLGGASSSAHHPITTYPPY---VPEYSSGLFPPSSLLGGSPTGF---------GCKSRPKARSSTEGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEGIQTRNRKMSSKSKKCKKVHDALEDFPKSSS-----FNPAALSRHMSSLSHISPFSHSSHMLTTPTPMH----PPSGLSFG 431          
BLAST of Transcription factor GATA-3 vs. Ensembl Mouse
Match: Gata2 (GATA binding protein 2 [Source:MGI Symbol;Acc:MGI:95662])

HSP 1 Score: 207.994 bits (528), Expect = 6.743e-61
Identity = 102/163 (62.58%), Postives = 115/163 (70.55%), Query Frame = 1
Query:  565 FPTNPYYGYFCAMSDYSKHTFANSSQGNMLN--FQNFNKVMRSKSKNSPNLDMSTEGRECVNCGATQTPLWRRDGTGHYLCNACGLYHKMNGTNRPLIKPKRRLSSARKVGTTCINCGTNHTTLWRRNQQGDSVCNACGLYYKLHHISRPISMKKDLIQTRNR 1047
             PT P Y    A  DY    F     G  L     +F    RSK+++       +EGRECVNCGAT TPLWRRDGTGHYLCNACGLYHKMNG NRPLIKPKRRLS+AR+ GT C NC T  TTLWRRN  GD VCNACGLYYKLH+++RP++MKK+ IQTRNR
Sbjct:  246 IPTYPSY-VPAAAHDYGSSLF---HPGGFLGGPASSFTPKQRSKARSC------SEGRECVNCGATATPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTCCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNVNRPLTMKKEGIQTRNR 398          
BLAST of Transcription factor GATA-3 vs. Ensembl Mouse
Match: Gata2 (GATA binding protein 2 [Source:MGI Symbol;Acc:MGI:95662])

HSP 1 Score: 207.994 bits (528), Expect = 6.743e-61
Identity = 102/163 (62.58%), Postives = 115/163 (70.55%), Query Frame = 1
Query:  565 FPTNPYYGYFCAMSDYSKHTFANSSQGNMLN--FQNFNKVMRSKSKNSPNLDMSTEGRECVNCGATQTPLWRRDGTGHYLCNACGLYHKMNGTNRPLIKPKRRLSSARKVGTTCINCGTNHTTLWRRNQQGDSVCNACGLYYKLHHISRPISMKKDLIQTRNR 1047
             PT P Y    A  DY    F     G  L     +F    RSK+++       +EGRECVNCGAT TPLWRRDGTGHYLCNACGLYHKMNG NRPLIKPKRRLS+AR+ GT C NC T  TTLWRRN  GD VCNACGLYYKLH+++RP++MKK+ IQTRNR
Sbjct:  246 IPTYPSY-VPAAAHDYGSSLF---HPGGFLGGPASSFTPKQRSKARSC------SEGRECVNCGATATPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTCCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNVNRPLTMKKEGIQTRNR 398          
BLAST of Transcription factor GATA-3 vs. Ensembl Mouse
Match: Gata4 (GATA binding protein 4 [Source:MGI Symbol;Acc:MGI:95664])

HSP 1 Score: 200.29 bits (508), Expect = 1.988e-58
Identity = 87/125 (69.60%), Postives = 101/125 (80.80%), Query Frame = 1
Query:  682 RSKSKNSPNLDMS---TEGRECVNCGATQTPLWRRDGTGHYLCNACGLYHKMNGTNRPLIKPKRRLSSARKVGTTCINCGTNHTTLWRRNQQGDSVCNACGLYYKLHHISRPISMKKDLIQTRNR 1047
            R+     PNLDM    +EGRECVNCGA  TPLWRRDGTGHYLCNACGLYHKMNG NRPLIKP+RRLS++R+VG +C NC T  TTLWRRN +G+ VCNACGLY KLH + RP++M+K+ IQTR R
Sbjct:  195 RANPGRHPNLDMFDDFSEGRECVNCGAMSTPLWRRDGTGHYLCNACGLYHKMNGINRPLIKPQRRLSASRRVGLSCANCQTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMRKEGIQTRKR 319          

HSP 2 Score: 59.3066 bits (142), Expect = 5.330e-9
Identity = 26/66 (39.39%), Postives = 37/66 (56.06%), Query Frame = 1
Query:  814 LYHKMNGTNRPLIKPKRRLSSARKVGTTCINCGTNHTTLWRRNQQGDSVCNACGLYYKLHHISRPI 1011
            + H + G   P   P   +      G  C+NCG   T LWRR+  G  +CNACGLY+K++ I+RP+
Sbjct:  188 VLHSLPGRANPGRHPNLDMFDDFSEGRECVNCGAMSTPLWRRDGTGHYLCNACGLYHKMNGINRPL 253          
BLAST of Transcription factor GATA-3 vs. Ensembl Mouse
Match: Gata4 (GATA binding protein 4 [Source:MGI Symbol;Acc:MGI:95664])

HSP 1 Score: 192.2 bits (487), Expect = 1.116e-57
Identity = 82/113 (72.57%), Postives = 95/113 (84.07%), Query Frame = 1
Query:  709 LDMSTEGRECVNCGATQTPLWRRDGTGHYLCNACGLYHKMNGTNRPLIKPKRRLSSARKVGTTCINCGTNHTTLWRRNQQGDSVCNACGLYYKLHHISRPISMKKDLIQTRNR 1047
             D  +EGRECVNCGA  TPLWRRDGTGHYLCNACGLYHKMNG NRPLIKP+RRLS++R+VG +C NC T  TTLWRRN +G+ VCNACGLY KLH + RP++M+K+ IQTR R
Sbjct:    2 FDDFSEGRECVNCGAMSTPLWRRDGTGHYLCNACGLYHKMNGINRPLIKPQRRLSASRRVGLSCANCQTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMRKEGIQTRKR 114          
BLAST of Transcription factor GATA-3 vs. UniProt/SwissProt
Match: sp|P23772|GATA3_MOUSE (Trans-acting T-cell-specific transcription factor GATA-3 OS=Mus musculus OX=10090 GN=Gata3 PE=1 SV=1)

HSP 1 Score: 218.779 bits (556), Expect = 1.572e-64
Identity = 150/354 (42.37%), Postives = 191/354 (53.95%), Query Frame = 1
Query:  253 QTISPWNFSSFSQTSAQSNWLNSMAPGSVVEHEKVISTEPFKIEYSPYLSSHNPT--KYLSSKSLLLGQKPLSPS-----------YDSCLTNQSSLGFTFDYPSLDVQSGALRNQIFPTNPYYGYFCAMSDYSKHTFANSS--QGNMLNFQNFNKVMRSKSKNSPNLDMSTEGRECVNCGATQTPLWRRDGTGHYLCNACGLYHKMNGTNRPLIKPKRRLSSARKVGTTCINCGTNHTTLWRRNQQGDSVCNACGLYYKLHHISRPISMKKDLIQTRNRXXXXXXXXXE--FDPISDFIKSDTAMMNLLQEANTLQPISSLTNRLVAGNQTYQLHSTSQAHHDTQQPNNLDFG 1263
             T SPWN S FS+TS     ++  +PG +  +    S+       SP+L +  PT  K +S    L    P S             Y   L +   L  +    S+    GA  +   P   Y  Y   + +YS   F  SS   G+   F           K+ P    STEGRECVNCGAT TPLWRRDGTGHYLCNACGLYHKMNG NRPLIKPKRRLS+AR+ GT+C NC T  TTLWRRN  GD VCNACGLYYKLH+I+RP++MKK+ IQTRNRK++   KK +   D + DF KS +        A   + +SSL++     + ++ L + +  H     P+ L FG
Sbjct:  106 HTASPWNLSPFSKTS-----IHHGSPGPLSVYPPASSSSLAAGHSSPHLFTFPPTPPKDVSPDPSL--STPGSAGSARQDEKECLKYQVQLPDSMKLETSHSRGSMTTLGGASSSAHHPITTYPPY---VPEYSSGLFPPSSLLGGSPTGF---------GCKSRPKARSSTEGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEGIQTRNRKMSSKSKKCKKVHDALEDFPKSSS-----FNPAALSRHMSSLSHISPFSHSSHMLTTPTPMH----PPSGLSFG 431          
BLAST of Transcription factor GATA-3 vs. UniProt/SwissProt
Match: sp|P23825|GATA3_CHICK (GATA-binding factor 3 OS=Gallus gallus OX=9031 GN=GATA3 PE=2 SV=1)

HSP 1 Score: 214.157 bits (544), Expect = 1.024e-62
Identity = 138/302 (45.70%), Postives = 168/302 (55.63%), Query Frame = 1
Query:  253 QTISPWNFSSFSQTSAQSNWLNSMAPGSVVEHEKVISTEPFKIEYSPYLSSHNPTKYLSSKSLLLGQKPLSPS-----YDSCLTNQSSLGFTFDYPSLDVQ------SGALRNQIFPTNPYYGYFCAMSDYSKHTFANSS--QGNMLNFQNFNKVMRSKSKNSPNLDMSTEGRECVNCGATQTPLWRRDGTGHYLCNACGLYHKMNGTNRPLIKPKRRLSSARKVGTTCINCGTNHTTLWRRNQQGDSVCNACGLYYKLHHISRPISMKKDLIQTRNRXXXXXXXXXE--FDPISDFIKSDT 1113
             + SPWN S FS+TS     ++  +PG +  +    S+       SP+L +  PT             P S          C+  Q SL  T    S   +       GA  +   P   Y  Y   + +YS   F  SS   G+   F           K+ P    STEGRECVNCGAT TPLWRRDGTGHYLCNACGLYHKMNG NRPLIKPKRRLS+AR+ GT+C NC T  TTLWRRN  GD VCNACGLYYKLH+I+RP++MKK+ IQTRNRK++   KK +   D + DF KS +
Sbjct:  107 HSASPWNLSPFSKTS-----IHHSSPGPLSVYPPASSSTLSAGHSSPHLFTFPPTPPKDVSPDPSISTPGSTGSTRQDEKECIKYQVSLADTMKLESSHSRSSMASLGGATSSAHHPITTYPPY---VPEYSSGLFPPSSLLGGSPTGF---------GCKSRPKARSSTEGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEGIQTRNRKMSSKSKKCKKVHDNLEDFPKSSS 391          
BLAST of Transcription factor GATA-3 vs. UniProt/SwissProt
Match: sp|Q08DV0|GATA3_BOVIN (Trans-acting T-cell-specific transcription factor GATA-3 OS=Bos taurus OX=9913 GN=GATA3 PE=2 SV=1)

HSP 1 Score: 211.846 bits (538), Expect = 7.070e-62
Identity = 147/352 (41.76%), Postives = 190/352 (53.98%), Query Frame = 1
Query:  253 QTISPWNFSSFSQTSAQSNWLNSMAPGSVVEHEKVISTEPFKIEYSPYLSSHNPT--KYLSSKSLLLGQKPLSPS-----------YDSCLTNQSSLGFTFDYPSLDVQSGALRNQIFPTNPYYGYFCAMSDYSKHTFANSSQGNMLNFQNFNKVMRSKSKNSPNLDMSTEGRECVNCGATQTPLWRRDGTGHYLCNACGLYHKMNGTNRPLIKPKRRLSSARKVGTTCINCGTNHTTLWRRNQQGDSVCNACGLYYKLHHISRPISMKKDLIQTRNRXXXXXXXXXE--FDPISDFIKSDTAMMNLLQEANTLQPISSLTNRLVAGNQTYQLHSTSQAHHDTQQPNNLDFG 1263
             T SPWN S FS+TS     ++  +PG +  +    S+       SP+L +  PT  K +S    L    P S             Y   L +   L       S+    GA  +   P   Y  Y   + +YS   F  SS   +L         +S+ K       S+ GRECVNCGAT TPLWRRDGTGHYLCNACGLYHKMNG NRPLIKPKRRLS+AR+ GT+C NC T  TTLWRRN  GD VCNACGLYYKLH+I+RP++MKK+ IQTRNRK++   KK +   D + DF KS +        A   + +SSL++     + ++ L + +  H     P++L FG
Sbjct:  107 HTASPWNLSPFSKTS-----IHHGSPGPLSVYPPASSSSLSAGHSSPHLFTFPPTPPKDVSPDPSL--STPGSAGSGRQDEKECIKYQVPLPDSMKLESAHPRGSMATLGGAAASAHHPITTYPPY---VPEYSSGLFPPSS---LLGGSPTGFGCKSRPK-----ARSSTGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEGIQTRNRKMSSKSKKCKKVHDALEDFPKSSS-----FNPAALSRHMSSLSHISPFSHSSHMLTTPTPMH----PPSSLSFG 431          
BLAST of Transcription factor GATA-3 vs. UniProt/SwissProt
Match: sp|P23771|GATA3_HUMAN (Trans-acting T-cell-specific transcription factor GATA-3 OS=Homo sapiens OX=9606 GN=GATA3 PE=1 SV=1)

HSP 1 Score: 211.075 bits (536), Expect = 1.357e-61
Identity = 129/278 (46.40%), Postives = 157/278 (56.47%), Query Frame = 1
Query:  253 QTISPWNFSSFSQTSAQSNWLNSMAPGSVVEHEKVISTEPFKIEYSPYLSSHNPT--KYLSSKSLLLGQKPLSPS-----------YDSCLTNQSSLGFTFDYPSLDVQSGALRNQIFPTNPYYGYFCAMSDYSKHTFANSSQGNMLNFQNFNKVMRSKSKNSPNLDMSTEGRECVNCGATQTPLWRRDGTGHYLCNACGLYHKMNGTNRPLIKPKRRLSSARKVGTTCINCGTNHTTLWRRNQQGDSVCNACGLYYKLHHISRPISMKKDLIQTRNR 1047
             T SPWN S FS+TS     ++  +PG +  +    S+       SP+L +  PT  K +S    L    P S             Y   L +   L  +    S+    GA  +   P   Y  Y   + +YS   F  SS   +L         +S+ K       S+ GRECVNCGAT TPLWRRDGTGHYLCNACGLYHKMNG NRPLIKPKRRLS+AR+ GT+C NC T  TTLWRRN  GD VCNACGLYYKLH+I+RP++MKK+ IQTRNR
Sbjct:  107 HTASPWNLSPFSKTS-----IHHGSPGPLSVYPPASSSSLSGGHASPHLFTFPPTPPKDVSPDPSL--STPGSAGSARQDEKECLKYQVPLPDSMKLESSHSRGSMTALGGASSSTHHPITTYPPY---VPEYSSGLFPPSS---LLGGSPTGFGCKSRPK-----ARSSTGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEGIQTRNR 366          
BLAST of Transcription factor GATA-3 vs. UniProt/SwissProt
Match: sp|P23824|GATA2_CHICK (GATA-binding factor 2 OS=Gallus gallus OX=9031 GN=GATA2 PE=2 SV=1)

HSP 1 Score: 211.46 bits (537), Expect = 1.534e-61
Identity = 104/170 (61.18%), Postives = 119/170 (70.00%), Query Frame = 1
Query:  544 GALRNQIFPTNPYYGYFCAMSDYSKHTFANSSQGNMLN--FQNFNKVMRSKSKNSPNLDMSTEGRECVNCGATQTPLWRRDGTGHYLCNACGLYHKMNGTNRPLIKPKRRLSSARKVGTTCINCGTNHTTLWRRNQQGDSVCNACGLYYKLHHISRPISMKKDLIQTRNR 1047
            GA  +   P   Y  Y  A  DYS   F     G+ L     +F    RSK+++       +EGRECVNCGAT TPLWRRDGTGHYLCNACGLYHKMNG NRPLIKPKRRLS+AR+ GT C NC T  TTLWRRN  GD VCNACGLYYKLH+++RP++MKK+ IQTRNR
Sbjct:  224 GAQPSTHHPIPTYPSYVPAAHDYSSSLF---HPGSFLGGPASSFTPKPRSKARSC------SEGRECVNCGATATPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTCCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNVNRPLTMKKEGIQTRNR 384          
BLAST of Transcription factor GATA-3 vs. TrEMBL
Match: F1CDE2 (GATA123a (Fragment) OS=Schmidtea polychroa OX=50054 PE=2 SV=1)

HSP 1 Score: 221.861 bits (564), Expect = 9.516e-68
Identity = 101/101 (100.00%), Postives = 101/101 (100.00%), Query Frame = 1
Query:  715 MSTEGRECVNCGATQTPLWRRDGTGHYLCNACGLYHKMNGTNRPLIKPKRRLSSARKVGTTCINCGTNHTTLWRRNQQGDSVCNACGLYYKLHHISRPISM 1017
            MSTEGRECVNCGATQTPLWRRDGTGHYLCNACGLYHKMNGTNRPLIKPKRRLSSARKVGTTCINCGTNHTTLWRRNQQGDSVCNACGLYYKLHHISRPISM
Sbjct:    1 MSTEGRECVNCGATQTPLWRRDGTGHYLCNACGLYHKMNGTNRPLIKPKRRLSSARKVGTTCINCGTNHTTLWRRNQQGDSVCNACGLYYKLHHISRPISM 101          
BLAST of Transcription factor GATA-3 vs. TrEMBL
Match: A0A4S2LKW2 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_006446 PE=4 SV=1)

HSP 1 Score: 222.246 bits (565), Expect = 1.333e-63
Identity = 108/160 (67.50%), Postives = 126/160 (78.75%), Query Frame = 1
Query:  646 NMLNFQNFNKVMRSKSKNSPNLDMSTEGRECVNCGATQTPLWRRDGTGHYLCNACGLYHKMNGTNRPLIKPKRRLSSARKVGTTCINCGTNHTTLWRRNQQGDSVCNACGLYYKLHHISRPISMKKDLIQTRNRXXXXXXXXXEFDPISDFIKSDTAMMN 1125
            +ML   +    +RSKS+N       T+GRECVNCGATQTPLWRRD TGHYLCNACGLYHKMNGT+RPLIKPKRR+S+ RK GT C NC T HTTLWRRNQ GDSVCNACGLYYKLHHI+RP+SMKK++IQTRNR++T+ KK+K+    S  + S T   N
Sbjct:   55 HMLRISSLASKLRSKSRNL------TDGRECVNCGATQTPLWRRDETGHYLCNACGLYHKMNGTSRPLIKPKRRMSATRKSGTICANCRTAHTTLWRRNQHGDSVCNACGLYYKLHHINRPLSMKKEIIQTRNRRLTQGKKRKDMHHFSQLVGSVTTASN 208          
BLAST of Transcription factor GATA-3 vs. TrEMBL
Match: A0A1A6G3I9 (Uncharacterized protein OS=Neotoma lepida OX=56216 GN=A6R68_08929 PE=4 SV=1)

HSP 1 Score: 220.32 bits (560), Expect = 2.065e-63
Identity = 150/354 (42.37%), Postives = 191/354 (53.95%), Query Frame = 1
Query:  253 QTISPWNFSSFSQTSAQSNWLNSMAPGSVVEHEKVISTEPFKIEYSPYLSSHNPT--KYLSSKSLLLGQKPLSPS-----------YDSCLTNQSSLGFTFDYPSLDVQSGALRNQIFPTNPYYGYFCAMSDYSKHTFANSS--QGNMLNFQNFNKVMRSKSKNSPNLDMSTEGRECVNCGATQTPLWRRDGTGHYLCNACGLYHKMNGTNRPLIKPKRRLSSARKVGTTCINCGTNHTTLWRRNQQGDSVCNACGLYYKLHHISRPISMKKDLIQTRNRXXXXXXXXXE--FDPISDFIKSDTAMMNLLQEANTLQPISSLTNRLVAGNQTYQLHSTSQAHHDTQQPNNLDFG 1263
             T SPWN S FS+TS     ++  +PG +  +    S+       SP+L +  PT  K +S    L    P S             Y   L +   L  +    S+    GA  +   P   Y  Y   + +YS   F  SS   G+   F           K+ P    STEGRECVNCGAT TPLWRRDGTGHYLCNACGLYHKMNG NRPLIKPKRRLS+AR+ GT+C NC T  TTLWRRN  GD VCNACGLYYKLH+I+RP++MKK+ IQTRNRK++   KK +   D + DF KS +        A   + +SSL++     + ++ L + +  H     P+ L FG
Sbjct:   43 HTASPWNLSPFSKTS-----IHHGSPGPLSVYPPASSSSLAAGHSSPHLFTFPPTPPKDVSPDPSL--STPGSAGSARQDEKECLKYQVPLPDSMKLETSHSRGSMTTLGGASSSAHHPITTYPPY---VPEYSSGLFPPSSLLGGSPTGF---------GCKSRPKARSSTEGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEGIQTRNRKMSSKSKKCKKVHDALEDFPKSSS-----FNPAALSRHMSSLSHISPFSHSSHMLTTPTPMH----PPSGLSFG 368          
BLAST of Transcription factor GATA-3 vs. TrEMBL
Match: A0A1S3JFS3 (transcription factor GATA-3 isoform X3 OS=Lingula unguis OX=7574 GN=LOC106172844 PE=4 SV=1)

HSP 1 Score: 222.246 bits (565), Expect = 3.453e-63
Identity = 103/163 (63.19%), Postives = 125/163 (76.69%), Query Frame = 1
Query:  565 FPTNPYYGY--FCAMSDYSKHTFANSSQGNMLNFQNFNKVMRSKSKNSPNLDMSTEGRECVNCGATQTPLWRRDGTGHYLCNACGLYHKMNGTNRPLIKPKRRLSSARKVGTTCINCGTNHTTLWRRNQQGDSVCNACGLYYKLHHISRPISMKKDLIQTRNR 1047
             P++P   Y  +   +DY      +S+  +M  F+  + + R++SK       S+EGRECVNCGAT TPLWRRDGTGHYLCNACGLYHKMNG NRPLIKPKRRLS+AR+ GT+C NCGT+ TTLWRRNQ GD VCNACGLYYKLH+++RP++MKKD IQTRNR
Sbjct:  193 MPSHPMATYPAYVTGTDYGASLGFHSAAASM--FKATSALARARSKT----RSSSEGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTSCANCGTSTTTLWRRNQNGDPVCNACGLYYKLHNVNRPLTMKKDGIQTRNR 349          
BLAST of Transcription factor GATA-3 vs. TrEMBL
Match: A0A1S3JH34 (GATA-binding factor 2 isoform X4 OS=Lingula unguis OX=7574 GN=LOC106172844 PE=4 SV=1)

HSP 1 Score: 221.09 bits (562), Expect = 4.198e-63
Identity = 104/177 (58.76%), Postives = 124/177 (70.06%), Query Frame = 1
Query:  565 FPTNPY--YGYFCAMSDYSKHTFANSSQGNMLNFQNFNKVMRSKSKNS--------------PNLDMSTEGRECVNCGATQTPLWRRDGTGHYLCNACGLYHKMNGTNRPLIKPKRRLSSARKVGTTCINCGTNHTTLWRRNQQGDSVCNACGLYYKLHHISRPISMKKDLIQTRNR 1047
             P++P   Y  +   +DY      +S+  +M    +     RSK+++S              P    S EGRECVNCGAT TPLWRRDGTGHYLCNACGLYHKMNG NRPLIKPKRRLS+AR+ GT+C NCGT+ TTLWRRNQ GD VCNACGLYYKLH+++RP++MKKD IQTRNR
Sbjct:  134 MPSHPMATYPAYVTGTDYGASLGFHSAAASMFKATSALARARSKTRSSSDVFQQDRESDLFQPQFHESEEGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTSCANCGTSTTTLWRRNQNGDPVCNACGLYYKLHNVNRPLTMKKDGIQTRNR 310          
BLAST of Transcription factor GATA-3 vs. Ensembl Cavefish
Match: gata2a (GATA-binding factor 2-like [Source:NCBI gene;Acc:103037830])

HSP 1 Score: 209.534 bits (532), Expect = 9.388e-62
Identity = 105/190 (55.26%), Postives = 124/190 (65.26%), Query Frame = 1
Query:  475 DSCLTNQSSLGFTFDYPSLDVQSGALRNQIFPTNPYYGYFCAMSDYSKHTFANSSQGNMLNFQNFNKVMRSKSKNSPNLDMSTEGRECVNCGATQTPLWRRDGTGHYLCNACGLYHKMNGTNRPLIKPKRRLSSARKVGTTCINCGTNHTTLWRRNQQGDSVCNACGLYYKLHHISRPISMKKDLIQTRN 1044
            + C   ++ LG     PS         +   PT P Y    A  DY    F     G++L     +   + KSK   + +  TEGRECVNCGAT TPLWRRDGTGHYLCNACGLYHKMNG NRPLIKPKRRLS+AR+ GT C NC T  TTLWRRN  GD VCNACGLY+KLH+++RP++MKK+ IQTRN
Sbjct:  210 EGCSPLRTGLGMGAPAPSA--------HHPIPTYPAYS-LPAPHDYGASLF---HPGSLLGGSPSSFTPKCKSKTRSSSEFYTEGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTCCANCQTTTTTLWRRNGNGDPVCNACGLYFKLHNVNRPLTMKKEGIQTRN 387          
BLAST of Transcription factor GATA-3 vs. Ensembl Cavefish
Match: gata3 (GATA binding protein 3 [Source:NCBI gene;Acc:103042823])

HSP 1 Score: 207.994 bits (528), Expect = 2.432e-61
Identity = 101/158 (63.92%), Postives = 121/158 (76.58%), Query Frame = 1
Query:  694 KNSPNLDMSTEGRECVNCGATQTPLWRRDGTGHYLCNACGLYHKMNGTNRPLIKPKRRLSSARKVGTTCINCGTNHTTLWRRNQQGDSVCNACGLYYKLHHISRPISMKKDLIQTRNRXXXXXXXXXEF--DPISDFIKSDTAMMNLLQEANTLQPIS 1161
            K  P     +EGRECVNCGAT TPLWRRDGTGHYLCNACGLYHKMNG NRPLIKPKRRLS+AR+ GT+C NC T  TTLWRRN  GD VCNACGLYYKLH+I+RP++MKK+ IQTRNRK++   KK +   D + DF KS      L++++++  P +
Sbjct:  246 KTRPKTRSCSEGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEGIQTRNRKMSSKSKKSKKSQDSMEDFSKS------LMEKSSSFSPAA 397          
BLAST of Transcription factor GATA-3 vs. Ensembl Cavefish
Match: gata3 (GATA binding protein 3 [Source:NCBI gene;Acc:103042823])

HSP 1 Score: 207.608 bits (527), Expect = 2.520e-61
Identity = 101/158 (63.92%), Postives = 121/158 (76.58%), Query Frame = 1
Query:  694 KNSPNLDMSTEGRECVNCGATQTPLWRRDGTGHYLCNACGLYHKMNGTNRPLIKPKRRLSSARKVGTTCINCGTNHTTLWRRNQQGDSVCNACGLYYKLHHISRPISMKKDLIQTRNRXXXXXXXXXEF--DPISDFIKSDTAMMNLLQEANTLQPIS 1161
            K  P     +EGRECVNCGAT TPLWRRDGTGHYLCNACGLYHKMNG NRPLIKPKRRLS+AR+ GT+C NC T  TTLWRRN  GD VCNACGLYYKLH+I+RP++MKK+ IQTRNRK++   KK +   D + DF KS      L++++++  P +
Sbjct:  244 KTRPKTRSCSEGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEGIQTRNRKMSSKSKKSKKSQDSMEDFSKS------LMEKSSSFSPAA 395          
BLAST of Transcription factor GATA-3 vs. Ensembl Cavefish
Match: ENSAMXT00000017595.2 (GATA-binding factor 1-B-like [Source:NCBI gene;Acc:103031807])

HSP 1 Score: 202.601 bits (514), Expect = 1.462e-59
Identity = 110/233 (47.21%), Postives = 141/233 (60.52%), Query Frame = 1
Query:  580 YYGYFCAMSDYSKHTFANSSQGNMLNFQNFNKVMRSKSKNSPNLDMSTEGRECVNCGATQTPLWRRDGTGHYLCNACGLYHKMNGTNRPLIKPKRRLSSARKVGTTCINCGTNHTTLWRRNQQGDSVCNACGLYYKLHHISRPISMKKDLIQTRNRXXXXXXXXX------EFDPISDFIKSDTAMMNLLQEANTLQPISSLTNRLVAGNQTYQLHSTSQAHHDTQQPNNLDF 1260
            Y  Y     D+S   F + S        +F+  +R+K + SP     TE RECVNCGAT TPLWRRDGTGHYLCNACGLYHKMNG NRPLI+PK+RL  +++ GT C NC T+ TTLWRRN  G+ VCNACGLY+KLH+++RP++MKK+ IQTRNRK++   +K       E DP S+ I     M   + E  T+   +     LV  +        SQA H    P +L +
Sbjct:  203 YSSYGTPGQDFSSAAFYSPS--------SFSPKLRNKMRLSP-----TEARECVNCGATATPLWRRDGTGHYLCNACGLYHKMNGQNRPLIRPKKRLVVSKRAGTQCANCQTSTTTLWRRNANGEPVCNACGLYFKLHNVNRPLTMKKEGIQTRNRKVSGKSRKARRVAGVELDPFSESI-----MKGSVSEQPTMDSFNLGAGSLVPYSHAAHAMGPSQALHT---PTHLPY 414          
BLAST of Transcription factor GATA-3 vs. Ensembl Cavefish
Match: gata2b (GATA-binding factor 2 [Source:NCBI gene;Acc:103039425])

HSP 1 Score: 198.364 bits (503), Expect = 1.161e-58
Identity = 86/109 (78.90%), Postives = 97/109 (88.99%), Query Frame = 1
Query:  721 TEGRECVNCGATQTPLWRRDGTGHYLCNACGLYHKMNGTNRPLIKPKRRLSSARKVGTTCINCGTNHTTLWRRNQQGDSVCNACGLYYKLHHISRPISMKKDLIQTRNR 1047
            +EGRECVNCGAT TPLWRRDGTGHYLCNACGLYHKMNG NRPLI+PKRRLS+AR+ GT C NC T  TTLWRRN  G+ VCNACGLYYKLH+++RP++MKK+ IQTRNR
Sbjct:  192 SEGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIRPKRRLSAARRAGTCCANCHTGTTTLWRRNANGEPVCNACGLYYKLHNMNRPLTMKKEGIQTRNR 300          

HSP 2 Score: 57.7658 bits (138), Expect = 1.143e-8
Identity = 40/121 (33.06%), Postives = 58/121 (47.93%), Query Frame = 1
Query:  700 SPNLDMST---EGRECVNCGATQTPLWRRDGTGHYLCNACGLY--HKMNGTNRPLIKPKRRLSSARKVGTTCINCGTNHTTLWRRNQQGDSVCNACGLYYKLHHISRPISMKKDLIQTRNR 1047
            +P  D ST   +G +  +CG ++               AC  Y   K+ GT R     K+R +S    G  C+NCG   T LWRR+  G  +CNACGLY+K++  +RP+   K  +    R
Sbjct:  147 APPTDTSTTLLDGLDAESCGPSE--------------RACAYYSPEKLTGTARN----KQRANSE---GRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIRPKRRLSAARR 246          
BLAST of Transcription factor GATA-3 vs. Ensembl Sea Lamprey
Match: gata2b (GATA binding protein 2b [Source:ZFIN;Acc:ZDB-GENE-040718-440])

HSP 1 Score: 204.142 bits (518), Expect = 7.196e-64
Identity = 98/169 (57.99%), Postives = 118/169 (69.82%), Query Frame = 1
Query:  541 SGALRNQIFPTNPYYGYFCAMSDYSKHTFANSSQGNMLNFQNFNKVMRSKSKNSPNLDMSTEGRECVNCGATQTPLWRRDGTGHYLCNACGLYHKMNGTNRPLIKPKRRLSSARKVGTTCINCGTNHTTLWRRNQQGDSVCNACGLYYKLHHISRPISMKKDLIQTRNR 1047
             G +     P   Y  Y  A +DY    + ++ QG   +   F    +SK ++       ++GRECVNCGAT TPLWRRDGTGHYLCNACGLYHKMNG NRPLIKPKRRLS++R+ GT C NC T  TTLWRRN  G+ VCNACGLYYKLH+++RP+SMKK+ IQTRNR
Sbjct:    5 GGTVTTTHVPIPTYPAYIPAGTDYGAGFYPHAHQGT--SAHGFTTKSKSKGRSG------SDGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSASRRAGTACANCQTTTTTLWRRNPNGEPVCNACGLYYKLHNVNRPMSMKKEGIQTRNR 165          
BLAST of Transcription factor GATA-3 vs. Ensembl Sea Lamprey
Match: gata3 (GATA binding protein 3 [Source:NCBI gene;Acc:30458])

HSP 1 Score: 201.06 bits (510), Expect = 1.739e-62
Identity = 107/184 (58.15%), Postives = 127/184 (69.02%), Query Frame = 1
Query:  724 EGRECVNCGATQTPLWRRDGTGHYLCNACGLYHKMNGTNRPLIKPKRRLSSARKVGTTCINCGTNHTTLWRRNQQGDSVCNACGLYYKLHHISRPISMKKDLIQTRNRXXXXXXXXXE---FDPIS-DFIKSDTAMMNLLQEANTLQPISSLTNRLVAGNQTYQLHSTSQAHHDTQQPNNLDFG 1263
            EGRECVNCGAT TPLWRRDGTGHYLCNACGLYHKMNG NRPLIKPKRRLS+AR+ GT+C NC T  TTLWRRN  GD VCNACGLYYKLH+I+RP++MKK+ IQTRNRK+T   KK      D +  D+ KS             + P+S+L +  ++    + + S S  H     P +L FG
Sbjct:    1 EGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTSCANCQTTITTLWRRNASGDPVCNACGLYYKLHNINRPLTMKKEGIQTRNRKMTGKSKKNRKVVCDGLENDYAKSFHDKQGHYGAPALIGPLSTLGHHPLSPYPAHVIPSHSSMH----PPASLSFG 180          
BLAST of Transcription factor GATA-3 vs. Ensembl Sea Lamprey
Match: gata2b (GATA binding protein 2b [Source:ZFIN;Acc:ZDB-GENE-040718-440])

HSP 1 Score: 199.134 bits (505), Expect = 3.035e-61
Identity = 100/150 (66.67%), Postives = 114/150 (76.00%), Query Frame = 1
Query:  682 RSKSKNSPNLDMSTEGRECVNCGATQTPLWRRDGTGHYLCNACGLYHKMNGTNRPLIKPKRRLSSARKVGTTCINCGTNHTTLWRRNQQGDSVCNACGLYYKLHHISRPISMKKDLIQTRNRXXXXXXXXXEF---DPISDFIKSDTAMM 1122
            +SKSK     D    GRECVNCGAT TPLWRRDGTGHYLCNACGLYHKMNG NRPLIKPKRRLS++R+ GT C NC T  TTLWRRN  G+ VCNACGLYYKLH+++RP+SMKK+ IQTRNRK++   KK      DP  DF +S  A +
Sbjct:   16 KSKSKGRSGSD----GRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSASRRAGTACANCQTTTTTLWRRNPNGEPVCNACGLYYKLHNVNRPMSMKKEGIQTRNRKMSSKSKKGRKLSDDP--DFDQSRAAAL 159          
BLAST of Transcription factor GATA-3 vs. Ensembl Sea Lamprey
Match: gata4 (GATA binding protein 4 [Source:ZFIN;Acc:ZDB-GENE-980526-476])

HSP 1 Score: 166.007 bits (419), Expect = 5.825e-50
Identity = 76/113 (67.26%), Postives = 90/113 (79.65%), Query Frame = 1
Query:  709 LDMSTEGRECVNCGATQTPLWRRDGTGHYLCNACGLYHKMNGTNRPLIKPKRRLSSARKVGTTCINCGTNHTTLWRRNQQGDSVCNACGLYYKLHHISRPISMKKDLIQTRNR 1047
            LD S EGRECVNCGA  TPLWRRDGTGHYLCNACGLY+KMNG NRPLIKP+RR+S +R+VG +C NC T+ TTLWRRN +G+    ACG+   +  + RP++MKKD IQTR R
Sbjct:    7 LDESMEGRECVNCGAMSTPLWRRDGTGHYLCNACGLYNKMNGINRPLIKPQRRMSGSRRVGLSCSNCQTSTTTLWRRNAEGEPGYIACGIIV-IEGVPRPLAMKKDGIQTRKR 118          
BLAST of Transcription factor GATA-3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000698.1 (pep scaffold:Pmarinus_7.0:GL479144:20133:30389:-1 gene:ENSPMAG00000000635.1 transcript:ENSPMAT00000000698.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.003 bits (149), Expect = 1.233e-10
Identity = 28/48 (58.33%), Postives = 32/48 (66.67%), Query Frame = 1
Query:  880 RKVGTTCINCGTNHTTLWRRNQQGDSVCNACGLYYKLHHISRPISMKK 1023
            R  G  C+NC T  TTLWR+N  G  VCNACGLY KLH   RP+S+ K
Sbjct:    4 RGQGLFCVNCLTTTTTLWRKNAGGVYVCNACGLYEKLHSAPRPLSIIK 51          

HSP 2 Score: 54.6842 bits (130), Expect = 2.764e-8
Identity = 23/42 (54.76%), Postives = 29/42 (69.05%), Query Frame = 1
Query:  724 EGRECVNCGATQTPLWRRDGTGHYLCNACGLYHKMNGTNRPL 849
            +G  CVNC  T T LWR++  G Y+CNACGLY K++   RPL
Sbjct:    6 QGLFCVNCLTTTTTLWRKNAGGVYVCNACGLYEKLHSAPRPL 47          
BLAST of Transcription factor GATA-3 vs. Ensembl Yeast
Match: GZF3 (GATA zinc finger protein; negatively regulates nitrogen catabolic gene expression by competing with Gat1p for GATA site binding; function requires a repressive carbon source; dimerizes with Dal80p and binds to Tor1p; GZF3 has a paralog, DAL80, that arose from the whole genome duplication [Source:SGD;Acc:S000003646])

HSP 1 Score: 71.2478 bits (173), Expect = 1.191e-13
Identity = 29/51 (56.86%), Postives = 38/51 (74.51%), Query Frame = 1
Query:  895 TCINCGTNHTTLWRRNQQGDSVCNACGLYYKLHHISRPISMKKDLIQTRNR 1047
             C NC T+ T LWRR++ G  +CNACGL+ KLH   RPIS+K D+I++RNR
Sbjct:  130 VCKNCLTSTTPLWRRDEHGAMLCNACGLFLKLHGKPRPISLKTDVIKSRNR 180          

HSP 2 Score: 56.9954 bits (136), Expect = 3.540e-9
Identity = 22/38 (57.89%), Postives = 27/38 (71.05%), Query Frame = 1
Query:  736 CVNCGATQTPLWRRDGTGHYLCNACGLYHKMNGTNRPL 849
            C NC  + TPLWRRD  G  LCNACGL+ K++G  RP+
Sbjct:  131 CKNCLTSTTPLWRRDEHGAMLCNACGLFLKLHGKPRPI 168          
BLAST of Transcription factor GATA-3 vs. Ensembl Yeast
Match: GAT1 (Transcriptional activator of nitrogen catabolite repression genes; contains a GATA-1-type zinc finger DNA-binding motif; activity and localization regulated by nitrogen limitation and Ure2p; different translational starts produce two major and two minor isoforms that are differentially regulated and localized [Source:SGD;Acc:S000001873])

HSP 1 Score: 68.5514 bits (166), Expect = 7.523e-13
Identity = 26/50 (52.00%), Postives = 38/50 (76.00%), Query Frame = 1
Query:  898 CINCGTNHTTLWRRNQQGDSVCNACGLYYKLHHISRPISMKKDLIQTRNR 1047
            C NC T+ T LWR++ +G  +CNACGL+ KLH ++RP+S+K D+I+ R R
Sbjct:  310 CSNCTTSTTPLWRKDPKGLPLCNACGLFLKLHGVTRPLSLKTDIIKKRQR 359          
BLAST of Transcription factor GATA-3 vs. Ensembl Yeast
Match: GLN3 (Transcriptional activator of genes regulated by nitrogen catabolite repression; localization and activity regulated by quality of nitrogen source and Ure2p [Source:SGD;Acc:S000000842])

HSP 1 Score: 68.5514 bits (166), Expect = 1.056e-12
Identity = 27/54 (50.00%), Postives = 38/54 (70.37%), Query Frame = 1
Query:  880 RKVGTTCINCGTNHTTLWRRNQQGDSVCNACGLYYKLHHISRPISMKKDLIQTR 1041
            +K    C NC T  T LWRR+ +G+++CNACGL+ KLH   RP+S+K D+I+ R
Sbjct:  300 KKPLIQCFNCKTFKTPLWRRSPEGNTLCNACGLFQKLHGTMRPLSLKSDVIKKR 353          
BLAST of Transcription factor GATA-3 vs. Ensembl Yeast
Match: DAL80 (Negative regulator of genes in multiple nitrogen degradation pathways; expression is regulated by nitrogen levels and by Gln3p; member of the GATA-binding family, forms homodimers and heterodimers with Gzf3p; DAL80 has a paralog, GZF3, that arose from the whole genome duplication [Source:SGD;Acc:S000001742])

HSP 1 Score: 63.929 bits (154), Expect = 6.377e-12
Identity = 27/48 (56.25%), Postives = 34/48 (70.83%), Query Frame = 1
Query:  895 TCINCGTNHTTLWRRNQQGDSVCNACGLYYKLHHISRPISMKKDLIQT 1038
            TC NC T  T LWRR++ G  +CNACGL+ KLH   RPIS+K D I++
Sbjct:   30 TCQNCFTVKTPLWRRDEHGTVLCNACGLFLKLHGEPRPISLKTDTIKS 77          

HSP 2 Score: 56.9954 bits (136), Expect = 1.405e-9
Identity = 22/38 (57.89%), Postives = 27/38 (71.05%), Query Frame = 1
Query:  736 CVNCGATQTPLWRRDGTGHYLCNACGLYHKMNGTNRPL 849
            C NC   +TPLWRRD  G  LCNACGL+ K++G  RP+
Sbjct:   31 CQNCFTVKTPLWRRDEHGTVLCNACGLFLKLHGEPRPI 68          
BLAST of Transcription factor GATA-3 vs. Ensembl Nematostella
Match: GATA (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFY2])

HSP 1 Score: 202.986 bits (515), Expect = 4.135e-60
Identity = 87/109 (79.82%), Postives = 98/109 (89.91%), Query Frame = 1
Query:  721 TEGRECVNCGATQTPLWRRDGTGHYLCNACGLYHKMNGTNRPLIKPKRRLSSARKVGTTCINCGTNHTTLWRRNQQGDSVCNACGLYYKLHHISRPISMKKDLIQTRNR 1047
             +GRECVNCGAT TPLWRRDG+GHYLCNACGLYHKMNG++RPLIKPKRRLS+AR+ GT+C NC T  TTLWRRNQ GD VCNACGLY+KLH ++RP+SMKKD IQTRNR
Sbjct:  213 ADGRECVNCGATSTPLWRRDGSGHYLCNACGLYHKMNGSSRPLIKPKRRLSAARRAGTSCANCHTTQTTLWRRNQNGDPVCNACGLYWKLHAVNRPLSMKKDGIQTRNR 321          
BLAST of Transcription factor GATA-3 vs. Ensembl Medaka
Match: gata3 (GATA binding protein 3 [Source:NCBI gene;Acc:100049296])

HSP 1 Score: 207.608 bits (527), Expect = 3.025e-61
Identity = 124/282 (43.97%), Postives = 155/282 (54.96%), Query Frame = 1
Query:  241 LNPLQTISPWNFSSFSQTSAQSNWLNSMAPGSVVEHEKVISTEPFKIEYSPYLSSHNPTKYLSSKSLLLGQKPLSPSY-----DSCLTNQSSLGFTFD--------YPSLDVQSGALRNQIFPTNPYYGYFCAMSDYSKHTFANSSQGNMLNFQNFNKVMRSKSKNSPNLDMSTEGRECVNCGATQTPLWRRDGTGHYLCNACGLYHKMNGTNRPLIKPKRRLSSARKVGTTCINCGTNHTTLWRRNQQGDSVCNACGLYYKLHHISRPISMKKDLIQTRNR 1047
            + P  + SPWN S F +     N L+  +P S+  +    ST       SP+L +  PT             P S S        C+  Q +L  +            S+   S +  + I P  PY        +Y    F  S      +    +K  R K+++       +EGRECVNCGAT TPLWRRDGTGHYLCNACGLYHKMNG NRPLIKPKRRLS+AR+ GT+C NC T  TTLWRRN  GD VCNACGLY+KLH+I+RP++MKK+ IQTRNR
Sbjct:  100 IGPHHSSSPWNLSPFPK-----NPLHHGSPASLSVYPPASSTSLSTGHSSPHLFTFPPTPPKDVSPDPGISTPGSSSSGRQEDKECIKYQVTLADSMKLESAHSRSVASIGAGSASAHHPIAPYPPY--------EYGPGLFPPSGLIGGSSSSYGSKT-RPKTRSC------SEGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYFKLHNINRPLTMKKEGIQTRNR 361          
BLAST of Transcription factor GATA-3 vs. Ensembl Medaka
Match: gata2a (GATA-binding factor 2 [Source:NCBI gene;Acc:101161391])

HSP 1 Score: 206.838 bits (525), Expect = 7.984e-61
Identity = 103/174 (59.20%), Postives = 126/174 (72.41%), Query Frame = 1
Query:  526 SLDVQSGALRNQIFPTNPYYGYFCAMSDYSKHTFANSSQGNMLNFQNFNKVMRSKSKNSPNLDMSTEGRECVNCGATQTPLWRRDGTGHYLCNACGLYHKMNGTNRPLIKPKRRLSSARKVGTTCINCGTNHTTLWRRNQQGDSVCNACGLYYKLHHISRPISMKKDLIQTRNR 1047
            S++ Q+ A  + I PT P Y       +YS   F +       +  +F    +SK+++S   ++ TEGRECVNCGAT TPLWRRDGTGHYLCNACGLYHKMNG NRPLIKPKRRLS+AR+ GT C NC T  TTLWRRN  GD VCNACGLY+KLH+++RP++MKK+ IQTRNR
Sbjct:  210 SMNSQAPATHHPI-PTYPAY-TLPTPHEYSGSLF-HPGSLLGGSSSSFTPKCKSKARSS--SELYTEGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTCCANCQTTTTTLWRRNGNGDPVCNACGLYFKLHNVNRPLTMKKEGIQTRNR 378          
BLAST of Transcription factor GATA-3 vs. Ensembl Medaka
Match: gata2 (GATA binding protein 2 [Source:NCBI gene;Acc:100125427])

HSP 1 Score: 203.371 bits (516), Expect = 1.660e-59
Identity = 88/109 (80.73%), Postives = 96/109 (88.07%), Query Frame = 1
Query:  721 TEGRECVNCGATQTPLWRRDGTGHYLCNACGLYHKMNGTNRPLIKPKRRLSSARKVGTTCINCGTNHTTLWRRNQQGDSVCNACGLYYKLHHISRPISMKKDLIQTRNR 1047
            TEGRECVNCGAT TPLWRRD TGHYLCNACGLYHKMNG NRPLIKPKRRLS+AR+ GT C NC T  TTLWRRN  GD VCNACGLYYKLH+++RP++MKK+ IQTRNR
Sbjct:  270 TEGRECVNCGATSTPLWRRDSTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTCCANCQTTTTTLWRRNASGDPVCNACGLYYKLHNVNRPLTMKKEGIQTRNR 378          
BLAST of Transcription factor GATA-3 vs. Ensembl Medaka
Match: gata-1 (hematopietic transcription factor GATA-1 [Source:NCBI gene;Acc:100125425])

HSP 1 Score: 198.749 bits (504), Expect = 3.623e-58
Identity = 91/158 (57.59%), Postives = 115/158 (72.78%), Query Frame = 1
Query:  574 NPYYGYFCAMSDYSKHTFANSSQGNMLNFQNFNKVMRSKSKNSPNLDMSTEGRECVNCGATQTPLWRRDGTGHYLCNACGLYHKMNGTNRPLIKPKRRLSSARKVGTTCINCGTNHTTLWRRNQQGDSVCNACGLYYKLHHISRPISMKKDLIQTRNR 1047
            +PY  Y     DYS      S  G  +N  +++  +R+K + +     + E RECVNCGAT TPLWRRDGTGHYLCNACGLYHKMNG NRPLI+PK+RL  +++ GT C NC T+ TTLWRRN  G+ VCNACGLY+KLH+++RP++MKK+ IQTRNR
Sbjct:  191 SPYSSYMSGPQDYSSAALY-SGAGAWIN-PSYSPKLRNKMRAT-----TPEARECVNCGATATPLWRRDGTGHYLCNACGLYHKMNGQNRPLIRPKKRLIVSKRAGTQCANCHTSTTTLWRRNANGEPVCNACGLYFKLHNVNRPLTMKKEGIQTRNR 341          
BLAST of Transcription factor GATA-3 vs. Ensembl Medaka
Match: gata4 (GATA binding protein 4 [Source:NCBI gene;Acc:100125520])

HSP 1 Score: 194.126 bits (492), Expect = 1.208e-56
Identity = 91/134 (67.91%), Postives = 104/134 (77.61%), Query Frame = 1
Query:  703 PNLDMS---TEGRECVNCGATQTPLWRRDGTGHYLCNACGLYHKMNGTNRPLIKPKRRLSSARKVGTTCINCGTNHTTLWRRNQQGDSVCNACGLYYKLHHISRPISMKKDLIQTRNRXXXXXXXXXEFDPISD 1095
            PN+D+     EGRECVNCGA  TPLWRRDGTGHYLCNACGLYHKMNG NRPLIKP+RRLS++R+VG +C NC T  TTLWRRN +G+ VCNACGLY KLH + RP++MKKD IQTR RK     K +   P SD
Sbjct:  172 PNIDLFDDFAEGRECVNCGAMSTPLWRRDGTGHYLCNACGLYHKMNGINRPLIKPQRRLSASRRVGLSCTNCHTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMKKDGIQTRKRKPKNLNKTQSGTPGSD 305          
BLAST of Transcription factor GATA-3 vs. Planmine SMEST
Match: SMESG000079514.1 (SMESG000079514.1)

HSP 1 Score: 860.907 bits (2223), Expect = 0.000e+0
Identity = 438/440 (99.55%), Postives = 438/440 (99.55%), Query Frame = 1
Query:  109 MDFSTSFNSLPSKLDLNSRILCVNAELSAITESTNEQISANRGRLNPLQTISPWNFSSFSQTSAQSNWLNSMAPGSVVEHEKVISTEPFKIEYSPYLSSHNPTKYLSSKSLLLGQKPLSPSYDSCLTNQSSLGFTFDYPSLDVQSGALRNQIFPTNPYYGYFCAMSDYSKHTFANSSQGNMLNFQNFNKVMRSKSKNSPNLDMSTEGRECVNCGATQTPLWRRDGTGHYLCNACGLYHKMNGTNRPLIKPKRRLSSARKVGTTCINCGTNHTTLWRRNQQGDSVCNACGLYYKLHHISRPISMKKDLIQTRNRXXXXXXXXXEFDPISDFIKSDTAMMNLLQEANTLQPISSLTNRLVAGNQTYQLHSTSQAHHDTQQPNNLDFGKXXXXXXXXXXXXRQTSPDFHRHSHYQMRNSRINNETPLGNPIDYTFNTSNQQVY 1428
            MDFSTSFNSLPSKLDLNSRILCVNAELSAITESTNEQISANRGRLNPLQTISPWNFSSFSQTSAQSNWLNSMAPGSVVEHEKVIS EPFKIEYSPYLSSHN TKYLSSKSLLLGQKPLSPSYDSCLTNQSSLGFTFDYPSLDVQSGALRNQIFPTNPYYGYFCAMSDYSKHTFANSSQGNMLNFQNFNKVMRSKSKNSPNLDMSTEGRECVNCGATQTPLWRRDGTGHYLCNACGLYHKMNGTNRPLIKPKRRLSSARKVGTTCINCGTNHTTLWRRNQQGDSVCNACGLYYKLHHISRPISMKKDLIQTRNRKITKSKKKKEFDPISDFIKSDTAMMNLLQEANTLQPISSLTNRLVAGNQTYQLHSTSQAHHDTQQPNNLDFGKFFSLSDNFSFDNRQTSPDFHRHSHYQMRNSRINNETPLGNPIDYTFNTSNQQVY
Sbjct:    1 MDFSTSFNSLPSKLDLNSRILCVNAELSAITESTNEQISANRGRLNPLQTISPWNFSSFSQTSAQSNWLNSMAPGSVVEHEKVISAEPFKIEYSPYLSSHNSTKYLSSKSLLLGQKPLSPSYDSCLTNQSSLGFTFDYPSLDVQSGALRNQIFPTNPYYGYFCAMSDYSKHTFANSSQGNMLNFQNFNKVMRSKSKNSPNLDMSTEGRECVNCGATQTPLWRRDGTGHYLCNACGLYHKMNGTNRPLIKPKRRLSSARKVGTTCINCGTNHTTLWRRNQQGDSVCNACGLYYKLHHISRPISMKKDLIQTRNRKITKSKKKKEFDPISDFIKSDTAMMNLLQEANTLQPISSLTNRLVAGNQTYQLHSTSQAHHDTQQPNNLDFGKFFSLSDNFSFDNRQTSPDFHRHSHYQMRNSRINNETPLGNPIDYTFNTSNQQVY 440          
BLAST of Transcription factor GATA-3 vs. Planmine SMEST
Match: SMESG000028503.1 (SMESG000028503.1)

HSP 1 Score: 192.2 bits (487), Expect = 2.219e-54
Identity = 82/108 (75.93%), Postives = 92/108 (85.19%), Query Frame = 1
Query:  724 EGRECVNCGATQTPLWRRDGTGHYLCNACGLYHKMNGTNRPLIKPKRRLSSARKVGTTCINCGTNHTTLWRRNQQGDSVCNACGLYYKLHHISRPISMKKDLIQTRNR 1047
            EGRECVNCGA  TPLWRRDG G+YLCNACGLY KMNG NRPLIKPKRRLS++R+ GT C NC T+ TTLWRRN  G+ VCNACGLY+KLH +SRP +MKK+ IQTRNR
Sbjct:  368 EGRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRRTGTICSNCNTSTTTLWRRNSNGEPVCNACGLYFKLHSVSRPPTMKKEGIQTRNR 475          
BLAST of Transcription factor GATA-3 vs. Planmine SMEST
Match: SMESG000028503.1 (SMESG000028503.1)

HSP 1 Score: 192.2 bits (487), Expect = 2.258e-54
Identity = 82/108 (75.93%), Postives = 92/108 (85.19%), Query Frame = 1
Query:  724 EGRECVNCGATQTPLWRRDGTGHYLCNACGLYHKMNGTNRPLIKPKRRLSSARKVGTTCINCGTNHTTLWRRNQQGDSVCNACGLYYKLHHISRPISMKKDLIQTRNR 1047
            EGRECVNCGA  TPLWRRDG G+YLCNACGLY KMNG NRPLIKPKRRLS++R+ GT C NC T+ TTLWRRN  G+ VCNACGLY+KLH +SRP +MKK+ IQTRNR
Sbjct:  366 EGRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRRTGTICSNCNTSTTTLWRRNSNGEPVCNACGLYFKLHSVSRPPTMKKEGIQTRNR 473          
BLAST of Transcription factor GATA-3 vs. Planmine SMEST
Match: SMESG000028503.1 (SMESG000028503.1)

HSP 1 Score: 192.2 bits (487), Expect = 4.585e-54
Identity = 82/108 (75.93%), Postives = 92/108 (85.19%), Query Frame = 1
Query:  724 EGRECVNCGATQTPLWRRDGTGHYLCNACGLYHKMNGTNRPLIKPKRRLSSARKVGTTCINCGTNHTTLWRRNQQGDSVCNACGLYYKLHHISRPISMKKDLIQTRNR 1047
            EGRECVNCGA  TPLWRRDG G+YLCNACGLY KMNG NRPLIKPKRRLS++R+ GT C NC T+ TTLWRRN  G+ VCNACGLY+KLH +SRP +MKK+ IQTRNR
Sbjct:  368 EGRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRRTGTICSNCNTSTTTLWRRNSNGEPVCNACGLYFKLHSVSRPPTMKKEGIQTRNR 475          
BLAST of Transcription factor GATA-3 vs. Planmine SMEST
Match: SMESG000028503.1 (SMESG000028503.1)

HSP 1 Score: 191.815 bits (486), Expect = 4.630e-54
Identity = 82/108 (75.93%), Postives = 92/108 (85.19%), Query Frame = 1
Query:  724 EGRECVNCGATQTPLWRRDGTGHYLCNACGLYHKMNGTNRPLIKPKRRLSSARKVGTTCINCGTNHTTLWRRNQQGDSVCNACGLYYKLHHISRPISMKKDLIQTRNR 1047
            EGRECVNCGA  TPLWRRDG G+YLCNACGLY KMNG NRPLIKPKRRLS++R+ GT C NC T+ TTLWRRN  G+ VCNACGLY+KLH +SRP +MKK+ IQTRNR
Sbjct:  366 EGRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRRTGTICSNCNTSTTTLWRRNSNGEPVCNACGLYFKLHSVSRPPTMKKEGIQTRNR 473          
The following BLAST results are available for this feature:
BLAST of Transcription factor GATA-3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GATA31.649e-6447.14GATA binding protein 3 [Source:HGNC Symbol;Acc:HGN... [more]
GATA32.826e-6246.40GATA binding protein 3 [Source:HGNC Symbol;Acc:HGN... [more]
GATA23.635e-6163.19GATA binding protein 2 [Source:HGNC Symbol;Acc:HGN... [more]
GATA23.635e-6163.19GATA binding protein 2 [Source:HGNC Symbol;Acc:HGN... [more]
GATA44.601e-5872.88GATA binding protein 4 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of Transcription factor GATA-3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
elt-16.854e-5167.54Transcription factor elt-1 [Source:UniProtKB/Swis... [more]
elt-12.851e-5065.55Transcription factor elt-1 [Source:UniProtKB/Swis... [more]
elt-18.075e-5068.70Transcription factor elt-1 [Source:UniProtKB/Swis... [more]
elt-12.894e-4966.67Transcription factor elt-1 [Source:UniProtKB/Swis... [more]
elt-12.950e-4966.67Transcription factor elt-1 [Source:UniProtKB/Swis... [more]
back to top
BLAST of Transcription factor GATA-3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pnr1.045e-5575.00gene:FBgn0003117 transcript:FBtr0335426[more]
grn1.613e-5563.16gene:FBgn0001138 transcript:FBtr0300040[more]
grn2.929e-5563.16gene:FBgn0001138 transcript:FBtr0330188[more]
grn3.098e-5574.56gene:FBgn0001138 transcript:FBtr0081808[more]
pnr9.586e-5574.77gene:FBgn0003117 transcript:FBtr0335427[more]
back to top
BLAST of Transcription factor GATA-3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gata32.447e-6245.33GATA binding protein 3 [Source:NCBI gene;Acc:30458... [more]
gata2a3.089e-6155.79GATA binding protein 2a [Source:ZFIN;Acc:ZDB-GENE-... [more]
gata1a5.969e-6058.86GATA binding protein 1a [Source:ZFIN;Acc:ZDB-GENE-... [more]
gata1a5.969e-6058.86GATA binding protein 1a [Source:ZFIN;Acc:ZDB-GENE-... [more]
gata2a2.038e-5954.69GATA binding protein 2a [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of Transcription factor GATA-3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gata38.664e-6357.51GATA binding protein 3 [Source:NCBI gene;Acc:44839... [more]
gata31.134e-6257.51GATA binding protein 3 [Source:NCBI gene;Acc:44839... [more]
GATA21.834e-6162.28GATA binding protein 2 [Source:NCBI gene;Acc:10048... [more]
mcm47.076e-5959.38minichromosome maintenance complex component 4 [So... [more]
ENSXETT00000034979.16.101e-5773.28GATA binding protein 1 [Source:NCBI gene;Acc:10049... [more]
back to top
BLAST of Transcription factor GATA-3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gata32.248e-6542.37GATA binding protein 3 [Source:MGI Symbol;Acc:MGI:... [more]
Gata26.743e-6162.58GATA binding protein 2 [Source:MGI Symbol;Acc:MGI:... [more]
Gata26.743e-6162.58GATA binding protein 2 [Source:MGI Symbol;Acc:MGI:... [more]
Gata41.988e-5869.60GATA binding protein 4 [Source:MGI Symbol;Acc:MGI:... [more]
Gata41.116e-5772.57GATA binding protein 4 [Source:MGI Symbol;Acc:MGI:... [more]
back to top
BLAST of Transcription factor GATA-3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P23772|GATA3_MOUSE1.572e-6442.37Trans-acting T-cell-specific transcription factor ... [more]
sp|P23825|GATA3_CHICK1.024e-6245.70GATA-binding factor 3 OS=Gallus gallus OX=9031 GN=... [more]
sp|Q08DV0|GATA3_BOVIN7.070e-6241.76Trans-acting T-cell-specific transcription factor ... [more]
sp|P23771|GATA3_HUMAN1.357e-6146.40Trans-acting T-cell-specific transcription factor ... [more]
sp|P23824|GATA2_CHICK1.534e-6161.18GATA-binding factor 2 OS=Gallus gallus OX=9031 GN=... [more]
back to top
BLAST of Transcription factor GATA-3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
F1CDE29.516e-68100.00GATA123a (Fragment) OS=Schmidtea polychroa OX=5005... [more]
A0A4S2LKW21.333e-6367.50Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A1A6G3I92.065e-6342.37Uncharacterized protein OS=Neotoma lepida OX=56216... [more]
A0A1S3JFS33.453e-6363.19transcription factor GATA-3 isoform X3 OS=Lingula ... [more]
A0A1S3JH344.198e-6358.76GATA-binding factor 2 isoform X4 OS=Lingula unguis... [more]
back to top
BLAST of Transcription factor GATA-3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gata2a9.388e-6255.26GATA-binding factor 2-like [Source:NCBI gene;Acc:1... [more]
gata32.432e-6163.92GATA binding protein 3 [Source:NCBI gene;Acc:10304... [more]
gata32.520e-6163.92GATA binding protein 3 [Source:NCBI gene;Acc:10304... [more]
ENSAMXT00000017595.21.462e-5947.21GATA-binding factor 1-B-like [Source:NCBI gene;Acc... [more]
gata2b1.161e-5878.90GATA-binding factor 2 [Source:NCBI gene;Acc:103039... [more]
back to top
BLAST of Transcription factor GATA-3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gata2b7.196e-6457.99GATA binding protein 2b [Source:ZFIN;Acc:ZDB-GENE-... [more]
gata31.739e-6258.15GATA binding protein 3 [Source:NCBI gene;Acc:30458... [more]
gata2b3.035e-6166.67GATA binding protein 2b [Source:ZFIN;Acc:ZDB-GENE-... [more]
gata45.825e-5067.26GATA binding protein 4 [Source:ZFIN;Acc:ZDB-GENE-9... [more]
ENSPMAT00000000698.11.233e-1058.33pep scaffold:Pmarinus_7.0:GL479144:20133:30389:-1 ... [more]
back to top
BLAST of Transcription factor GATA-3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
GZF31.191e-1356.86GATA zinc finger protein; negatively regulates nit... [more]
GAT17.523e-1352.00Transcriptional activator of nitrogen catabolite r... [more]
GLN31.056e-1250.00Transcriptional activator of genes regulated by ni... [more]
DAL806.377e-1256.25Negative regulator of genes in multiple nitrogen d... [more]
back to top
BLAST of Transcription factor GATA-3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
GATA4.135e-6079.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Transcription factor GATA-3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gata33.025e-6143.97GATA binding protein 3 [Source:NCBI gene;Acc:10004... [more]
gata2a7.984e-6159.20GATA-binding factor 2 [Source:NCBI gene;Acc:101161... [more]
gata21.660e-5980.73GATA binding protein 2 [Source:NCBI gene;Acc:10012... [more]
gata-13.623e-5857.59hematopietic transcription factor GATA-1 [Source:N... [more]
gata41.208e-5667.91GATA binding protein 4 [Source:NCBI gene;Acc:10012... [more]
back to top
BLAST of Transcription factor GATA-3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000079514.10.000e+099.55SMESG000079514.1[more]
SMESG000028503.12.219e-5475.93SMESG000028503.1[more]
SMESG000028503.12.258e-5475.93SMESG000028503.1[more]
SMESG000028503.14.585e-5475.93SMESG000028503.1[more]
SMESG000028503.14.630e-5475.93SMESG000028503.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011950 ID=SMED30011950|Name=Transcription factor GATA-3|organism=Schmidtea mediterranea sexual|type=transcript|length=1478bp
CCGAAATACAGATAAGGAATCGTTGTATATCTGATACTGTCTGATTGAAG
ATTATCTCTCCTAGGGAAAATTATAAAGAAATTATCTAATACCCTATCAA
GCCTCACTATGGATTTTTCTACTTCCTTTAATTCTTTACCTTCAAAACTG
GATTTGAACAGTCGAATCTTGTGCGTGAATGCCGAACTGTCAGCGATCAC
AGAATCTACTAACGAACAAATCTCTGCAAACCGAGGTCGGCTCAATCCTT
TGCAAACGATTTCACCGTGGAATTTTTCTTCGTTCAGTCAGACCTCAGCT
CAGTCGAATTGGCTGAATAGTATGGCTCCTGGATCGGTTGTCGAACATGA
GAAAGTAATTTCAACAGAACCCTTCAAAATTGAATACTCTCCATATTTGT
CATCACATAATCCAACCAAATATCTCTCTTCGAAATCTTTGTTACTAGGA
CAAAAACCTCTTTCTCCTTCCTACGACTCATGCTTGACAAATCAGTCATC
TTTAGGATTCACATTTGATTATCCTTCACTCGATGTGCAGTCCGGTGCAT
TGAGGAATCAGATTTTCCCCACGAATCCTTACTATGGATATTTTTGCGCA
ATGTCCGACTATTCTAAACATACATTTGCCAATTCCTCCCAGGGAAATAT
GTTGAATTTTCAAAATTTTAATAAAGTAATGCGATCAAAATCGAAAAATA
GTCCAAATTTGGACATGTCAACGGAAGGACGAGAATGCGTCAATTGTGGA
GCAACTCAGACCCCTCTCTGGAGAAGAGACGGAACTGGACACTATTTATG
CAATGCTTGTGGACTTTATCATAAAATGAACGGCACTAATCGGCCATTAA
TTAAACCGAAAAGAAGATTGTCTTCAGCAAGAAAAGTCGGTACAACGTGC
ATAAATTGTGGAACAAATCACACGACTCTGTGGCGCCGAAATCAGCAAGG
AGACTCGGTGTGTAACGCTTGTGGGTTATATTACAAATTACATCACATAA
GTCGACCGATCTCAATGAAAAAAGATCTCATTCAAACTAGAAACCGAAAA
ATAACAAAGTCAAAAAAGAAAAAAGAATTCGATCCAATATCAGACTTTAT
AAAATCGGATACGGCAATGATGAACCTTCTGCAAGAAGCTAATACCCTTC
AACCGATATCTTCTTTAACGAATCGGTTAGTAGCTGGCAATCAAACTTAC
CAACTCCATTCGACAAGTCAAGCTCATCACGATACTCAACAACCAAATAA
TTTGGATTTTGGGAAATTCTTTTCACTTTCAGACAATTTTAGTTTTGATA
ACAGACAAACCTCACCAGATTTCCATCGACATTCTCATTATCAAATGAGA
AATTCAAGAATCAACAATGAGACCCCTTTAGGTAATCCGATTGACTATAC
CTTCAATACCTCAAACCAGCAAGTTTATTAGAACAATTACAGTTTAACGT
AAAGTTGTAATGTAAATAAATTTGAGAT
back to top

protein sequence of SMED30011950-orf-1

>SMED30011950-orf-1 ID=SMED30011950-orf-1|Name=SMED30011950-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=441bp
MDFSTSFNSLPSKLDLNSRILCVNAELSAITESTNEQISANRGRLNPLQT
ISPWNFSSFSQTSAQSNWLNSMAPGSVVEHEKVISTEPFKIEYSPYLSSH
NPTKYLSSKSLLLGQKPLSPSYDSCLTNQSSLGFTFDYPSLDVQSGALRN
QIFPTNPYYGYFCAMSDYSKHTFANSSQGNMLNFQNFNKVMRSKSKNSPN
LDMSTEGRECVNCGATQTPLWRRDGTGHYLCNACGLYHKMNGTNRPLIKP
KRRLSSARKVGTTCINCGTNHTTLWRRNQQGDSVCNACGLYYKLHHISRP
ISMKKDLIQTRNRKITKSKKKKEFDPISDFIKSDTAMMNLLQEANTLQPI
SSLTNRLVAGNQTYQLHSTSQAHHDTQQPNNLDFGKFFSLSDNFSFDNRQ
TSPDFHRHSHYQMRNSRINNETPLGNPIDYTFNTSNQQVY*
back to top
Aliases
The feature 'Transcription factor GATA-3' has the following synonyms
Synonym
Smed-GATA123*
Spol-GATA123a
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000429neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR016374TF_GATA-2/3
IPR039355Transcription_factor_GATA
IPR000679Znf_GATA
IPR013088Znf_NHR/GATA
Vocabulary: molecular function
TermDefinition
GO:0043565sequence-specific DNA binding
GO:0008270zinc ion binding
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0000976transcription regulatory region sequence-specific DNA binding
GO:0000977RNA polymerase II regulatory region sequence-specific DNA binding
GO:0001085RNA polymerase II transcription factor binding
GO:0001228transcriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding
GO:0003677DNA binding
GO:0003682chromatin binding
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
GO:0006351transcription, DNA-templated
GO:0006366transcription from RNA polymerase II promoter
GO:0008284positive regulation of cell proliferation
GO:0008543fibroblast growth factor receptor signaling pathway
GO:0021514ventral spinal cord interneuron differentiation
GO:0031101fin regeneration
GO:0042246tissue regeneration
GO:0043049otic placode formation
GO:0045582positive regulation of T cell differentiation
GO:0045944positive regulation of transcription from RNA polymerase II promoter
GO:0048702embryonic neurocranium morphogenesis
GO:0050769positive regulation of neurogenesis
GO:0060788ectodermal placode formation
GO:0061026cardiac muscle tissue regeneration
GO:0071696ectodermal placode development
GO:2001224positive regulation of neuron migration
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005667transcription factor complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000679Zinc finger, GATA-typePRINTSPR00619GATAZNFINGERcoord: 224..241
score: 77.0
coord: 206..223
score: 72.05
IPR000679Zinc finger, GATA-typeSMARTSM00401GATA_3coord: 258..308
e-value: 3.3E-19
score: 79.8
coord: 204..254
e-value: 3.5E-20
score: 83.1
IPR000679Zinc finger, GATA-typePFAMPF00320GATAcoord: 264..296
e-value: 6.9E-13
score: 48.0
coord: 210..243
e-value: 1.2E-14
score: 53.6
IPR000679Zinc finger, GATA-typePROSITEPS00344GATA_ZN_FINGER_1coord: 210..234
IPR000679Zinc finger, GATA-typePROSITEPS00344GATA_ZN_FINGER_1coord: 264..288
IPR000679Zinc finger, GATA-typePROSITEPS50114GATA_ZN_FINGER_2coord: 258..311
score: 26.772
IPR000679Zinc finger, GATA-typePROSITEPS50114GATA_ZN_FINGER_2coord: 204..258
score: 28.723
IPR000679Zinc finger, GATA-typeCDDcd00202ZnF_GATAcoord: 263..313
e-value: 2.02041E-17
score: 73.9462
IPR000679Zinc finger, GATA-typeCDDcd00202ZnF_GATAcoord: 209..259
e-value: 4.62046E-20
score: 81.265
IPR016374Transcription factor, GATA-2/3PIRSFPIRSF003027Txn_fact_GATA-1/2/3coord: 32..391
e-value: 2.7E-85
score: 285.0
IPR013088Zinc finger, NHR/GATA-typeGENE3DG3DSA:3.30.50.10coord: 254..314
e-value: 1.2E-28
score: 100.4
IPR013088Zinc finger, NHR/GATA-typeGENE3DG3DSA:3.30.50.10coord: 204..253
e-value: 9.6E-28
score: 97.3
NoneNo IPR availablePANTHERPTHR10071:SF315GATA-BINDING FACTOR Ccoord: 172..344
NoneNo IPR availableSUPERFAMILYSSF57716Glucocorticoid receptor-like (DNA-binding domain)coord: 257..316
NoneNo IPR availableSUPERFAMILYSSF57716Glucocorticoid receptor-like (DNA-binding domain)coord: 206..253
IPR039355Transcription factor GATAPANTHERPTHR10071TRANSCRIPTION FACTOR GATA FAMILY MEMBERcoord: 172..344