F-box/WD repeat-containing protein 10

Overview
NameF-box/WD repeat-containing protein 10
Smed IDSMED30011948
Length (bp)3386
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of F-box/WD repeat-containing protein 10 (SMED30011948) t-SNE clustered cells

Violin plots show distribution of expression levels for F-box/WD repeat-containing protein 10 (SMED30011948) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of F-box/WD repeat-containing protein 10 (SMED30011948) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for F-box/WD repeat-containing protein 10 (SMED30011948) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011948

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30011948SMESG000002351.1 SMESG000002342.1 SmedASXL_016919SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30011948SMESG000002351.1 SMESG000002342.1 dd_Smed_v4_13271_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30011948SMESG000002351.1 SMESG000002342.1 dd_Smed_v4_13271_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30011948SMESG000002351.1 SMESG000002342.1 dd_Smed_v6_13271_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30011948SMESG000002351.1 SMESG000002342.1 dd_Smed_v4_13271_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of F-box/WD repeat-containing protein 10 vs. Ensembl Human
Match: FBXW10 (F-box and WD repeat domain containing 10 [Source:HGNC Symbol;Acc:HGNC:1211])

HSP 1 Score: 320.087 bits (819), Expect = 5.089e-92
Identity = 170/467 (36.40%), Postives = 258/467 (55.25%), Query Frame = 2
Query:  692 DFISNLPVHISKRIINFLDEKSLNVCSKVCEIWQQIVYEVRREDIVNAKIKKQAMMLQSQKDESKSVFTAPADPRFARDTNVRVPQLEPHSHRIIYINNSPPHTTNKDTYQIDNFNELELINSRKVFSMDVAYQNILTKKLIIEERNIFCGSYSVMIILESQSRNRDPLRTISYNGGLLVAVSGTNKIIQFLDKRGIQTEIMKNSIRGHAGSIKVVKFLNKHNKKFFGKRTYDSYNNICHEDVEILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATMRHKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVGEFDTCIGNFHHPKSVLSMEFQFLRAVTGCADGKIRIWNILNGHCIRVIRGNSRSDPILNLVVKDDTLIINTVSNILVLNFEPIDWMY 2092
            DFI  LP+H+SK I+  LD  +LN C+ V + W  +  +V+ +   +  I+ Q   LQ         +T   DP +A   ++ VP++         +++          +++   NE         +++  AYQN  T++++IEERN+FCG+Y+V I+ ++  +NR     I Y+GG L+AVS +N+ I  LD   IQ + +    RGHAGS++ + FL                   C E+  +LSGSYD SIR WD  +G C +I+ GH GTI+ +D  +    SG  D   K+W  D      T RHK PI A  I++   VS    GL+KVW+I     +K+LSGH   +  +  D WH+LS S D  VM WS VG+++ C+  F HPK VL +   FLR ++ CADGKIRI+N LNG+C++V++ N R DP+L+  ++ + +++NT SN+L+  FE I W Y
Sbjct:  276 DFIRYLPIHLSKYILRMLDRHTLNKCASVSQHWAAMAQQVKMDLSAHGFIQNQITFLQGS-------YTRGIDPNYANKVSIPVPKM---------VDDGKSMRVKHPKWKLRTKNE---------YNLWTAYQNEETQQVLIEERNVFCGTYNVRILSDTWDQNR----VIHYSGGDLIAVS-SNRKIHLLDI--IQVKAIPVEFRGHAGSVRAL-FL-------------------CEEENFLLSGSYDLSIRYWDLKSGVCTRIFGGHQGTITCMDLCKNRLVSGGRDCQVKVWDVDTGKCLKTFRHKDPILATRINDTYIVSSCERGLVKVWHIAMAQLVKTLSGHEGAVKCLFFDQWHLLSGSTDGLVMAWSMVGKYERCLMAFKHPKEVLDVSLLFLRVISACADGKIRIYNFLNGNCMKVLKANGRGDPVLSFFIQGNRMVVNTESNVLMFQFEHIKWQY 690          
BLAST of F-box/WD repeat-containing protein 10 vs. Ensembl Human
Match: FBXW10 (F-box and WD repeat domain containing 10 [Source:HGNC Symbol;Acc:HGNC:1211])

HSP 1 Score: 304.294 bits (778), Expect = 2.052e-86
Identity = 170/496 (34.27%), Postives = 259/496 (52.22%), Query Frame = 2
Query:  692 DFISNLPVHISKRIINFL-----------------------------DEKSLNVCSKVCEIWQQIVYEVRREDIVNAKIKKQAMMLQSQKDESKSVFTAPADPRFARDTNVRVPQLEPHSHRIIYINNSPPHTTNKDTYQIDNFNELELINSRKVFSMDVAYQNILTKKLIIEERNIFCGSYSVMIILESQSRNRDPLRTISYNGGLLVAVSGTNKIIQFLDKRGIQTEIMKNSIRGHAGSIKVVKFLNKHNKKFFGKRTYDSYNNICHEDVEILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATMRHKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVGEFDTCIGNFHHPKSVLSMEFQFLRAVTGCADGKIRIWNILNGHCIRVIRGNSRSDPILNLVVKDDTLIINTVSNILVLNFEPIDWMY 2092
            DFI  LP+H+SK I++ L                             D  +LN C+ V + W  +  +V+ +   +  I+ Q   LQ         +T   DP +A   ++ VP++         +++          +++   NE         +++  AYQN  T++++IEERN+FCG+Y+V I+ ++  +NR     I Y+GG L+AVS +N+ I  LD   IQ + +    RGHAGS++ + FL                   C E+  +LSGSYD SIR WD  +G C +I+ GH GTI+ +D  +    SG  D   K+W  D      T RHK PI A  I++   VS    GL+KVW+I     +K+LSGH   +  +  D WH+LS S D  VM WS VG+++ C+  F HPK VL +   FLR ++ CADGKIRI+N LNG+C++V++ N R DP+L+  ++ + +++NT SN+L+  FE I W Y
Sbjct:  276 DFIRYLPIHLSKYILSMLGCMRGFPRHLPSWPSSGVSGSIFFFPGMLDRHTLNKCASVSQHWAAMAQQVKMDLSAHGFIQNQITFLQGS-------YTRGIDPNYANKVSIPVPKM---------VDDGKSMRVKHPKWKLRTKNE---------YNLWTAYQNEETQQVLIEERNVFCGTYNVRILSDTWDQNR----VIHYSGGDLIAVS-SNRKIHLLDI--IQVKAIPVEFRGHAGSVRAL-FL-------------------CEEENFLLSGSYDLSIRYWDLKSGVCTRIFGGHQGTITCMDLCKNRLVSGGRDCQVKVWDVDTGKCLKTFRHKDPILATRINDTYIVSSCERGLVKVWHIAMAQLVKTLSGHEGAVKCLFFDQWHLLSGSTDGLVMAWSMVGKYERCLMAFKHPKEVLDVSLLFLRVISACADGKIRIYNFLNGNCMKVLKANGRGDPVLSFFIQGNRMVVNTESNVLMFQFEHIKWQY 719          
BLAST of F-box/WD repeat-containing protein 10 vs. Ensembl Human
Match: CDRT1 (CMT1A duplicated region transcript 1 [Source:HGNC Symbol;Acc:HGNC:14379])

HSP 1 Score: 294.664 bits (753), Expect = 1.074e-85
Identity = 163/465 (35.05%), Postives = 250/465 (53.76%), Query Frame = 2
Query:  692 DFISNLPVHISKRIINFLDEKSLNVCSKVCEIWQQIVYEVRREDIVNAKIKKQAMMLQSQKDESKSVFTAPADPRFARDTNVRVPQLEPHSHRIIYINNSPPHTTNKDTYQIDNFNELELINSRKVFSMDVAYQNILTKKLIIEERNIFCGSYSVMIILESQSRNRDPLRTISYNGGLLVAVSGTNKIIQFLDKRGIQTEIMKNSIRGHAGSIKVVKFLNKHNKKFFGKRTYDSYNNICHEDVEILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATMRHKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVGEFDTCIGNFHHPKSVLSMEFQFLRAVTGCADGKIRIWNILNGHCIRVIRGNSRSDPILNLVVKDDTLIINTVSNILVLNFEPIDW 2086
            DFI  LP+H+SK I+  LD  +LN C+ V + W  +  +V+ +   +  I+ Q   LQ         +T   DP +A   ++ VP++         +++          +++   NE         +++  AYQN  T+++++EERN+FCG+Y+V I+ ++  +NR     I Y+GG L+AVS +N+ I  LD   IQ + +    RGHAGS++ + FL                   C E+  +LSGSYD SIR WD  +G C +I+ GH GTI+ +D  +    SG  D   K+W  D      T RHK PI A  I++   VS    GL+KVW+I     +K+LSGH   +  +  D WH+LS S D  VM WS VG+++ C+  F HPK VL +   FLR ++ CADGKIRI+N  NG+C++VI+ N R DP+L+  ++ +       S+ L   + P++W
Sbjct:  276 DFIRYLPIHLSKYILRMLDRHTLNKCASVSQHWAAMAQQVKMDLSAHGFIQNQITFLQGS-------YTRGIDPNYANKVSIPVPKM---------VDDGKSMRVKHPKWKLRTKNE---------YNLWTAYQNEETQQVLMEERNVFCGTYNVRILSDTWDQNR----VIHYSGGDLIAVS-SNRKIHLLDI--IQVKAIPVEFRGHAGSVRAL-FL-------------------CEEENFLLSGSYDLSIRYWDLKSGVCTRIFGGHQGTITCMDLCKNRLVSGGRDCQVKVWDVDTGKCLKTFRHKDPILATRINDTYIVSSCERGLVKVWHIAMAQLVKTLSGHEGAVKCLFFDQWHLLSGSTDGLVMAWSMVGKYERCLMAFKHPKEVLDVSLLFLRVISACADGKIRIYNFFNGNCMKVIKANGRGDPVLSFFIQGN-------SDHLRKTYLPVEW 681          
BLAST of F-box/WD repeat-containing protein 10 vs. Ensembl Human
Match: CDRT1 (CMT1A duplicated region transcript 1 [Source:HGNC Symbol;Acc:HGNC:14379])

HSP 1 Score: 293.123 bits (749), Expect = 1.115e-84
Identity = 160/453 (35.32%), Postives = 246/453 (54.30%), Query Frame = 2
Query:  692 DFISNLPVHISKRIINFLDEKSLNVCSKVCEIWQQIVYEVRREDIVNAKIKKQAMMLQSQKDESKSVFTAPADPRFARDTNVRVPQLEPHSHRIIYINNSPPHTTNKDTYQIDNFNELELINSRKVFSMDVAYQNILTKKLIIEERNIFCGSYSVMIILESQSRNRDPLRTISYNGGLLVAVSGTNKIIQFLDKRGIQTEIMKNSIRGHAGSIKVVKFLNKHNKKFFGKRTYDSYNNICHEDVEILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATMRHKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVGEFDTCIGNFHHPKSVLSMEFQFLRAVTGCADGKIRIWNILNGHCIRVIRGNSRSDPILNLVVKDDTLIINTVS 2050
            DFI  LP+H+SK I+  LD  +LN C+ V + W  +  +V+ +   +  I+ Q   LQ         +T   DP +A   ++ VP++         +++          +++   NE         +++  AYQN  T+++++EERN+FCG+Y+V I+ ++  +NR     I Y+GG L+AVS +N+ I  LD   IQ + +    RGHAGS++ + FL                   C E+  +LSGSYD SIR WD  +G C +I+ GH GTI+ +D  +    SG  D   K+W  D      T RHK PI A  I++   VS    GL+KVW+I     +K+LSGH   +  +  D WH+LS S D  VM WS VG+++ C+  F HPK VL +   FLR ++ CADGKIRI+N  NG+C++VI+ N R DP+L+  ++ + + +  +S
Sbjct:  276 DFIRYLPIHLSKYILRMLDRHTLNKCASVSQHWAAMAQQVKMDLSAHGFIQNQITFLQGS-------YTRGIDPNYANKVSIPVPKM---------VDDGKSMRVKHPKWKLRTKNE---------YNLWTAYQNEETQQVLMEERNVFCGTYNVRILSDTWDQNR----VIHYSGGDLIAVS-SNRKIHLLDI--IQVKAIPVEFRGHAGSVRAL-FL-------------------CEEENFLLSGSYDLSIRYWDLKSGVCTRIFGGHQGTITCMDLCKNRLVSGGRDCQVKVWDVDTGKCLKTFRHKDPILATRINDTYIVSSCERGLVKVWHIAMAQLVKTLSGHEGAVKCLFFDQWHLLSGSTDGLVMAWSMVGKYERCLMAFKHPKEVLDVSLLFLRVISACADGKIRIYNFFNGNCMKVIKANGRGDPVLSFFIQGNRISVCHIS 676          
BLAST of F-box/WD repeat-containing protein 10 vs. Ensembl Human
Match: FBXW10 (F-box and WD repeat domain containing 10 [Source:HGNC Symbol;Acc:HGNC:1211])

HSP 1 Score: 239.58 bits (610), Expect = 1.109e-64
Identity = 141/407 (34.64%), Postives = 212/407 (52.09%), Query Frame = 2
Query:  692 DFISNLPVHISKRIINFLDEKSLNVCSKVCEIWQQIVYEVRREDIVNAKIKKQAMMLQSQKDESKSVFTAPADPRFARDTNVRVPQLEPHSHRIIYINNSPPHTTNKDTYQIDNFNELELINSRKVFSMDVAYQNILTKKLIIEERNIFCGSYSVMIILESQSRNRDPLRTISYNGGLLVAVSGTNKIIQFLDKRGIQTEIMKNSIRGHAGSIKVVKFLNKHNKKFFGKRTYDSYNNICHEDVEILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATMRHKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVGEFDTCIGNFHHPKSVLSME-----FQF 1897
            DFI  LP+H+SK I+  LD  +LN C+ V + W  +  +V+ +   +  I+ Q   LQ         +T   DP +A   ++ VP++         +++          +++   NE         +++  AYQN  T++++IEERN+FCG+Y+V I+ ++  +NR     I Y+GG L+AVS +N+ I  LD   IQ + +    RGHAGS++ + FL                   C E+  +LSGSYD SIR WD  +G C +I+ GH GTI+ +D  +    SG  D   K+W  D      T RHK PI A  I++   VS    GL+KVW+I     +K+LSGH   +  +  D WH+LS S D  VM WS VG+++ C+  F HPK V++ E     FQF
Sbjct:  276 DFIRYLPIHLSKYILRMLDRHTLNKCASVSQHWAAMAQQVKMDLSAHGFIQNQITFLQGS-------YTRGIDPNYANKVSIPVPKM---------VDDGKSMRVKHPKWKLRTKNE---------YNLWTAYQNEETQQVLIEERNVFCGTYNVRILSDTWDQNR----VIHYSGGDLIAVS-SNRKIHLLDI--IQVKAIPVEFRGHAGSVRAL-FL-------------------CEEENFLLSGSYDLSIRYWDLKSGVCTRIFGGHQGTITCMDLCKNRLVSGGRDCQVKVWDVDTGKCLKTFRHKDPILATRINDTYIVSSCERGLVKVWHIAMAQLVKTLSGHEGAVKCLFFDQWHLLSGSTDGLVMAWSMVGKYERCLMAFKHPKMVVNTESNVLMFQF 630          

HSP 2 Score: 70.8626 bits (172), Expect = 1.277e-11
Identity = 61/247 (24.70%), Postives = 110/247 (44.53%), Query Frame = 2
Query: 1382 TYDSYNNICHEDVEILSGSYDTSIRRWDTFTGKCLKI-YIGHSGTISDIDAGEE--IFASGSYDGTCKLWRYDEKNSFATM---RHKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLW--STVGEFDTCIGNFHHPKSVLSMEFQFLRAVTGCADGKIRIWNILNGH--CIRVIRGNSRSDPILNLVVKDDTLIINTVSNILVLNFEPIDWMY 2092
            T+D    I +   ++++ S +  I   D    K + + + GH+G++  +   EE     SGSYD + + W  D K+   T     H+  IT + + +   VSG     +KVW++  G  +K+   H   I A R++  +I+S+     V +W  +      T  G   H  +V  + F     ++G  DG +  W+++  +  C+              +  K   +++NT SN+L+  FE I W Y
Sbjct:  411 TWDQNRVIHYSGGDLIAVSSNRKIHLLDIIQVKAIPVEFRGHAGSVRALFLCEEENFLLSGSYDLSIRYW--DLKSGVCTRIFGGHQGTITCMDLCKNRLVSGGRDCQVKVWDVDTGKCLKTFR-HKDPILATRINDTYIVSSCERGLVKVWHIAMAQLVKTLSG---HEGAVKCLFFDQWHLLSGSTDGLVMAWSMVGKYERCL--------------MAFKHPKMVVNTESNVLMFQFEHIKWQY 637          
BLAST of F-box/WD repeat-containing protein 10 vs. Ensembl Celegans
Match: lin-23 (F-box/WD repeat-containing protein lin-23 [Source:UniProtKB/Swiss-Prot;Acc:Q09990])

HSP 1 Score: 89.7373 bits (221), Expect = 4.998e-18
Identity = 104/483 (21.53%), Postives = 181/483 (37.47%), Query Frame = 2
Query:  692 DFISNLPVHISKRIINFLDEKSLNVCSKVCEIWQQIVYEVRR-EDIVNAKIKKQAMMLQSQKDESKSVFTAPADPRFARDTNVRVPQLEPHSHRIIYINNSPPHTTNKDTYQI----DNFNELELINSRKVFSMDVAYQNILTKKLIIEERNI----FCGSYSVMIILESQSRNRDPLRTISYNGGLLVAVSGTNKIIQFLDKRGIQTEIMKNSIRGHAGSIKVVKFLNKHNKKFFGKRTYDSYNNICHEDVEILSGSYDTSIRRWDTFTGKCLK-------------------------------------------IYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATMR-HKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVGEFD-------TCIGNF-HHPKSVLSMEFQFLRAVTGCADGKIRIWNILNG 1957
            DFISNLP H+ + I+  ++  SL  C +V   W+  +   +  + ++   ++  ++     +      F        +RD +VR                       K  Y +    D  ++L L        M V Y   L  K+I +  NI      G+Y  M  +  QS N   +  + Y+   +V+    N  I+  D++      +   + GH GS+  +++ N+                       I+SGS D ++R WD  TG+C+K                                           + +GH   ++ +D  +    S S D T K+W  D      T+  H+  I  +    +L VSG S   I++W+I +GV ++ L GH + +  IR D   I+S + D  + +W      D        C+ +   H   V  ++F   + V+   D  I IW+ L+ 
Sbjct:   27 DFISNLPAHLVELILFNVNSDSLKSCEEVSTSWRCALARGQHWKKLIEKNVRSDSLWWGLSEKRQWDKFL-----NISRDMSVR-------------------RICEKFNYDVNIKRDKLDQLIL--------MHVFYSK-LYPKIIRDIHNIDNNWKRGNYK-MTRINCQSENSKGVYCLQYDDDKIVSGLRDN-TIKIWDRKDYSCSRI---LSGHTGSVLCLQYDNR----------------------VIISGSSDATVRVWDVETGECIKTLIHHCEAVLHLRFANGIMVTCSKDRSIAVWDMVSPRDITIRRVLVGHRAAVNVVDFDDRYIVSASGDRTIKVWSMDTLEFVRTLAGHRRGIACLQYRGRLVVSGSSDNTIRLWDIHSGVCLRVLEGHEELVRCIRFDEKRIVSGAYDGKIKVWDLQAALDPRALSSEICLCSLVQHTGRVFRLQFDDFQIVSSSHDDTILIWDFLDA 449          

HSP 2 Score: 85.1149 bits (209), Expect = 1.198e-16
Identity = 53/198 (26.77%), Postives = 100/198 (50.51%), Query Frame = 2
Query: 1409 HEDVEILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATM-RHKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYI---KSLSGHFKEISAIRLDSWHILSASLDNFVMLWS--TVGEFDTCIGNFHHPKSVLSMEFQFLRAVTGCADGKIRIWNILNGHCIRVIRGN 1984
            ++D +I+SG  D +I+ WD     C +I  GH+G++  +     +  SGS D T ++W  +      T+  H   +  +  +  + V+      I VW++ +   I   + L GH   ++ +  D  +I+SAS D  + +WS  T+    T  G   H + +  ++++    V+G +D  IR+W+I +G C+RV+ G+
Sbjct:  175 YDDDKIVSGLRDNTIKIWDRKDYSCSRILSGHTGSVLCLQYDNRVIISGSSDATVRVWDVETGECIKTLIHHCEAVLHLRFANGIMVTCSKDRSIAVWDMVSPRDITIRRVLVGHRAAVNVVDFDDRYIVSASGDRTIKVWSMDTLEFVRTLAG---HRRGIACLQYRGRLVVSGSSDNTIRLWDIHSGVCLRVLEGH 369          
BLAST of F-box/WD repeat-containing protein 10 vs. Ensembl Celegans
Match: lin-23 (F-box/WD repeat-containing protein lin-23 [Source:UniProtKB/Swiss-Prot;Acc:Q09990])

HSP 1 Score: 89.7373 bits (221), Expect = 5.374e-18
Identity = 104/483 (21.53%), Postives = 181/483 (37.47%), Query Frame = 2
Query:  692 DFISNLPVHISKRIINFLDEKSLNVCSKVCEIWQQIVYEVRR-EDIVNAKIKKQAMMLQSQKDESKSVFTAPADPRFARDTNVRVPQLEPHSHRIIYINNSPPHTTNKDTYQI----DNFNELELINSRKVFSMDVAYQNILTKKLIIEERNI----FCGSYSVMIILESQSRNRDPLRTISYNGGLLVAVSGTNKIIQFLDKRGIQTEIMKNSIRGHAGSIKVVKFLNKHNKKFFGKRTYDSYNNICHEDVEILSGSYDTSIRRWDTFTGKCLK-------------------------------------------IYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATMR-HKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVGEFD-------TCIGNF-HHPKSVLSMEFQFLRAVTGCADGKIRIWNILNG 1957
            DFISNLP H+ + I+  ++  SL  C +V   W+  +   +  + ++   ++  ++     +      F        +RD +VR                       K  Y +    D  ++L L        M V Y   L  K+I +  NI      G+Y  M  +  QS N   +  + Y+   +V+    N  I+  D++      +   + GH GS+  +++ N+                       I+SGS D ++R WD  TG+C+K                                           + +GH   ++ +D  +    S S D T K+W  D      T+  H+  I  +    +L VSG S   I++W+I +GV ++ L GH + +  IR D   I+S + D  + +W      D        C+ +   H   V  ++F   + V+   D  I IW+ L+ 
Sbjct:   27 DFISNLPAHLVELILFNVNSDSLKSCEEVSTSWRCALARGQHWKKLIEKNVRSDSLWWGLSEKRQWDKFL-----NISRDMSVR-------------------RICEKFNYDVNIKRDKLDQLIL--------MHVFYSK-LYPKIIRDIHNIDNNWKRGNYK-MTRINCQSENSKGVYCLQYDDDKIVSGLRDN-TIKIWDRKDYSCSRI---LSGHTGSVLCLQYDNR----------------------VIISGSSDATVRVWDVETGECIKTLIHHCEAVLHLRFANGIMVTCSKDRSIAVWDMVSPRDITIRRVLVGHRAAVNVVDFDDRYIVSASGDRTIKVWSMDTLEFVRTLAGHRRGIACLQYRGRLVVSGSSDNTIRLWDIHSGVCLRVLEGHEELVRCIRFDEKRIVSGAYDGKIKVWDLQAALDPRALSSEICLCSLVQHTGRVFRLQFDDFQIVSSSHDDTILIWDFLDA 449          

HSP 2 Score: 85.1149 bits (209), Expect = 1.203e-16
Identity = 53/198 (26.77%), Postives = 100/198 (50.51%), Query Frame = 2
Query: 1409 HEDVEILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATM-RHKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYI---KSLSGHFKEISAIRLDSWHILSASLDNFVMLWS--TVGEFDTCIGNFHHPKSVLSMEFQFLRAVTGCADGKIRIWNILNGHCIRVIRGN 1984
            ++D +I+SG  D +I+ WD     C +I  GH+G++  +     +  SGS D T ++W  +      T+  H   +  +  +  + V+      I VW++ +   I   + L GH   ++ +  D  +I+SAS D  + +WS  T+    T  G   H + +  ++++    V+G +D  IR+W+I +G C+RV+ G+
Sbjct:  175 YDDDKIVSGLRDNTIKIWDRKDYSCSRILSGHTGSVLCLQYDNRVIISGSSDATVRVWDVETGECIKTLIHHCEAVLHLRFANGIMVTCSKDRSIAVWDMVSPRDITIRRVLVGHRAAVNVVDFDDRYIVSASGDRTIKVWSMDTLEFVRTLAG---HRRGIACLQYRGRLVVSGSSDNTIRLWDIHSGVCLRVLEGH 369          
BLAST of F-box/WD repeat-containing protein 10 vs. Ensembl Celegans
Match: lin-23 (F-box/WD repeat-containing protein lin-23 [Source:UniProtKB/Swiss-Prot;Acc:Q09990])

HSP 1 Score: 89.3521 bits (220), Expect = 7.224e-18
Identity = 99/483 (20.50%), Postives = 180/483 (37.27%), Query Frame = 2
Query:  692 DFISNLPVHISKRIINFLDEKSLNVCSKVCEIWQQIVYEVRR-EDIVNAKIKKQAMMLQ-SQKDESKSVFTAPAD-------PRFARDTNVRVPQLEPHSHRIIYINNSPPHTTNKDTYQIDNFNELELINSRKVFSMDVAYQNILTKKLIIEERNIFCGSYSVMIILESQSRNRDPLRTISYNGGLLVAVSGTNKIIQFLDKRGIQTEIMKNSIRGHAGSIKVVKFLNKHNKKFFGKRTYDSYNNICHEDVEILSGSYDTSIRRWDTFTGKCLK-------------------------------------------IYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATMR-HKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVGEFD-------TCIGNF-HHPKSVLSMEFQFLRAVTGCADGKIRIWNILNG 1957
            DFISNLP H+ + I+  ++  SL  C +V   W+  +   +  + ++   ++  ++    S+K +         D        +F  D N++  +L+      ++ +   P    +D + IDN                                N   G+Y  M  +  QS N   +  + Y+   +V+    N  I+  D++      +   + GH GS+  +++ N+                       I+SGS D ++R WD  TG+C+K                                           + +GH   ++ +D  +    S S D T K+W  D      T+  H+  I  +    +L VSG S   I++W+I +GV ++ L GH + +  IR D   I+S + D  + +W      D        C+ +   H   V  ++F   + V+   D  I IW+ L+ 
Sbjct:   82 DFISNLPAHLVELILFNVNSDSLKSCEEVSTSWRCALARGQHWKKLIEKNVRSDSLWWGLSEKRQWDKFLNISRDMSVRRICEKFNYDVNIKRDKLDQLILMHVFYSKLYPKII-RDIHNIDN--------------------------------NWKRGNYK-MTRINCQSENSKGVYCLQYDDDKIVSGLRDN-TIKIWDRKDYSCSRI---LSGHTGSVLCLQYDNR----------------------VIISGSSDATVRVWDVETGECIKTLIHHCEAVLHLRFANGIMVTCSKDRSIAVWDMVSPRDITIRRVLVGHRAAVNVVDFDDRYIVSASGDRTIKVWSMDTLEFVRTLAGHRRGIACLQYRGRLVVSGSSDNTIRLWDIHSGVCLRVLEGHEELVRCIRFDEKRIVSGAYDGKIKVWDLQAALDPRALSSEICLCSLVQHTGRVFRLQFDDFQIVSSSHDDTILIWDFLDA 504          

HSP 2 Score: 85.1149 bits (209), Expect = 1.460e-16
Identity = 53/198 (26.77%), Postives = 100/198 (50.51%), Query Frame = 2
Query: 1409 HEDVEILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATM-RHKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYI---KSLSGHFKEISAIRLDSWHILSASLDNFVMLWS--TVGEFDTCIGNFHHPKSVLSMEFQFLRAVTGCADGKIRIWNILNGHCIRVIRGN 1984
            ++D +I+SG  D +I+ WD     C +I  GH+G++  +     +  SGS D T ++W  +      T+  H   +  +  +  + V+      I VW++ +   I   + L GH   ++ +  D  +I+SAS D  + +WS  T+    T  G   H + +  ++++    V+G +D  IR+W+I +G C+RV+ G+
Sbjct:  230 YDDDKIVSGLRDNTIKIWDRKDYSCSRILSGHTGSVLCLQYDNRVIISGSSDATVRVWDVETGECIKTLIHHCEAVLHLRFANGIMVTCSKDRSIAVWDMVSPRDITIRRVLVGHRAAVNVVDFDDRYIVSASGDRTIKVWSMDTLEFVRTLAG---HRRGIACLQYRGRLVVSGSSDNTIRLWDIHSGVCLRVLEGH 424          
BLAST of F-box/WD repeat-containing protein 10 vs. Ensembl Celegans
Match: lin-23 (F-box/WD repeat-containing protein lin-23 [Source:UniProtKB/Swiss-Prot;Acc:Q09990])

HSP 1 Score: 89.3521 bits (220), Expect = 7.224e-18
Identity = 99/483 (20.50%), Postives = 180/483 (37.27%), Query Frame = 2
Query:  692 DFISNLPVHISKRIINFLDEKSLNVCSKVCEIWQQIVYEVRR-EDIVNAKIKKQAMMLQ-SQKDESKSVFTAPAD-------PRFARDTNVRVPQLEPHSHRIIYINNSPPHTTNKDTYQIDNFNELELINSRKVFSMDVAYQNILTKKLIIEERNIFCGSYSVMIILESQSRNRDPLRTISYNGGLLVAVSGTNKIIQFLDKRGIQTEIMKNSIRGHAGSIKVVKFLNKHNKKFFGKRTYDSYNNICHEDVEILSGSYDTSIRRWDTFTGKCLK-------------------------------------------IYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATMR-HKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVGEFD-------TCIGNF-HHPKSVLSMEFQFLRAVTGCADGKIRIWNILNG 1957
            DFISNLP H+ + I+  ++  SL  C +V   W+  +   +  + ++   ++  ++    S+K +         D        +F  D N++  +L+      ++ +   P    +D + IDN                                N   G+Y  M  +  QS N   +  + Y+   +V+    N  I+  D++      +   + GH GS+  +++ N+                       I+SGS D ++R WD  TG+C+K                                           + +GH   ++ +D  +    S S D T K+W  D      T+  H+  I  +    +L VSG S   I++W+I +GV ++ L GH + +  IR D   I+S + D  + +W      D        C+ +   H   V  ++F   + V+   D  I IW+ L+ 
Sbjct:   82 DFISNLPAHLVELILFNVNSDSLKSCEEVSTSWRCALARGQHWKKLIEKNVRSDSLWWGLSEKRQWDKFLNISRDMSVRRICEKFNYDVNIKRDKLDQLILMHVFYSKLYPKII-RDIHNIDN--------------------------------NWKRGNYK-MTRINCQSENSKGVYCLQYDDDKIVSGLRDN-TIKIWDRKDYSCSRI---LSGHTGSVLCLQYDNR----------------------VIISGSSDATVRVWDVETGECIKTLIHHCEAVLHLRFANGIMVTCSKDRSIAVWDMVSPRDITIRRVLVGHRAAVNVVDFDDRYIVSASGDRTIKVWSMDTLEFVRTLAGHRRGIACLQYRGRLVVSGSSDNTIRLWDIHSGVCLRVLEGHEELVRCIRFDEKRIVSGAYDGKIKVWDLQAALDPRALSSEICLCSLVQHTGRVFRLQFDDFQIVSSSHDDTILIWDFLDA 504          

HSP 2 Score: 85.1149 bits (209), Expect = 1.460e-16
Identity = 53/198 (26.77%), Postives = 100/198 (50.51%), Query Frame = 2
Query: 1409 HEDVEILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATM-RHKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYI---KSLSGHFKEISAIRLDSWHILSASLDNFVMLWS--TVGEFDTCIGNFHHPKSVLSMEFQFLRAVTGCADGKIRIWNILNGHCIRVIRGN 1984
            ++D +I+SG  D +I+ WD     C +I  GH+G++  +     +  SGS D T ++W  +      T+  H   +  +  +  + V+      I VW++ +   I   + L GH   ++ +  D  +I+SAS D  + +WS  T+    T  G   H + +  ++++    V+G +D  IR+W+I +G C+RV+ G+
Sbjct:  230 YDDDKIVSGLRDNTIKIWDRKDYSCSRILSGHTGSVLCLQYDNRVIISGSSDATVRVWDVETGECIKTLIHHCEAVLHLRFANGIMVTCSKDRSIAVWDMVSPRDITIRRVLVGHRAAVNVVDFDDRYIVSASGDRTIKVWSMDTLEFVRTLAG---HRRGIACLQYRGRLVVSGSSDNTIRLWDIHSGVCLRVLEGH 424          
BLAST of F-box/WD repeat-containing protein 10 vs. Ensembl Celegans
Match: lin-23 (F-box/WD repeat-containing protein lin-23 [Source:UniProtKB/Swiss-Prot;Acc:Q09990])

HSP 1 Score: 89.3521 bits (220), Expect = 7.447e-18
Identity = 104/483 (21.53%), Postives = 181/483 (37.47%), Query Frame = 2
Query:  692 DFISNLPVHISKRIINFLDEKSLNVCSKVCEIWQQIVYEVRR-EDIVNAKIKKQAMMLQSQKDESKSVFTAPADPRFARDTNVRVPQLEPHSHRIIYINNSPPHTTNKDTYQI----DNFNELELINSRKVFSMDVAYQNILTKKLIIEERNI----FCGSYSVMIILESQSRNRDPLRTISYNGGLLVAVSGTNKIIQFLDKRGIQTEIMKNSIRGHAGSIKVVKFLNKHNKKFFGKRTYDSYNNICHEDVEILSGSYDTSIRRWDTFTGKCLK-------------------------------------------IYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATMR-HKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVGEFD-------TCIGNF-HHPKSVLSMEFQFLRAVTGCADGKIRIWNILNG 1957
            DFISNLP H+ + I+  ++  SL  C +V   W+  +   +  + ++   ++  ++     +      F        +RD +VR                       K  Y +    D  ++L L        M V Y   L  K+I +  NI      G+Y  M  +  QS N   +  + Y+   +V+    N  I+  D++      +   + GH GS+  +++ N+                       I+SGS D ++R WD  TG+C+K                                           + +GH   ++ +D  +    S S D T K+W  D      T+  H+  I  +    +L VSG S   I++W+I +GV ++ L GH + +  IR D   I+S + D  + +W      D        C+ +   H   V  ++F   + V+   D  I IW+ L+ 
Sbjct:   82 DFISNLPAHLVELILFNVNSDSLKSCEEVSTSWRCALARGQHWKKLIEKNVRSDSLWWGLSEKRQWDKFL-----NISRDMSVR-------------------RICEKFNYDVNIKRDKLDQLIL--------MHVFYSK-LYPKIIRDIHNIDNNWKRGNYK-MTRINCQSENSKGVYCLQYDDDKIVSGLRDN-TIKIWDRKDYSCSRI---LSGHTGSVLCLQYDNR----------------------VIISGSSDATVRVWDVETGECIKTLIHHCEAVLHLRFANGIMVTCSKDRSIAVWDMVSPRDITIRRVLVGHRAAVNVVDFDDRYIVSASGDRTIKVWSMDTLEFVRTLAGHRRGIACLQYRGRLVVSGSSDNTIRLWDIHSGVCLRVLEGHEELVRCIRFDEKRIVSGAYDGKIKVWDLQAALDPRALSSEICLCSLVQHTGRVFRLQFDDFQIVSSSHDDTILIWDFLDA 504          

HSP 2 Score: 85.1149 bits (209), Expect = 1.586e-16
Identity = 53/198 (26.77%), Postives = 100/198 (50.51%), Query Frame = 2
Query: 1409 HEDVEILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATM-RHKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYI---KSLSGHFKEISAIRLDSWHILSASLDNFVMLWS--TVGEFDTCIGNFHHPKSVLSMEFQFLRAVTGCADGKIRIWNILNGHCIRVIRGN 1984
            ++D +I+SG  D +I+ WD     C +I  GH+G++  +     +  SGS D T ++W  +      T+  H   +  +  +  + V+      I VW++ +   I   + L GH   ++ +  D  +I+SAS D  + +WS  T+    T  G   H + +  ++++    V+G +D  IR+W+I +G C+RV+ G+
Sbjct:  230 YDDDKIVSGLRDNTIKIWDRKDYSCSRILSGHTGSVLCLQYDNRVIISGSSDATVRVWDVETGECIKTLIHHCEAVLHLRFANGIMVTCSKDRSIAVWDMVSPRDITIRRVLVGHRAAVNVVDFDDRYIVSASGDRTIKVWSMDTLEFVRTLAG---HRRGIACLQYRGRLVVSGSSDNTIRLWDIHSGVCLRVLEGH 424          
BLAST of F-box/WD repeat-containing protein 10 vs. Ensembl Fly
Match: ago (gene:FBgn0041171 transcript:FBtr0073246)

HSP 1 Score: 103.219 bits (256), Expect = 8.227e-22
Identity = 56/189 (29.63%), Postives = 91/189 (48.15%), Query Frame = 2
Query: 1424 ILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATMR-HKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVGEFDTCIGNFH-HPKSVLSMEFQFLRAVTGCADGKIRIWNILNGHCIRVIRGN 1984
            I+SGS D +++ W    GKCL+  +GH+G +        I  SGS D T K+W  D      T++ H   +  + +     VSG     ++VW+I+ G  +  L GH   +  ++ D   I+S + D  V +W    E   C+     H   V S++F  L  V+G  D  IR+W++  G+C   + G+
Sbjct: 1008 IVSGSDDNTLKVWSAVNGKCLRTLVGHTGGVWSSQMSGNIIISGSTDRTLKVWDMDSGACVHTLQGHTSTVRCMHLHGSKVVSGSRDATLRVWDIEQGSCLHVLVGHLAAVRCVQYDGKLIVSGAYDYMVKIWHP--ERQECLHTLQGHTNRVYSLQFDGLHVVSGSLDTSIRVWDVETGNCKHTLMGH 1194          

HSP 2 Score: 89.3521 bits (220), Expect = 1.443e-17
Identity = 75/309 (24.27%), Postives = 136/309 (44.01%), Query Frame = 2
Query: 1196 LRT-ISYNGGLLVAVSGTNKIIQFLDKRGIQTEIMKNSIRGHA--GSIKVVKFLNKHNKKFFGKRTYDSYNNICHEDVEILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATMR-HKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWS-TVGE-FDTCIGNFHHPKSVLSMEFQFLRAVTGCADGKIRIWNILNGHCIR--VIRGNSRSDPILNLVVKDDTLIINTV--------SNILVLNFE 2074
            LRT + + GG+  +    N II     R ++   M +    H   G    V+ ++ H  K                   ++SGS D ++R WD   G CL + +GH   +  +    ++  SG+YD   K+W  + +    T++ H + + ++       VSG     I+VW+++ G    +L GH    S + L    ++S + D+ V +W  T G+   T  G   H  +V  ++F     VT   DG +++W++  G  IR  V   +  S  ++  +  +DT +I  V        + ++VL+F+
Sbjct: 1028 LRTLVGHTGGVWSSQMSGNIIISGSTDRTLKVWDMDSGACVHTLQGHTSTVRCMHLHGSK-------------------VVSGSRDATLRVWDIEQGSCLHVLVGHLAAVRCVQYDGKLIVSGAYDYMVKIWHPERQECLHTLQGHTNRVYSLQFDGLHVVSGSLDTSIRVWDVETGNCKHTLMGHQSLTSGMELRQNILVSGNADSTVKVWDITTGQCLQTLSGPNKHHSAVTCLQFNSRFVVTSSDDGTVKLWDVKTGDFIRNLVALDSGGSGGVVWRIRANDTKLICAVGSRNGTEETKLMVLDFD 1317          

HSP 3 Score: 62.7734 bits (151), Expect = 2.155e-9
Identity = 40/152 (26.32%), Postives = 71/152 (46.71%), Query Frame = 2
Query: 1625 HPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVGEFDTCIGNFH-HPKSVLSMEFQFLRAVTGCADGKIRIWNILNGHCIRVIRGNSRSDPILNLVVKDDTLIINTVSNILVLNFEP 2077
            H IT +  S    VSG     +KVW+  NG  +++L GH   + + ++    I+S S D  + +W    +   C+     H  +V  M     + V+G  D  +R+W+I  G C+ V+ G+  +   +  V  D  LI++   + +V  + P
Sbjct:  996 HVITCLQFSGNRIVSGSDDNTLKVWSAVNGKCLRTLVGHTGGVWSSQMSGNIIISGSTDRTLKVWDM--DSGACVHTLQGHTSTVRCMHLHGSKVVSGSRDATLRVWDIEQGSCLHVLVGHLAA---VRCVQYDGKLIVSGAYDYMVKIWHP 1142          
BLAST of F-box/WD repeat-containing protein 10 vs. Ensembl Fly
Match: ago (gene:FBgn0041171 transcript:FBtr0073245)

HSP 1 Score: 103.219 bits (256), Expect = 8.227e-22
Identity = 56/189 (29.63%), Postives = 91/189 (48.15%), Query Frame = 2
Query: 1424 ILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATMR-HKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVGEFDTCIGNFH-HPKSVLSMEFQFLRAVTGCADGKIRIWNILNGHCIRVIRGN 1984
            I+SGS D +++ W    GKCL+  +GH+G +        I  SGS D T K+W  D      T++ H   +  + +     VSG     ++VW+I+ G  +  L GH   +  ++ D   I+S + D  V +W    E   C+     H   V S++F  L  V+G  D  IR+W++  G+C   + G+
Sbjct: 1008 IVSGSDDNTLKVWSAVNGKCLRTLVGHTGGVWSSQMSGNIIISGSTDRTLKVWDMDSGACVHTLQGHTSTVRCMHLHGSKVVSGSRDATLRVWDIEQGSCLHVLVGHLAAVRCVQYDGKLIVSGAYDYMVKIWHP--ERQECLHTLQGHTNRVYSLQFDGLHVVSGSLDTSIRVWDVETGNCKHTLMGH 1194          

HSP 2 Score: 89.3521 bits (220), Expect = 1.443e-17
Identity = 75/309 (24.27%), Postives = 136/309 (44.01%), Query Frame = 2
Query: 1196 LRT-ISYNGGLLVAVSGTNKIIQFLDKRGIQTEIMKNSIRGHA--GSIKVVKFLNKHNKKFFGKRTYDSYNNICHEDVEILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATMR-HKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWS-TVGE-FDTCIGNFHHPKSVLSMEFQFLRAVTGCADGKIRIWNILNGHCIR--VIRGNSRSDPILNLVVKDDTLIINTV--------SNILVLNFE 2074
            LRT + + GG+  +    N II     R ++   M +    H   G    V+ ++ H  K                   ++SGS D ++R WD   G CL + +GH   +  +    ++  SG+YD   K+W  + +    T++ H + + ++       VSG     I+VW+++ G    +L GH    S + L    ++S + D+ V +W  T G+   T  G   H  +V  ++F     VT   DG +++W++  G  IR  V   +  S  ++  +  +DT +I  V        + ++VL+F+
Sbjct: 1028 LRTLVGHTGGVWSSQMSGNIIISGSTDRTLKVWDMDSGACVHTLQGHTSTVRCMHLHGSK-------------------VVSGSRDATLRVWDIEQGSCLHVLVGHLAAVRCVQYDGKLIVSGAYDYMVKIWHPERQECLHTLQGHTNRVYSLQFDGLHVVSGSLDTSIRVWDVETGNCKHTLMGHQSLTSGMELRQNILVSGNADSTVKVWDITTGQCLQTLSGPNKHHSAVTCLQFNSRFVVTSSDDGTVKLWDVKTGDFIRNLVALDSGGSGGVVWRIRANDTKLICAVGSRNGTEETKLMVLDFD 1317          

HSP 3 Score: 62.7734 bits (151), Expect = 2.155e-9
Identity = 40/152 (26.32%), Postives = 71/152 (46.71%), Query Frame = 2
Query: 1625 HPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVGEFDTCIGNFH-HPKSVLSMEFQFLRAVTGCADGKIRIWNILNGHCIRVIRGNSRSDPILNLVVKDDTLIINTVSNILVLNFEP 2077
            H IT +  S    VSG     +KVW+  NG  +++L GH   + + ++    I+S S D  + +W    +   C+     H  +V  M     + V+G  D  +R+W+I  G C+ V+ G+  +   +  V  D  LI++   + +V  + P
Sbjct:  996 HVITCLQFSGNRIVSGSDDNTLKVWSAVNGKCLRTLVGHTGGVWSSQMSGNIIISGSTDRTLKVWDM--DSGACVHTLQGHTSTVRCMHLHGSKVVSGSRDATLRVWDIEQGSCLHVLVGHLAA---VRCVQYDGKLIVSGAYDYMVKIWHP 1142          
BLAST of F-box/WD repeat-containing protein 10 vs. Ensembl Fly
Match: ago (gene:FBgn0041171 transcript:FBtr0073247)

HSP 1 Score: 103.219 bits (256), Expect = 8.227e-22
Identity = 56/189 (29.63%), Postives = 91/189 (48.15%), Query Frame = 2
Query: 1424 ILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATMR-HKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVGEFDTCIGNFH-HPKSVLSMEFQFLRAVTGCADGKIRIWNILNGHCIRVIRGN 1984
            I+SGS D +++ W    GKCL+  +GH+G +        I  SGS D T K+W  D      T++ H   +  + +     VSG     ++VW+I+ G  +  L GH   +  ++ D   I+S + D  V +W    E   C+     H   V S++F  L  V+G  D  IR+W++  G+C   + G+
Sbjct: 1008 IVSGSDDNTLKVWSAVNGKCLRTLVGHTGGVWSSQMSGNIIISGSTDRTLKVWDMDSGACVHTLQGHTSTVRCMHLHGSKVVSGSRDATLRVWDIEQGSCLHVLVGHLAAVRCVQYDGKLIVSGAYDYMVKIWHP--ERQECLHTLQGHTNRVYSLQFDGLHVVSGSLDTSIRVWDVETGNCKHTLMGH 1194          

HSP 2 Score: 89.3521 bits (220), Expect = 1.443e-17
Identity = 75/309 (24.27%), Postives = 136/309 (44.01%), Query Frame = 2
Query: 1196 LRT-ISYNGGLLVAVSGTNKIIQFLDKRGIQTEIMKNSIRGHA--GSIKVVKFLNKHNKKFFGKRTYDSYNNICHEDVEILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATMR-HKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWS-TVGE-FDTCIGNFHHPKSVLSMEFQFLRAVTGCADGKIRIWNILNGHCIR--VIRGNSRSDPILNLVVKDDTLIINTV--------SNILVLNFE 2074
            LRT + + GG+  +    N II     R ++   M +    H   G    V+ ++ H  K                   ++SGS D ++R WD   G CL + +GH   +  +    ++  SG+YD   K+W  + +    T++ H + + ++       VSG     I+VW+++ G    +L GH    S + L    ++S + D+ V +W  T G+   T  G   H  +V  ++F     VT   DG +++W++  G  IR  V   +  S  ++  +  +DT +I  V        + ++VL+F+
Sbjct: 1028 LRTLVGHTGGVWSSQMSGNIIISGSTDRTLKVWDMDSGACVHTLQGHTSTVRCMHLHGSK-------------------VVSGSRDATLRVWDIEQGSCLHVLVGHLAAVRCVQYDGKLIVSGAYDYMVKIWHPERQECLHTLQGHTNRVYSLQFDGLHVVSGSLDTSIRVWDVETGNCKHTLMGHQSLTSGMELRQNILVSGNADSTVKVWDITTGQCLQTLSGPNKHHSAVTCLQFNSRFVVTSSDDGTVKLWDVKTGDFIRNLVALDSGGSGGVVWRIRANDTKLICAVGSRNGTEETKLMVLDFD 1317          

HSP 3 Score: 62.7734 bits (151), Expect = 2.155e-9
Identity = 40/152 (26.32%), Postives = 71/152 (46.71%), Query Frame = 2
Query: 1625 HPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVGEFDTCIGNFH-HPKSVLSMEFQFLRAVTGCADGKIRIWNILNGHCIRVIRGNSRSDPILNLVVKDDTLIINTVSNILVLNFEP 2077
            H IT +  S    VSG     +KVW+  NG  +++L GH   + + ++    I+S S D  + +W    +   C+     H  +V  M     + V+G  D  +R+W+I  G C+ V+ G+  +   +  V  D  LI++   + +V  + P
Sbjct:  996 HVITCLQFSGNRIVSGSDDNTLKVWSAVNGKCLRTLVGHTGGVWSSQMSGNIIISGSTDRTLKVWDM--DSGACVHTLQGHTSTVRCMHLHGSKVVSGSRDATLRVWDIEQGSCLHVLVGHLAA---VRCVQYDGKLIVSGAYDYMVKIWHP 1142          
BLAST of F-box/WD repeat-containing protein 10 vs. Ensembl Fly
Match: slmb (gene:FBgn0283468 transcript:FBtr0084032)

HSP 1 Score: 95.1301 bits (235), Expect = 7.285e-20
Identity = 106/459 (23.09%), Postives = 193/459 (42.05%), Query Frame = 2
Query:  692 DFISNLPV----HISKRIINFLDEKSLNVCSKVCEIWQQIVYE-VRREDIVNAKIKKQAMM--LQSQKDESKSVFTAPADPRFARDTNVRVPQLEPHS-HRIIYINNSPPHTTNKDTYQIDNFNELELINSRKVFSMDVAYQNILTKKLIIEERNIFCGSYSVMIILESQSRNRDPLRTISYNGGLLVAVSGTNKIIQFLDKRGIQTEIMKNSIRGHAGSIKVVKFLNK--------HNKKFFGKRTYDSYNNICHEDVEIL----------SGSYDTSIRRWDTFTGKCL---KIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATMR-HKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVGEFD-------TCIGNF-HHPKSVLSMEFQFLRAVTGCADGKIRIWNILN 1954
            DFI+ LP+    HI++ I+++LD +SL     VC+ W +++ E +  + ++  K++  ++   L  +++  + +F     PR  +          PHS HR ++     P   N D   I+N                    N  T + ++  R I C           +S N   +  + Y+ G +V+    N I +  D+  +Q      ++ GH GS+  +++ +K           + +   T +  N + H    +L          + S D SI  WD  +   +   ++ +GH   ++ +D  E+   S S D T K+W         T+  HK  I  +   ++L VSG S   I++W+I+ G  ++ L GH + +  IR D+  I+S + D  + +W  V   D        C+     H   V  ++F   + V+   D  I IW+ LN
Sbjct:   87 DFITLLPIKGLDHIAENILSYLDAESLKSSELVCKEWLRVISEGMLWKKLIERKVRTDSLWRGLAERRNWMQYLFK----PRPGQTQ-------RPHSFHRELF-----PKIMN-DIDSIEN--------------------NWRTGRHML--RRINC-----------RSENSKGVYCLQYDDGKIVSGLRDNTI-KIWDRTDLQC---VKTLMGHTGSVLCLQYDDKVIISGSSDSTVRVWDVNTGEMVNTLIHHCEAVLHLRFNNGMMVTCSKDRSIAVWDMTSPSEITLRRVLVGHRAAVNVVDFDEKYIVSASGDRTIKVWSTSSCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNSIRLWDIECGACLRVLEGHEELVRCIRFDTKRIVSGAYDGKIKVWDLVAALDPRAASNTLCLNTLVEHTGRVFRLQFDEFQIVSSSHDDTILIWDFLN 491          

HSP 2 Score: 88.9669 bits (219), Expect = 7.649e-18
Identity = 57/219 (26.03%), Postives = 111/219 (50.68%), Query Frame = 2
Query: 1349 NKHNKKFFGKRTYDSYNNIC--HEDVEILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATM-RHKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYI---KSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVG-EFDTCIGNFHHPKSVLSMEFQFLRAVTGCADGKIRIWNILNGHCIRVIRGN 1984
             +H  +    R+ +S    C  ++D +I+SG  D +I+ WD    +C+K  +GH+G++  +   +++  SGS D T ++W  +      T+  H   +  +  +  + V+      I VW++ +   I   + L GH   ++ +  D  +I+SAS D  + +WST   EF   +    H + +  ++++    V+G +D  IR+W+I  G C+RV+ G+
Sbjct:  196 GRHMLRRINCRSENSKGVYCLQYDDGKIVSGLRDNTIKIWDRTDLQCVKTLMGHTGSVLCLQYDDKVIISGSSDSTVRVWDVNTGEMVNTLIHHCEAVLHLRFNNGMMVTCSKDRSIAVWDMTSPSEITLRRVLVGHRAAVNVVDFDEKYIVSASGDRTIKVWSTSSCEFVRTLNG--HKRGIACLQYRDRLVVSGSSDNSIRLWDIECGACLRVLEGH 412          
BLAST of F-box/WD repeat-containing protein 10 vs. Ensembl Fly
Match: slmb (gene:FBgn0283468 transcript:FBtr0333931)

HSP 1 Score: 95.1301 bits (235), Expect = 7.285e-20
Identity = 106/459 (23.09%), Postives = 193/459 (42.05%), Query Frame = 2
Query:  692 DFISNLPV----HISKRIINFLDEKSLNVCSKVCEIWQQIVYE-VRREDIVNAKIKKQAMM--LQSQKDESKSVFTAPADPRFARDTNVRVPQLEPHS-HRIIYINNSPPHTTNKDTYQIDNFNELELINSRKVFSMDVAYQNILTKKLIIEERNIFCGSYSVMIILESQSRNRDPLRTISYNGGLLVAVSGTNKIIQFLDKRGIQTEIMKNSIRGHAGSIKVVKFLNK--------HNKKFFGKRTYDSYNNICHEDVEIL----------SGSYDTSIRRWDTFTGKCL---KIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATMR-HKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVGEFD-------TCIGNF-HHPKSVLSMEFQFLRAVTGCADGKIRIWNILN 1954
            DFI+ LP+    HI++ I+++LD +SL     VC+ W +++ E +  + ++  K++  ++   L  +++  + +F     PR  +          PHS HR ++     P   N D   I+N                    N  T + ++  R I C           +S N   +  + Y+ G +V+    N I +  D+  +Q      ++ GH GS+  +++ +K           + +   T +  N + H    +L          + S D SI  WD  +   +   ++ +GH   ++ +D  E+   S S D T K+W         T+  HK  I  +   ++L VSG S   I++W+I+ G  ++ L GH + +  IR D+  I+S + D  + +W  V   D        C+     H   V  ++F   + V+   D  I IW+ LN
Sbjct:   87 DFITLLPIKGLDHIAENILSYLDAESLKSSELVCKEWLRVISEGMLWKKLIERKVRTDSLWRGLAERRNWMQYLFK----PRPGQTQ-------RPHSFHRELF-----PKIMN-DIDSIEN--------------------NWRTGRHML--RRINC-----------RSENSKGVYCLQYDDGKIVSGLRDNTI-KIWDRTDLQC---VKTLMGHTGSVLCLQYDDKVIISGSSDSTVRVWDVNTGEMVNTLIHHCEAVLHLRFNNGMMVTCSKDRSIAVWDMTSPSEITLRRVLVGHRAAVNVVDFDEKYIVSASGDRTIKVWSTSSCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNSIRLWDIECGACLRVLEGHEELVRCIRFDTKRIVSGAYDGKIKVWDLVAALDPRAASNTLCLNTLVEHTGRVFRLQFDEFQIVSSSHDDTILIWDFLN 491          

HSP 2 Score: 88.9669 bits (219), Expect = 7.649e-18
Identity = 57/219 (26.03%), Postives = 111/219 (50.68%), Query Frame = 2
Query: 1349 NKHNKKFFGKRTYDSYNNIC--HEDVEILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATM-RHKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYI---KSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVG-EFDTCIGNFHHPKSVLSMEFQFLRAVTGCADGKIRIWNILNGHCIRVIRGN 1984
             +H  +    R+ +S    C  ++D +I+SG  D +I+ WD    +C+K  +GH+G++  +   +++  SGS D T ++W  +      T+  H   +  +  +  + V+      I VW++ +   I   + L GH   ++ +  D  +I+SAS D  + +WST   EF   +    H + +  ++++    V+G +D  IR+W+I  G C+RV+ G+
Sbjct:  196 GRHMLRRINCRSENSKGVYCLQYDDGKIVSGLRDNTIKIWDRTDLQCVKTLMGHTGSVLCLQYDDKVIISGSSDSTVRVWDVNTGEMVNTLIHHCEAVLHLRFNNGMMVTCSKDRSIAVWDMTSPSEITLRRVLVGHRAAVNVVDFDEKYIVSASGDRTIKVWSTSSCEFVRTLNG--HKRGIACLQYRDRLVVSGSSDNSIRLWDIECGACLRVLEGH 412          
BLAST of F-box/WD repeat-containing protein 10 vs. Ensembl Zebrafish
Match: fbxw10 (F-box and WD repeat domain containing 10 [Source:ZFIN;Acc:ZDB-GENE-101021-1])

HSP 1 Score: 274.248 bits (700), Expect = 2.555e-78
Identity = 155/452 (34.29%), Postives = 233/452 (51.55%), Query Frame = 2
Query:  743 LDEKSLNVCSKVCEIWQQIVYEVRREDIVNAKIKKQAMMLQSQKDESKSVFTAPADPRFARDTNVRVPQLEPHSHRIIYINNSPPHTTNKDTYQIDNFNELELINSRKVFSMDVAYQNILTKKLIIEERNIFCGSYSVMIILESQSRNRDPLRTISYNGGLLVAVSGTNKIIQFLDKRGIQTEIMKNSIRGHAGSIKVVKFLNKHNKKFFGKRTYDSYNNICHEDVEILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATMRHKHP--ITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVGEFDTCIGNFHHPKSVLSMEFQFLRAVTGCADGKIRIWNILNGHCIRVIRGNSRSDPILNLVVKDDTLIINTVSNILVLNFEPIDWMY 2092
            LD+ SL+ C +V + WQ +  E+  E  V  ++KKQAM+ Q          T+  +P +A+   V VP  E   H   +   SP HT ++                     +D  Y+   T+K+ +EERN++CG Y+  ++LE +    D  R + Y GG LVAV   ++ I+ L    ++   +   I+GH+GS++ V                     +C E   ++S SYD SIR W+  TG C+ I+ GH GTI+ +D   +   SG+ D   K+W          ++ KHP  I  V +SE L +S  S G I++W+IQ  + I+ +SGH   +  +  D WHILS   D  V  WS    F  C+  F HPK VL+M F FLR +TGC DGKIRI+N LNG C+RVI+ N +  P+L+L    +T+++NT  ++L+L F  + W Y
Sbjct:    6 LDKVSLSSCRRVSKHWQSLTEEILTEMEVKKRVKKQAMIFQGNS-------TSKVNPVYAKICEVLVPISEGDKH-FQHGGTSPRHTQSQGQV------------------LDSLYKGFKTEKIQLEERNVYCGVYNTSVLLERE----DGSRVMHYAGGQLVAVGSRDRTIRLLHIGSLKE--LPLVIQGHSGSVRAVL--------------------VCEEKDLVISASYDLSIRCWNLKTGMCMMIFHGHFGTINCLDLVGDRLVSGAKDCRVKVWNLQTGKCVENLKFKHPKPIMCVKMSETLVISSCSGGQIRIWSIQTALLIRQISGHQGAVLCLCFDQWHILSGGSDGVVKAWSINSSFKKCLRTFQHPKEVLAMSFLFLRIITGCMDGKIRIFNFLNGDCLRVIKTNMKQCPVLSLHTHHNTVVVNTRGSVLMLQFAEVQWDY 405          
BLAST of F-box/WD repeat-containing protein 10 vs. Ensembl Zebrafish
Match: CR381538.1 (F-box and WD repeat domain containing 7 [Source:NCBI gene;Acc:564991])

HSP 1 Score: 113.62 bits (283), Expect = 1.919e-25
Identity = 75/256 (29.30%), Postives = 120/256 (46.88%), Query Frame = 2
Query: 1283 QTEIMKNSIRGHAGSIKVVKFLNKH---NKKFFGKRTYDSYNNICHEDVEILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATM-RHKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVGEFDTCIGNFH-HPKSVLSMEFQFLRAVTGCADGKIRIWNILNGHCIRVIRGNSRSDPILNLVVKDDTLI 2035
            Q  I  N  RG   S KV+K  + H     +F G R              I+SGS D +++ W   TGKCL+  +GH+G +      + I  SGS D T K+W  +      T+  H   +  + + EK  VSG     ++VW+I+ G  +  L GH   +  ++ D   ++S + D  V +W    E +TC+     H   V S++F  +  V+G  D  IR+W++  G+CI  + G+      + L  KD+ L+
Sbjct:  240 QHRIDTNWRRGDLKSPKVLKGHDDHVITCLQFCGNR--------------IVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDP--ETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMEL--KDNILV 477          

HSP 2 Score: 98.5969 bits (244), Expect = 1.300e-20
Identity = 55/188 (29.26%), Postives = 96/188 (51.06%), Query Frame = 2
Query: 1424 ILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSF-ATMRHKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVGEFDTCIGNFHHPKSVLS-MEFQFLRAVTGCADGKIRIWNILNGHCIRVIRG 1981
            I+SGS D +++ W+  TG+C+    GH+ T+  +   E+   SGS D T ++W  +        M H   +  V    +  VSG    ++KVW+ +    + +L GH   + +++ D  H++S SLD  + +W    E   CI      +S+ S ME +    V+G AD  ++IW+I  G C++ ++G
Sbjct:  316 IISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDV--ETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQG 501          

HSP 3 Score: 87.0409 bits (214), Expect = 5.566e-17
Identity = 59/230 (25.65%), Postives = 110/230 (47.83%), Query Frame = 2
Query: 1424 ILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATMR-HKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLW--STVGEFDTCIGNFHHPKSVLSMEFQFLRAVTGCADGKIRIWNILNGHCIR--VIRGNSRSDPILNLVVKDDTLIINTV--------SNILVLNFE 2074
            ++SGS D ++R WD  TG+CL + +GH   +  +        SG+YD   K+W  + +    T++ H + + ++       VSG     I+VW+++ G  I +L+GH    S + L    ++S + D+ V +W   T     T  G   H  +V  ++F     +T   DG +++W++  G  IR  V   +  S  ++  +   +T ++  V        + +LVL+F+
Sbjct:  356 VVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGPHKHQSAVTCLQFNKNFVITSSDDGTVKLWDLRTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFD 585          

HSP 4 Score: 72.7886 bits (177), Expect = 1.316e-12
Identity = 44/183 (24.04%), Postives = 87/183 (47.54%), Query Frame = 2
Query: 1196 LRTISYNGGLLVAVSGTNKIIQFLDKRGIQTEIMKNSIRGHAGSIKVVKFLNKHNKKFFGKRTYDSYNNICHEDVEILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATMR--HKH--PITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSL 1732
            +R + Y+G  +V+    + +++  D    +TE   ++++GH   +  ++F                      + + ++SGS DTSIR WD  TG C+    GH    S ++  + I  SG+ D T K+W         T++  HKH   +T +  ++   ++    G +K+W+++ G +I++L
Sbjct:  386 VRCVQYDGRRVVS-GAYDFMVKVWDP---ETETCLHTLQGHTNRVYSLQF----------------------DGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGPHKHQSAVTCLQFNKNFVITSSDDGTVKLWDLRTGEFIRNL 542          

HSP 5 Score: 61.2326 bits (147), Expect = 5.136e-9
Identity = 42/169 (24.85%), Postives = 77/169 (45.56%), Query Frame = 2
Query: 1580 WRYDEKNSFATMR--HKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVGEFDTCIGNFH-HPKSVLSMEFQFLRAVTGCADGKIRIWNILNGHCIRVIRGNSRSDPILNLVVKDDTLIINTVSNILVLNFEP 2077
            WR  +  S   ++    H IT +       VSG     +KVW+   G  +++L GH   + + ++    I+S S D  + +W+   E   CI   + H  +V  M     R V+G  D  +R+W+I  G C+ V+ G+  +   +  V  D   +++   + +V  ++P
Sbjct:  247 WRRGDLKSPKVLKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRDNIIISGSTDRTLKVWN--AETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGHVAA---VRCVQYDGRRVVSGAYDFMVKVWDP 410          
BLAST of F-box/WD repeat-containing protein 10 vs. Ensembl Zebrafish
Match: AL954386.1 (F-box and WD repeat domain containing 7 [Source:NCBI gene;Acc:564991])

HSP 1 Score: 113.62 bits (283), Expect = 2.231e-25
Identity = 75/256 (29.30%), Postives = 120/256 (46.88%), Query Frame = 2
Query: 1283 QTEIMKNSIRGHAGSIKVVKFLNKH---NKKFFGKRTYDSYNNICHEDVEILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATM-RHKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVGEFDTCIGNFH-HPKSVLSMEFQFLRAVTGCADGKIRIWNILNGHCIRVIRGNSRSDPILNLVVKDDTLI 2035
            Q  I  N  RG   S KV+K  + H     +F G R              I+SGS D +++ W   TGKCL+  +GH+G +      + I  SGS D T K+W  +      T+  H   +  + + EK  VSG     ++VW+I+ G  +  L GH   +  ++ D   ++S + D  V +W    E +TC+     H   V S++F  +  V+G  D  IR+W++  G+CI  + G+      + L  KD+ L+
Sbjct:  240 QHRIDTNWRRGDLKSPKVLKGHDDHVITCLQFCGNR--------------IVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDP--ETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMEL--KDNILV 477          

HSP 2 Score: 98.2117 bits (243), Expect = 1.632e-20
Identity = 55/188 (29.26%), Postives = 96/188 (51.06%), Query Frame = 2
Query: 1424 ILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSF-ATMRHKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVGEFDTCIGNFHHPKSVLS-MEFQFLRAVTGCADGKIRIWNILNGHCIRVIRG 1981
            I+SGS D +++ W+  TG+C+    GH+ T+  +   E+   SGS D T ++W  +        M H   +  V    +  VSG    ++KVW+ +    + +L GH   + +++ D  H++S SLD  + +W    E   CI      +S+ S ME +    V+G AD  ++IW+I  G C++ ++G
Sbjct:  316 IISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDV--ETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQG 501          

HSP 3 Score: 86.6557 bits (213), Expect = 7.875e-17
Identity = 59/230 (25.65%), Postives = 110/230 (47.83%), Query Frame = 2
Query: 1424 ILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATMR-HKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLW--STVGEFDTCIGNFHHPKSVLSMEFQFLRAVTGCADGKIRIWNILNGHCIR--VIRGNSRSDPILNLVVKDDTLIINTV--------SNILVLNFE 2074
            ++SGS D ++R WD  TG+CL + +GH   +  +        SG+YD   K+W  + +    T++ H + + ++       VSG     I+VW+++ G  I +L+GH    S + L    ++S + D+ V +W   T     T  G   H  +V  ++F     +T   DG +++W++  G  IR  V   +  S  ++  +   +T ++  V        + +LVL+F+
Sbjct:  356 VVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGPHKHQSAVTCLQFNKNFVITSSDDGTVKLWDLRTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFD 585          

HSP 4 Score: 72.7886 bits (177), Expect = 1.410e-12
Identity = 44/183 (24.04%), Postives = 87/183 (47.54%), Query Frame = 2
Query: 1196 LRTISYNGGLLVAVSGTNKIIQFLDKRGIQTEIMKNSIRGHAGSIKVVKFLNKHNKKFFGKRTYDSYNNICHEDVEILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATMR--HKH--PITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSL 1732
            +R + Y+G  +V+    + +++  D    +TE   ++++GH   +  ++F                      + + ++SGS DTSIR WD  TG C+    GH    S ++  + I  SG+ D T K+W         T++  HKH   +T +  ++   ++    G +K+W+++ G +I++L
Sbjct:  386 VRCVQYDGRRVVS-GAYDFMVKVWDP---ETETCLHTLQGHTNRVYSLQF----------------------DGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGPHKHQSAVTCLQFNKNFVITSSDDGTVKLWDLRTGEFIRNL 542          

HSP 5 Score: 60.8474 bits (146), Expect = 7.239e-9
Identity = 42/169 (24.85%), Postives = 77/169 (45.56%), Query Frame = 2
Query: 1580 WRYDEKNSFATMR--HKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVGEFDTCIGNFH-HPKSVLSMEFQFLRAVTGCADGKIRIWNILNGHCIRVIRGNSRSDPILNLVVKDDTLIINTVSNILVLNFEP 2077
            WR  +  S   ++    H IT +       VSG     +KVW+   G  +++L GH   + + ++    I+S S D  + +W+   E   CI   + H  +V  M     R V+G  D  +R+W+I  G C+ V+ G+  +   +  V  D   +++   + +V  ++P
Sbjct:  247 WRRGDLKSPKVLKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRDNIIISGSTDRTLKVWN--AETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGHVAA---VRCVQYDGRRVVSGAYDFMVKVWDP 410          
BLAST of F-box/WD repeat-containing protein 10 vs. Ensembl Zebrafish
Match: fbxw7 (F-box and WD repeat domain containing 7 [Source:ZFIN;Acc:ZDB-GENE-090313-79])

HSP 1 Score: 113.235 bits (282), Expect = 2.324e-25
Identity = 75/256 (29.30%), Postives = 120/256 (46.88%), Query Frame = 2
Query: 1283 QTEIMKNSIRGHAGSIKVVKFLNKH---NKKFFGKRTYDSYNNICHEDVEILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATM-RHKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVGEFDTCIGNFH-HPKSVLSMEFQFLRAVTGCADGKIRIWNILNGHCIRVIRGNSRSDPILNLVVKDDTLI 2035
            Q  I  N  RG   S KV+K  + H     +F G R              I+SGS D +++ W   TGKCL+  +GH+G +      + I  SGS D T K+W  +      T+  H   +  + + EK  VSG     ++VW+I+ G  +  L GH   +  ++ D   ++S + D  V +W    E +TC+     H   V S++F  +  V+G  D  IR+W++  G+CI  + G+      + L  KD+ L+
Sbjct:  195 QHRIDTNWRRGDLKSPKVLKGHDDHVITCLQFCGNR--------------IVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDP--ETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMEL--KDNILV 432          

HSP 2 Score: 97.8265 bits (242), Expect = 1.825e-20
Identity = 55/188 (29.26%), Postives = 96/188 (51.06%), Query Frame = 2
Query: 1424 ILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSF-ATMRHKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVGEFDTCIGNFHHPKSVLS-MEFQFLRAVTGCADGKIRIWNILNGHCIRVIRG 1981
            I+SGS D +++ W+  TG+C+    GH+ T+  +   E+   SGS D T ++W  +        M H   +  V    +  VSG    ++KVW+ +    + +L GH   + +++ D  H++S SLD  + +W    E   CI      +S+ S ME +    V+G AD  ++IW+I  G C++ ++G
Sbjct:  271 IISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDV--ETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQG 456          

HSP 3 Score: 88.5817 bits (218), Expect = 1.344e-17
Identity = 101/483 (20.91%), Postives = 193/483 (39.96%), Query Frame = 2
Query:  680 NFAVDFISNLPVHISKRIINFLDEKSLNVCSKVCEIWQQIVYEVRREDIVNAKIKKQAMMLQSQKDESKSVFTAPADPRFARDTNVRVPQLEPHSHRIIYINNSPPHTTNKDTYQIDNFNELELINSRKVFSMDVAYQNILTKKLIIEERNIFCGSYSVMIILESQSRNRDPLRTISYNGGLLVAVSGTNKIIQFLDKRGI-----QTEIMKNSIRGHAGSIKVVKFLNKHNKKFFGKRTYDSYNNICHEDVEILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATMR-HKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLW--STVGEFDTCIGNFHHPKSVLSMEFQFLRAVTGCADGKIRIWNILNGHCIR--VIRGNSRSDPILNLVVKDDTLIINTV--------SNILVLNFE 2074
             F  DFIS LP  ++  +++FL+ K L   ++ C  W               +I  +  +L  +K + + +     +P   +   V  P       +  YI            ++ID       + S KV      + + +   L      I  GS    + + S    +     + + GG+  +    N II     R +     +T    +++ GH  +++ +     H K+                   ++SGS D ++R WD  TG+CL + +GH   +  +        SG+YD   K+W  + +    T++ H + + ++       VSG     I+VW+++ G  I +L+GH    S + L    ++S + D+ V +W   T     T  G   H  +V  ++F     +T   DG +++W++  G  IR  V   +  S  ++  +   +T ++  V        + +LVL+F+
Sbjct:  112 QFQRDFISLLPRELALHVLSFLEPKDLLQAAQTCRYW---------------RILAEDNLLWKEKCKEEGI----DEPLHIKRRKVIKPGFTHSPWKSAYIRQ----------HRIDTNWRRGDLKSPKVLK---GHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHL---HEKR-------------------VVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGPHKHQSAVTCLQFNKNFVITSSDDGTVKLWDLRTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFD 540          

HSP 4 Score: 60.8474 bits (146), Expect = 6.471e-9
Identity = 42/169 (24.85%), Postives = 77/169 (45.56%), Query Frame = 2
Query: 1580 WRYDEKNSFATMR--HKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVGEFDTCIGNFH-HPKSVLSMEFQFLRAVTGCADGKIRIWNILNGHCIRVIRGNSRSDPILNLVVKDDTLIINTVSNILVLNFEP 2077
            WR  +  S   ++    H IT +       VSG     +KVW+   G  +++L GH   + + ++    I+S S D  + +W+   E   CI   + H  +V  M     R V+G  D  +R+W+I  G C+ V+ G+  +   +  V  D   +++   + +V  ++P
Sbjct:  202 WRRGDLKSPKVLKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRDNIIISGSTDRTLKVWN--AETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGHVAA---VRCVQYDGRRVVSGAYDFMVKVWDP 365          
BLAST of F-box/WD repeat-containing protein 10 vs. Ensembl Zebrafish
Match: fbxw7 (F-box and WD repeat domain containing 7 [Source:ZFIN;Acc:ZDB-GENE-090313-79])

HSP 1 Score: 114.005 bits (284), Expect = 3.021e-25
Identity = 75/256 (29.30%), Postives = 120/256 (46.88%), Query Frame = 2
Query: 1283 QTEIMKNSIRGHAGSIKVVKFLNKH---NKKFFGKRTYDSYNNICHEDVEILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATM-RHKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVGEFDTCIGNFH-HPKSVLSMEFQFLRAVTGCADGKIRIWNILNGHCIRVIRGNSRSDPILNLVVKDDTLI 2035
            Q  I  N  RG   S KV+K  + H     +F G R              I+SGS D +++ W   TGKCL+  +GH+G +      + I  SGS D T K+W  +      T+  H   +  + + EK  VSG     ++VW+I+ G  +  L GH   +  ++ D   ++S + D  V +W    E +TC+     H   V S++F  +  V+G  D  IR+W++  G+CI  + G+      + L  KD+ L+
Sbjct:  411 QHRIDTNWRRGDLKSPKVLKGHDDHVITCLQFCGNR--------------IVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDP--ETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMEL--KDNILV 648          

HSP 2 Score: 98.5969 bits (244), Expect = 1.888e-20
Identity = 55/188 (29.26%), Postives = 96/188 (51.06%), Query Frame = 2
Query: 1424 ILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSF-ATMRHKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVGEFDTCIGNFHHPKSVLS-MEFQFLRAVTGCADGKIRIWNILNGHCIRVIRG 1981
            I+SGS D +++ W+  TG+C+    GH+ T+  +   E+   SGS D T ++W  +        M H   +  V    +  VSG    ++KVW+ +    + +L GH   + +++ D  H++S SLD  + +W    E   CI      +S+ S ME +    V+G AD  ++IW+I  G C++ ++G
Sbjct:  487 IISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDV--ETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQG 672          

HSP 3 Score: 87.0409 bits (214), Expect = 7.848e-17
Identity = 59/230 (25.65%), Postives = 110/230 (47.83%), Query Frame = 2
Query: 1424 ILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATMR-HKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWS--TVGEFDTCIGNFHHPKSVLSMEFQFLRAVTGCADGKIRIWNILNGHCIR--VIRGNSRSDPILNLVVKDDTLIINTV--------SNILVLNFE 2074
            ++SGS D ++R WD  TG+CL + +GH   +  +        SG+YD   K+W  + +    T++ H + + ++       VSG     I+VW+++ G  I +L+GH    S + L    ++S + D+ V +W   T     T  G   H  +V  ++F     +T   DG +++W++  G  IR  V   +  S  ++  +   +T ++  V        + +LVL+F+
Sbjct:  527 VVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGPHKHQSAVTCLQFNKNFVITSSDDGTVKLWDLRTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFD 756          

HSP 4 Score: 72.0182 bits (175), Expect = 3.306e-12
Identity = 44/183 (24.04%), Postives = 87/183 (47.54%), Query Frame = 2
Query: 1196 LRTISYNGGLLVAVSGTNKIIQFLDKRGIQTEIMKNSIRGHAGSIKVVKFLNKHNKKFFGKRTYDSYNNICHEDVEILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATMR--HKH--PITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSL 1732
            +R + Y+G  +V+    + +++  D    +TE   ++++GH   +  ++F                      + + ++SGS DTSIR WD  TG C+    GH    S ++  + I  SG+ D T K+W         T++  HKH   +T +  ++   ++    G +K+W+++ G +I++L
Sbjct:  557 VRCVQYDGRRVVS-GAYDFMVKVWDP---ETETCLHTLQGHTNRVYSLQF----------------------DGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGPHKHQSAVTCLQFNKNFVITSSDDGTVKLWDLRTGEFIRNL 713          

HSP 5 Score: 62.003 bits (149), Expect = 3.705e-9
Identity = 42/169 (24.85%), Postives = 77/169 (45.56%), Query Frame = 2
Query: 1580 WRYDEKNSFATMR--HKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVGEFDTCIGNFH-HPKSVLSMEFQFLRAVTGCADGKIRIWNILNGHCIRVIRGNSRSDPILNLVVKDDTLIINTVSNILVLNFEP 2077
            WR  +  S   ++    H IT +       VSG     +KVW+   G  +++L GH   + + ++    I+S S D  + +W+   E   CI   + H  +V  M     R V+G  D  +R+W+I  G C+ V+ G+  +   +  V  D   +++   + +V  ++P
Sbjct:  418 WRRGDLKSPKVLKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRDNIIISGSTDRTLKVWNA--ETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGHVAA---VRCVQYDGRRVVSGAYDFMVKVWDP 581          
BLAST of F-box/WD repeat-containing protein 10 vs. Ensembl Xenopus
Match: ptbp2 (polypyrimidine tract binding protein 2 [Source:Xenbase;Acc:XB-GENE-491012])

HSP 1 Score: 333.569 bits (854), Expect = 8.719e-97
Identity = 206/711 (28.97%), Postives = 344/711 (48.38%), Query Frame = 2
Query:   32 MDEHILKCLDSIEISKNNIFNGTIFICKENPNPNPCQNCITCKLVILKDFSVSLLNHMPDNDVINFITKCSKTESYTELTGVLQHILYPLKAKDRLYSLSRNVPSLNTDLSDFSIKNFTIDKAQLEYVTHRISNWISLQPDTFRIQFIISLLAH------------LKLAVLSEIY-------NAISTNKDSSTDSSYTSNEIINTDSDPVTLLQRVCKISANHIFEDKHSEKNNNFAVDFISNLPVHISKRIINFLDEKSLNVCSKVCEIWQQIVYEVRREDIVNAKIKKQAMMLQSQKDESKSVFTAPADPRFARDTNVRVPQLEPHSHRIIYINNSPPHTTNKDTYQIDNFNELELINSRKVFSMDVAYQNILTKKLIIEERNIFCGSYSVMIILESQSRNRDPLRTISYNGGLLVAVSGTNKIIQFLDKRGIQTEIMKNSIRGHAGSIKVVKFLNKHNKKFFGKRTYDSYNNICHEDVEILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATMRHKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVGEFDTCIGNFHHPKSVLSMEFQFLRAVTGCADGKIRIWNILNGHCIRVIRGNSRSDPILNLVVKDDTLIINTVSNILVLNFEPIDWMYENGKD 2107
            M +H  + +  +E+ +  + +  +  C + P    CQ C TC L      +   L    D     F+    +     EL   L+ +L P   KD  YS SR  PSL  DL   S  +  +++  L         W+   P   +  + + LL              + + ++ E++         +  ++ +  D +   ++ +++D DP  ++          +     S    +   DFI  LPVH+SKRI+ FL++KSL  C  V + W  ++ E  ++      ++ +AM+LQ    +  S+        +A+  +V VP++    + I        +   +  YQ     E          S++ AY +  T  + +EERN+FCGSY+V+I+    +   D  R I ++GG LVAV   ++ ++  D   ++ + +   I GHAGSI+ V FL                   C E   + SG +D SIR+W   +G C++I+ GH  TI+ +D  E++  SG+ D   K+W         T +HK P+  V I E+  VSG   GL+K+W++ +   IK+L+GH   I  +  D WH++S S D + + WS +G F   +  F HPK VL MEF +LR +TGCADGKIR++N LNG C+RV+R NSR+DP+++L ++D+ ++INT ++I++  FE + W Y    +
Sbjct:    1 MKQH--RIMGMMEVCEYRLLSSPVLRCAKVPM---CQRCETCLLSRRHAQTKEWLRRASDASHRRFLFGVIRRLQSLELLQYLEKVLRPTLGKDFTYSRSRINPSLRQDLGT-SGSDRALNRRLLLQFMLETWEWLKHAPYWSKANYTLLLLQMCPPNLVHSAANLIHVLIMQEMHPHTRKAVTPMGHSRATGQDGTQGPDQAVSSD-DPSIMM----------VPTSFKSTSGVSLYKDFICCLPVHLSKRILGFLNKKSLFSCLFVSQYWYYLIKETLQDLDAERLVRNEAMILQGTSYKGVSI-------SYAKMRSVPVPKVGEGGNTI--------NAVERKFYQETKTGE----------SLEAAYIDTETTSVPLEERNLFCGSYNVLIL----TGQGDHHRVIHFDGGRLVAVGSVDRKVKLFDL--VEMKQVPPLIHGHAGSIRRV-FL-------------------CEERGFLFSGGFDLSIRQWAVESGVCMRIFHGHMKTITSLDVEEDLLVSGAKDCHVKVWNIPTGKCLRTFKHKDPVLCVRIKERYVVSGCEKGLVKLWHMDSATLIKTLTGHSGPIKCLSFDQWHLISGSADGYAIAWSMMGNFQKRLCTFRHPKEVLCMEFLYLRVITGCADGKIRVFNFLNGDCLRVMRANSRADPVMSLCIRDNRMVINTPASIMIFQFEEVSWDYSQASE 643          
BLAST of F-box/WD repeat-containing protein 10 vs. Ensembl Xenopus
Match: ptbp2 (polypyrimidine tract binding protein 2 [Source:Xenbase;Acc:XB-GENE-491012])

HSP 1 Score: 276.559 bits (706), Expect = 2.040e-78
Identity = 130/345 (37.68%), Postives = 203/345 (58.84%), Query Frame = 2
Query: 1073 SMDVAYQNILTKKLIIEERNIFCGSYSVMIILESQSRNRDPLRTISYNGGLLVAVSGTNKIIQFLDKRGIQTEIMKNSIRGHAGSIKVVKFLNKHNKKFFGKRTYDSYNNICHEDVEILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATMRHKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVGEFDTCIGNFHHPKSVLSMEFQFLRAVTGCADGKIRIWNILNGHCIRVIRGNSRSDPILNLVVKDDTLIINTVSNILVLNFEPIDWMYENGKD 2107
            +++ AY +  T  + +EERN+FCGSY+V+I+    +   D  R I ++GG LVAV   ++ ++  D   ++ + +   I GHAGSI+ V FL                   C E   + SG +D SIR+W   +G C++I+ GH  TI+ +D  E++  SG+ D   K+W         T +HK P+  V I E+  VSG   GL+K+W++ +   IK+L+GH   I  +  D WH++S S D + + WS +G F   +  F HPK VL MEF +LR +TGCADGKIR++N LNG C+RV+R NSR+DP+++L ++D+ ++INT ++I++  FE + W Y    +
Sbjct:  179 TLEAAYIDTETTSVPLEERNLFCGSYNVLIL----TGQGDHHRVIHFDGGRLVAVGSVDRKVKLFDL--VEMKQVPPLIHGHAGSIRRV-FL-------------------CEERGFLFSGGFDLSIRQWAVESGVCMRIFHGHMKTITSLDVEEDLLVSGAKDCHVKVWNIPTGKCLRTFKHKDPVLCVRIKERYVVSGCEKGLVKLWHMDSATLIKTLTGHSGPIKCLSFDQWHLISGSADGYAIAWSMMGNFQKRLCTFRHPKEVLCMEFLYLRVITGCADGKIRVFNFLNGDCLRVMRANSRADPVMSLCIRDNRMVINTPASIMIFQFEEVSWDYSQASE 497          
BLAST of F-box/WD repeat-containing protein 10 vs. Ensembl Xenopus
Match: ENSXETT00000008237.1 (F-box and WD repeat domain containing 7 [Source:NCBI gene;Acc:100145670])

HSP 1 Score: 115.161 bits (287), Expect = 1.662e-25
Identity = 75/256 (29.30%), Postives = 120/256 (46.88%), Query Frame = 2
Query: 1283 QTEIMKNSIRGHAGSIKVVKFLNKH---NKKFFGKRTYDSYNNICHEDVEILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATM-RHKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVGEFDTCIGNFH-HPKSVLSMEFQFLRAVTGCADGKIRIWNILNGHCIRVIRGNSRSDPILNLVVKDDTLI 2035
            Q  I  N  RG   S KV+K  + H     +F G R              I+SGS D +++ W   TGKCL+  +GH+G +      + I  SGS D T K+W  +      T+  H   +  + + EK  VSG     ++VW+I+ G  +  L GH   +  ++ D   ++S + D  V +W    E +TC+     H   V S++F  +  V+G  D  IR+W++  G+CI  + G+      + L  KD+ L+
Sbjct:  354 QHRIDTNWRRGELKSPKVLKGHDDHVITCLQFCGNR--------------IVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDP--ETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMEL--KDNILV 591          

HSP 2 Score: 99.7525 bits (247), Expect = 1.201e-20
Identity = 55/188 (29.26%), Postives = 96/188 (51.06%), Query Frame = 2
Query: 1424 ILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSF-ATMRHKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVGEFDTCIGNFHHPKSVLS-MEFQFLRAVTGCADGKIRIWNILNGHCIRVIRG 1981
            I+SGS D +++ W+  TG+C+    GH+ T+  +   E+   SGS D T ++W  +        M H   +  V    +  VSG    ++KVW+ +    + +L GH   + +++ D  H++S SLD  + +W    E   CI      +S+ S ME +    V+G AD  ++IW+I  G C++ ++G
Sbjct:  430 IISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDV--ETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQG 615          

HSP 3 Score: 91.2781 bits (225), Expect = 4.402e-18
Identity = 109/492 (22.15%), Postives = 199/492 (40.45%), Query Frame = 2
Query:  683 FAVDFISNLPVHISKRIINFLDEKSLNVCSKVCEIWQQIVYE--VRREDIVNAKIKKQAMMLQSQKDESKSVFTAPADPRFAR----DTNVRVPQLEPHSHRIIYINNSPPHTTNKDTYQIDNFNELELINSRKVFSMD---VAYQNILTKKLIIEERNIFCGSYSVMIILESQSRNRDPLRT-ISYNGGLLVAVSGTNKIIQFLDKRGI-----QTEIMKNSIRGHAGSIKVVKFLNKHNKKFFGKRTYDSYNNICHEDVEILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATMR-HKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWS--TVGEFDTCIGNFHHPKSVLSMEFQFLRAVTGCADGKIRIWNILNGHCIR--VIRGNSRSDPILNLVVKDDTLIINTV--------SNILVLNFE 2074
            F  DFIS LP  ++  +++FLD K L   ++ C  W+ +  +  + RE      I  + + L+ +K        +P    + R    DTN R  +L+           SP      D + I     L+   +R V   D   +   + +T K                            LRT + + GG+  +    N II     R +     +T    +++ GH  +++ +     H K+                   ++SGS D ++R WD  TG+CL + +GH   +  +        SG+YD   K+W  + +    T++ H + + ++       VSG     I+VW+++ G  I +L+GH    S + L    ++S + D+ V +W   T     T  G   H  +V  ++F     +T   DG +++W++  G  IR  V   +  S  ++  +   +T ++  V        + +LVL+F+
Sbjct:  272 FQRDFISLLPKELALYVLSFLDPKDLLQAAQTCRYWRILAEDNLLWREKCKEDGID-EPLHLKKRKISKPGFTHSPWKSAYIRQHRIDTNWRRGELK-----------SPKVLKGHDDHVI---TCLQFCGNRIVSGSDDNTLKVWSAVTGKC---------------------------LRTLVGHTGGVWSSQMRDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHL---HEKR-------------------VVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGPNKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFD 699          
BLAST of F-box/WD repeat-containing protein 10 vs. Ensembl Xenopus
Match: ENSXETT00000008205.1 (F-box and WD repeat domain containing 7 [Source:NCBI gene;Acc:100145670])

HSP 1 Score: 115.161 bits (287), Expect = 2.022e-25
Identity = 75/256 (29.30%), Postives = 120/256 (46.88%), Query Frame = 2
Query: 1283 QTEIMKNSIRGHAGSIKVVKFLNKH---NKKFFGKRTYDSYNNICHEDVEILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATM-RHKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVGEFDTCIGNFH-HPKSVLSMEFQFLRAVTGCADGKIRIWNILNGHCIRVIRGNSRSDPILNLVVKDDTLI 2035
            Q  I  N  RG   S KV+K  + H     +F G R              I+SGS D +++ W   TGKCL+  +GH+G +      + I  SGS D T K+W  +      T+  H   +  + + EK  VSG     ++VW+I+ G  +  L GH   +  ++ D   ++S + D  V +W    E +TC+     H   V S++F  +  V+G  D  IR+W++  G+CI  + G+      + L  KD+ L+
Sbjct:  424 QHRIDTNWRRGELKSPKVLKGHDDHVITCLQFCGNR--------------IVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDP--ETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMEL--KDNILV 661          

HSP 2 Score: 99.3673 bits (246), Expect = 1.599e-20
Identity = 55/188 (29.26%), Postives = 96/188 (51.06%), Query Frame = 2
Query: 1424 ILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSF-ATMRHKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVGEFDTCIGNFHHPKSVLS-MEFQFLRAVTGCADGKIRIWNILNGHCIRVIRG 1981
            I+SGS D +++ W+  TG+C+    GH+ T+  +   E+   SGS D T ++W  +        M H   +  V    +  VSG    ++KVW+ +    + +L GH   + +++ D  H++S SLD  + +W    E   CI      +S+ S ME +    V+G AD  ++IW+I  G C++ ++G
Sbjct:  500 IISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDV--ETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQG 685          

HSP 3 Score: 91.6633 bits (226), Expect = 4.124e-18
Identity = 109/492 (22.15%), Postives = 199/492 (40.45%), Query Frame = 2
Query:  683 FAVDFISNLPVHISKRIINFLDEKSLNVCSKVCEIWQQIVYE--VRREDIVNAKIKKQAMMLQSQKDESKSVFTAPADPRFAR----DTNVRVPQLEPHSHRIIYINNSPPHTTNKDTYQIDNFNELELINSRKVFSMD---VAYQNILTKKLIIEERNIFCGSYSVMIILESQSRNRDPLRT-ISYNGGLLVAVSGTNKIIQFLDKRGI-----QTEIMKNSIRGHAGSIKVVKFLNKHNKKFFGKRTYDSYNNICHEDVEILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATMR-HKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWS--TVGEFDTCIGNFHHPKSVLSMEFQFLRAVTGCADGKIRIWNILNGHCIR--VIRGNSRSDPILNLVVKDDTLIINTV--------SNILVLNFE 2074
            F  DFIS LP  ++  +++FLD K L   ++ C  W+ +  +  + RE      I  + + L+ +K        +P    + R    DTN R  +L+           SP      D + I     L+   +R V   D   +   + +T K                            LRT + + GG+  +    N II     R +     +T    +++ GH  +++ +     H K+                   ++SGS D ++R WD  TG+CL + +GH   +  +        SG+YD   K+W  + +    T++ H + + ++       VSG     I+VW+++ G  I +L+GH    S + L    ++S + D+ V +W   T     T  G   H  +V  ++F     +T   DG +++W++  G  IR  V   +  S  ++  +   +T ++  V        + +LVL+F+
Sbjct:  342 FQRDFISLLPKELALYVLSFLDPKDLLQAAQTCRYWRILAEDNLLWREKCKEDGID-EPLHLKKRKISKPGFTHSPWKSAYIRQHRIDTNWRRGELK-----------SPKVLKGHDDHVI---TCLQFCGNRIVSGSDDNTLKVWSAVTGKC---------------------------LRTLVGHTGGVWSSQMRDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHL---HEKR-------------------VVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGPNKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFD 769          
BLAST of F-box/WD repeat-containing protein 10 vs. Ensembl Xenopus
Match: ENSXETT00000008111.1 (F-box and WD repeat domain containing 7 [Source:NCBI gene;Acc:100145670])

HSP 1 Score: 113.235 bits (282), Expect = 2.494e-25
Identity = 75/256 (29.30%), Postives = 120/256 (46.88%), Query Frame = 2
Query: 1283 QTEIMKNSIRGHAGSIKVVKFLNKH---NKKFFGKRTYDSYNNICHEDVEILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATM-RHKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVGEFDTCIGNFH-HPKSVLSMEFQFLRAVTGCADGKIRIWNILNGHCIRVIRGNSRSDPILNLVVKDDTLI 2035
            Q  I  N  RG   S KV+K  + H     +F G R              I+SGS D +++ W   TGKCL+  +GH+G +      + I  SGS D T K+W  +      T+  H   +  + + EK  VSG     ++VW+I+ G  +  L GH   +  ++ D   ++S + D  V +W    E +TC+     H   V S++F  +  V+G  D  IR+W++  G+CI  + G+      + L  KD+ L+
Sbjct:  165 QHRIDTNWRRGELKSPKVLKGHDDHVITCLQFCGNR--------------IVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDP--ETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMEL--KDNILV 402          

HSP 2 Score: 97.4413 bits (241), Expect = 3.186e-20
Identity = 55/188 (29.26%), Postives = 96/188 (51.06%), Query Frame = 2
Query: 1424 ILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSF-ATMRHKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVGEFDTCIGNFHHPKSVLS-MEFQFLRAVTGCADGKIRIWNILNGHCIRVIRG 1981
            I+SGS D +++ W+  TG+C+    GH+ T+  +   E+   SGS D T ++W  +        M H   +  V    +  VSG    ++KVW+ +    + +L GH   + +++ D  H++S SLD  + +W    E   CI      +S+ S ME +    V+G AD  ++IW+I  G C++ ++G
Sbjct:  241 IISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDV--ETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQG 426          

HSP 3 Score: 89.7373 bits (221), Expect = 8.857e-18
Identity = 108/488 (22.13%), Postives = 203/488 (41.60%), Query Frame = 2
Query:  680 NFAVDFISNLPVHISKRIINFLDEKSLNVCSKVCEIWQQIVYE--VRREDIVNAKIKKQAMMLQSQKDESKSVFTAPADPRFAR----DTNVRVPQLEPHSHRIIYINNSPPHTTNKDTYQIDNFNELELINSRKVFSMD---VAYQNILTKKLIIEERNIFCGSYSVMIILESQSRNRDPLRTISYNGGLLVAVSG-TNKIIQFLDKRGIQTEIMKNSIRGHAGSIKVVKFLNKHNKKFFGKRTYDSYNNICHEDVEILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATMR-HKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLW--STVGEFDTCIGNFHHPKSVLSMEFQFLRAVTGCADGKIRIWNILNGHCIR--VIRGNSRSDPILNLVVKDDTLIINTV--------SNILVLNFE 2074
             F  DFIS LP  ++  +++FLD K L   ++ C  W+ +  +  + RE      I  + + L+ +K        +P    + R    DTN R  +L+           SP      D + I     L+   +R V   D   +   + +T K +        G +S      SQ R+              + +SG T++ ++  +    +T    +++ GH  +++ +     H K+                   ++SGS D ++R WD  TG+CL + +GH   +  +        SG+YD   K+W  + +    T++ H + + ++       VSG     I+VW+++ G  I +L+GH    S + L    ++S + D+ V +W   T     T  G   H  +V  ++F     +T   DG +++W++  G  IR  V   +  S  ++  +   +T ++  V        + +LVL+F+
Sbjct:   82 QFQRDFISLLPKELALYVLSFLDPKDLLQAAQTCRYWRILAEDNLLWREKCKEDGID-EPLHLKKRKISKPGFTHSPWKSAYIRQHRIDTNWRRGELK-----------SPKVLKGHDDHVI---TCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWS------SQMRDN-------------IIISGSTDRTLKVWNA---ETGECIHTLYGHTSTVRCMHL---HEKR-------------------VVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGPNKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFD 510          
BLAST of F-box/WD repeat-containing protein 10 vs. Ensembl Mouse
Match: Fbxw10 (F-box and WD-40 domain protein 10 [Source:MGI Symbol;Acc:MGI:3052463])

HSP 1 Score: 307.375 bits (786), Expect = 7.602e-88
Identity = 164/470 (34.89%), Postives = 264/470 (56.17%), Query Frame = 2
Query:  692 DFISNLPVHISKRIINFLDEKSLNVCSKVCEIWQQIVYEVRREDIVNAKIKKQAMMLQSQKDESKSV---FTAPADPRFARDTNVRVPQLEPHSHRIIYINNSPPHTTNKDTYQIDNFNELELINSRKVFSMDVAYQNILTKKLIIEERNIFCGSYSVMIILESQSRNRDPLRTISYNGGLLVAVSGTNKIIQFLDKRGIQTEIMKNSIRGHAGSIKVVKFLNKHNKKFFGKRTYDSYNNICHEDVEILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATMRHKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVGEFDTCIGNFHHPKSVLSMEFQFLRAVTGCADGKIRIWNILNGHCIRVIRGNSRSDPILNLVVKDDTLIINTVSNILVLNFEPIDWMY 2092
            DFI +LP+H+SK I+  LD+ SLN C  V + W  +  +V+ +  +++ I+ Q  +LQ  K+E ++    +T   DP +A   ++ VP++         +++     +    +++    +  L N         AYQN  T+ + +EERN+FCG+Y++ ++ ++  +NR     I YNGG L+A+S +N+ I  LD   +QT+ +    RGHAGS++ + FL++                   ED  +LSGSYD SIR WD  TG C++I+ GH GTI+ +D  +    SG+ DG  K W  +      T +HK PI A  ISE   VS    G++KVW++      K+L+GH   +  +  + WH++S   D  VM WS VG+++ C+  F HPK VL +   +LR ++ C DGKIRI+N LNG+C++VI+ ++R DP+L+   + + ++ +T SNILV  FE + W Y
Sbjct:  281 DFIRDLPLHLSKYILRMLDKHSLNRCIFVSQHWATLAQQVKVDQSMHSFIQNQISLLQVTKEEKQAYTGSYTRGIDPNYANKVSIPVPKI---------VDDGKRSRSKNQKWKLRTKTDYNLWN---------AYQNQETQLVQMEERNVFCGTYNIRVLSDTFDQNR----IIHYNGGDLMAIS-SNRKIHLLDI--MQTKELPIEFRGHAGSVRAL-FLSE-------------------EDNILLSGSYDLSIRYWDVKTGACVRIFYGHQGTITCLDVYKNRLVSGAKDGQVKEWDIETGKCLKTFKHKDPILAAKISETYIVSSCERGIVKVWHVVTAQLQKTLTGHEGAVKCLFFNEWHLVSGGADGLVMAWSMVGKYERCLMAFKHPKEVLQVSLLYLRVISACGDGKIRIYNFLNGNCLKVIKVDARGDPVLSFFYQGNRMVAHTDSNILVFQFENVKWQY 705          
BLAST of F-box/WD repeat-containing protein 10 vs. Ensembl Mouse
Match: Fbxw10 (F-box and WD-40 domain protein 10 [Source:MGI Symbol;Acc:MGI:3052463])

HSP 1 Score: 301.982 bits (772), Expect = 4.915e-86
Identity = 162/467 (34.69%), Postives = 259/467 (55.46%), Query Frame = 2
Query:  692 DFISNLPVHISKRIINFLDEKSLNVCSKVCEIWQQIVYEVRREDIVNAKIKKQAMMLQSQKDESKSVFTAPADPRFARDTNVRVPQLEPHSHRIIYINNSPPHTTNKDTYQIDNFNELELINSRKVFSMDVAYQNILTKKLIIEERNIFCGSYSVMIILESQSRNRDPLRTISYNGGLLVAVSGTNKIIQFLDKRGIQTEIMKNSIRGHAGSIKVVKFLNKHNKKFFGKRTYDSYNNICHEDVEILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATMRHKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVGEFDTCIGNFHHPKSVLSMEFQFLRAVTGCADGKIRIWNILNGHCIRVIRGNSRSDPILNLVVKDDTLIINTVSNILVLNFEPIDWMY 2092
            DFI +LP+H+SK I+  LD+ SLN C  V + W  +  +V+ +  +++ I+ Q  +LQ         +T   DP +A   ++ VP++         +++     +    +++    +  L N         AYQN  T+ + +EERN+FCG+Y++ ++ ++  +NR     I YNGG L+A+S +N+ I  LD   +QT+ +    RGHAGS++ + FL++                   ED  +LSGSYD SIR WD  TG C++I+ GH GTI+ +D  +    SG+ DG  K W  +      T +HK PI A  ISE   VS    G++KVW++      K+L+GH   +  +  + WH++S   D  VM WS VG+++ C+  F HPK VL +   +LR ++ C DGKIRI+N LNG+C++VI+ ++R DP+L+   + + ++ +T SNILV  FE + W Y
Sbjct:  281 DFIRDLPLHLSKYILRMLDKHSLNRCIFVSQHWATLAQQVKVDQSMHSFIQNQISLLQGS-------YTRGIDPNYANKVSIPVPKI---------VDDGKRSRSKNQKWKLRTKTDYNLWN---------AYQNQETQLVQMEERNVFCGTYNIRVLSDTFDQNR----IIHYNGGDLMAIS-SNRKIHLLDI--MQTKELPIEFRGHAGSVRAL-FLSE-------------------EDNILLSGSYDLSIRYWDVKTGACVRIFYGHQGTITCLDVYKNRLVSGAKDGQVKEWDIETGKCLKTFKHKDPILAAKISETYIVSSCERGIVKVWHVVTAQLQKTLTGHEGAVKCLFFNEWHLVSGGADGLVMAWSMVGKYERCLMAFKHPKEVLQVSLLYLRVISACGDGKIRIYNFLNGNCLKVIKVDARGDPVLSFFYQGNRMVAHTDSNILVFQFENVKWQY 695          
BLAST of F-box/WD repeat-containing protein 10 vs. Ensembl Mouse
Match: Fbxw10 (F-box and WD-40 domain protein 10 [Source:MGI Symbol;Acc:MGI:3052463])

HSP 1 Score: 296.204 bits (757), Expect = 7.043e-84
Identity = 162/472 (34.32%), Postives = 259/472 (54.87%), Query Frame = 2
Query:  692 DFISNLPVHISKRIINFLDEKSLNVCSKVCEIWQQIVYEVRREDIVNAKIKKQAMMLQSQKDESKSVFTAPADPRFARDTNVRVPQLEPHSHRIIYINNSPPHTTNKDTYQIDNFNELELINSRKVFSMDVAYQNILTKKLIIEERNIFCGSYSVMIILESQSRNRDPLRTISYNGGLLVAVSGTNKIIQFLDKRGIQTEIMKNSIRGHAGSIKVVKFLNKHNKKFFGKRTYDSYNNICHEDVEILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATMRHKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVGEFDTCIGNFHHPKSVLSMEFQFLRAVTGCADGKIRIWNILNGHCIRVIRGNSRSDPILNLVVKDDTLII-----NTVSNILVLNFEPIDWMY 2092
            DFI +LP+H+SK I+  LD+ SLN C  V + W  +  +V+ +  +++ I+ Q  +LQ         +T   DP +A   ++ VP++         +++     +    +++    +  L N         AYQN  T+ + +EERN+FCG+Y++ ++ ++  +NR     I YNGG L+A+S +N+ I  LD   +QT+ +    RGHAGS++ + FL++                   ED  +LSGSYD SIR WD  TG C++I+ GH GTI+ +D  +    SG+ DG  K W  +      T +HK PI A  ISE   VS    G++KVW++      K+L+GH   +  +  + WH++S   D  VM WS VG+++ C+  F HPK VL +   +LR ++ C DGKIRI+N LNG+C++VI+ ++R DP+L+   + +  ++     +T SNILV  FE + W Y
Sbjct:  281 DFIRDLPLHLSKYILRMLDKHSLNRCIFVSQHWATLAQQVKVDQSMHSFIQNQISLLQGS-------YTRGIDPNYANKVSIPVPKI---------VDDGKRSRSKNQKWKLRTKTDYNLWN---------AYQNQETQLVQMEERNVFCGTYNIRVLSDTFDQNR----IIHYNGGDLMAIS-SNRKIHLLDI--MQTKELPIEFRGHAGSVRAL-FLSE-------------------EDNILLSGSYDLSIRYWDVKTGACVRIFYGHQGTITCLDVYKNRLVSGAKDGQVKEWDIETGKCLKTFKHKDPILAAKISETYIVSSCERGIVKVWHVVTAQLQKTLTGHEGAVKCLFFNEWHLVSGGADGLVMAWSMVGKYERCLMAFKHPKEVLQVSLLYLRVISACGDGKIRIYNFLNGNCLKVIKVDARGDPVLSFFYQGNRWVVGRMVAHTDSNILVFQFENVKWQY 700          
BLAST of F-box/WD repeat-containing protein 10 vs. Ensembl Mouse
Match: Fbxw10 (F-box and WD-40 domain protein 10 [Source:MGI Symbol;Acc:MGI:3052463])

HSP 1 Score: 268.855 bits (686), Expect = 7.234e-77
Identity = 149/434 (34.33%), Postives = 238/434 (54.84%), Query Frame = 2
Query:  692 DFISNLPVHISKRIINFLDEKSLNVCSKVCEIWQQIVYEVRREDIVNAKIKKQAMMLQSQKDESKSVFTAPADPRFARDTNVRVPQLEPHSHRIIYINNSPPHTTNKDTYQIDNFNELELINSRKVFSMDVAYQNILTKKLIIEERNIFCGSYSVMIILESQSRNRDPLRTISYNGGLLVAVSGTNKIIQFLDKRGIQTEIMKNSIRGHAGSIKVVKFLNKHNKKFFGKRTYDSYNNICHEDVEILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATMRHKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVGEFDTCIGNFHHPKSVLSMEFQFLRAVTGCADGKIRIWNILNGHCIRVIRGNSRS 1993
            DFI +LP+H+SK I+  LD+ SLN C  V + W  +  +V+ +  +++ I+ Q  +LQ         +T   DP +A   ++ VP++         +++     +    +++    +  L N         AYQN  T+ + +EERN+FCG+Y++ ++ ++  +NR     I YNGG L+A+S +N+ I  LD   +QT+ +    RGHAGS++ + FL++                   ED  +LSGSYD SIR WD  TG C++I+ GH GTI+ +D  +    SG+ DG  K W  +      T +HK PI A  ISE   VS    G++KVW++      K+L+GH   +  +  + WH++S   D  VM WS VG+++ C+  F HPK VL +   +LR ++ C DGKIRI+N LNG+C++VI+ ++R 
Sbjct:  281 DFIRDLPLHLSKYILRMLDKHSLNRCIFVSQHWATLAQQVKVDQSMHSFIQNQISLLQGS-------YTRGIDPNYANKVSIPVPKI---------VDDGKRSRSKNQKWKLRTKTDYNLWN---------AYQNQETQLVQMEERNVFCGTYNIRVLSDTFDQNR----IIHYNGGDLMAIS-SNRKIHLLDI--MQTKELPIEFRGHAGSVRAL-FLSE-------------------EDNILLSGSYDLSIRYWDVKTGACVRIFYGHQGTITCLDVYKNRLVSGAKDGQVKEWDIETGKCLKTFKHKDPILAAKISETYIVSSCERGIVKVWHVVTAQLQKTLTGHEGAVKCLFFNEWHLVSGGADGLVMAWSMVGKYERCLMAFKHPKEVLQVSLLYLRVISACGDGKIRIYNFLNGNCLKVIKVDARG 662          
BLAST of F-box/WD repeat-containing protein 10 vs. Ensembl Mouse
Match: Fbxw7 (F-box and WD-40 domain protein 7 [Source:MGI Symbol;Acc:MGI:1354695])

HSP 1 Score: 115.546 bits (288), Expect = 9.665e-26
Identity = 75/256 (29.30%), Postives = 120/256 (46.88%), Query Frame = 2
Query: 1283 QTEIMKNSIRGHAGSIKVVKFLNKH---NKKFFGKRTYDSYNNICHEDVEILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATM-RHKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVGEFDTCIGNFH-HPKSVLSMEFQFLRAVTGCADGKIRIWNILNGHCIRVIRGNSRSDPILNLVVKDDTLI 2035
            Q  I  N  RG   S KV+K  + H     +F G R              I+SGS D +++ W   TGKCL+  +GH+G +      + I  SGS D T K+W  +      T+  H   +  + + EK  VSG     ++VW+I+ G  +  L GH   +  ++ D   ++S + D  V +W    E +TC+     H   V S++F  +  V+G  D  IR+W++  G+CI  + G+      + L  KD+ L+
Sbjct:  361 QHRIDTNWRRGELKSPKVLKGHDDHVITCLQFCGNR--------------IVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDP--ETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMEL--KDNILV 598          

HSP 2 Score: 101.293 bits (251), Expect = 2.782e-21
Identity = 56/191 (29.32%), Postives = 98/191 (51.31%), Query Frame = 2
Query: 1424 ILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSF-ATMRHKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVGEFDTCIGNFHHPKSVLS-MEFQFLRAVTGCADGKIRIWNILNGHCIRVIRGNSR 1990
            I+SGS D +++ W+  TG+C+    GH+ T+  +   E+   SGS D T ++W  +        M H   +  V    +  VSG    ++KVW+ +    + +L GH   + +++ D  H++S SLD  + +W    E   CI      +S+ S ME +    V+G AD  ++IW+I  G C++ ++G S+
Sbjct:  437 IISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDV--ETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGPSK 625          

HSP 3 Score: 87.4261 bits (215), Expect = 5.957e-17
Identity = 51/185 (27.57%), Postives = 91/185 (49.19%), Query Frame = 2
Query: 1424 ILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATMR-HKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLW--STVGEFDTCIGNFHHPKSVLSMEFQFLRAVTGCADGKIRIWNILNGHCIR 1969
            ++SGS D ++R WD  TG+CL + +GH   +  +        SG+YD   K+W  + +    T++ H + + ++       VSG     I+VW+++ G  I +L+GH    S + L    ++S + D+ V +W   T     T  G   H  +V  ++F     +T   DG +++W++  G  IR
Sbjct:  477 VVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGPSKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIR 661          

HSP 4 Score: 75.8702 bits (185), Expect = 2.147e-13
Identity = 86/401 (21.45%), Postives = 162/401 (40.40%), Query Frame = 2
Query:  683 FAVDFISNLPVHISKRIINFLDEKSLNVCSKVCEIWQQIVYE--VRREDIVNAKIKKQAMMLQSQKDESKSVFTAPADPRFAR----DTNVRVPQLEPHSHRIIYINNSPPHTTNKDTYQIDNFNELELINSRKVFSMD---VAYQNILTKKLIIEERNIFCGSYSVMI---ILESQSRNRDPLRTISYNGG----LLVAVSGTNKIIQFLDKR-------------GIQTEIMKNSIRGHAGSIKVVKFLNKH---NKKFFGKRTYDSYNNIC---------------HEDVEILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATM----RHKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSL 1732
            F  DFIS LP  ++  +++FL+ K L   ++ C  W+ +  +  + RE      I  + + ++ +K        +P    + R    DTN R  +L+           SP      D + I     L+   +R V   D   +   + +T K +        G +S  +   I+ S S +R  L+  +   G     L   + T + +   +KR              I+T    + + GH  +++ V++  +        F  + +D     C                + + ++SGS DTSIR WD  TG C+    GH    S ++  + I  SG+ D T K+W         T+    +H+  +T +  ++   ++    G +K+W+++ G +I++L
Sbjct:  279 FQRDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLLWREKCKEEGID-EPLHIKRRKIIKPGFIHSPWKSAYIRQHRIDTNWRRGELK-----------SPKVLKGHDDHVI---TCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRDNIIISGSTDR-TLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGPSKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNL 663          
BLAST of F-box/WD repeat-containing protein 10 vs. UniProt/SwissProt
Match: sp|Q5XX13|FBW10_HUMAN (F-box/WD repeat-containing protein 10 OS=Homo sapiens OX=9606 GN=FBXW10 PE=2 SV=2)

HSP 1 Score: 320.087 bits (819), Expect = 2.444e-91
Identity = 170/467 (36.40%), Postives = 258/467 (55.25%), Query Frame = 2
Query:  692 DFISNLPVHISKRIINFLDEKSLNVCSKVCEIWQQIVYEVRREDIVNAKIKKQAMMLQSQKDESKSVFTAPADPRFARDTNVRVPQLEPHSHRIIYINNSPPHTTNKDTYQIDNFNELELINSRKVFSMDVAYQNILTKKLIIEERNIFCGSYSVMIILESQSRNRDPLRTISYNGGLLVAVSGTNKIIQFLDKRGIQTEIMKNSIRGHAGSIKVVKFLNKHNKKFFGKRTYDSYNNICHEDVEILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATMRHKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVGEFDTCIGNFHHPKSVLSMEFQFLRAVTGCADGKIRIWNILNGHCIRVIRGNSRSDPILNLVVKDDTLIINTVSNILVLNFEPIDWMY 2092
            DFI  LP+H+SK I+  LD  +LN C+ V + W  +  +V+ +   +  I+ Q   LQ         +T   DP +A   ++ VP++         +++          +++   NE         +++  AYQN  T++++IEERN+FCG+Y+V I+ ++  +NR     I Y+GG L+AVS +N+ I  LD   IQ + +    RGHAGS++ + FL                   C E+  +LSGSYD SIR WD  +G C +I+ GH GTI+ +D  +    SG  D   K+W  D      T RHK PI A  I++   VS    GL+KVW+I     +K+LSGH   +  +  D WH+LS S D  VM WS VG+++ C+  F HPK VL +   FLR ++ CADGKIRI+N LNG+C++V++ N R DP+L+  ++ + +++NT SN+L+  FE I W Y
Sbjct:  276 DFIRYLPIHLSKYILRMLDRHTLNKCASVSQHWAAMAQQVKMDLSAHGFIQNQITFLQGS-------YTRGIDPNYANKVSIPVPKM---------VDDGKSMRVKHPKWKLRTKNE---------YNLWTAYQNEETQQVLIEERNVFCGTYNVRILSDTWDQNR----VIHYSGGDLIAVS-SNRKIHLLDI--IQVKAIPVEFRGHAGSVRAL-FL-------------------CEEENFLLSGSYDLSIRYWDLKSGVCTRIFGGHQGTITCMDLCKNRLVSGGRDCQVKVWDVDTGKCLKTFRHKDPILATRINDTYIVSSCERGLVKVWHIAMAQLVKTLSGHEGAVKCLFFDQWHLLSGSTDGLVMAWSMVGKYERCLMAFKHPKEVLDVSLLFLRVISACADGKIRIYNFLNGNCMKVLKANGRGDPVLSFFIQGNRMVVNTESNVLMFQFEHIKWQY 690          
BLAST of F-box/WD repeat-containing protein 10 vs. UniProt/SwissProt
Match: sp|Q5SUS0|FBW10_MOUSE (F-box/WD repeat-containing protein 10 OS=Mus musculus OX=10090 GN=Fbxw10 PE=2 SV=1)

HSP 1 Score: 307.375 bits (786), Expect = 5.318e-87
Identity = 164/470 (34.89%), Postives = 264/470 (56.17%), Query Frame = 2
Query:  692 DFISNLPVHISKRIINFLDEKSLNVCSKVCEIWQQIVYEVRREDIVNAKIKKQAMMLQSQKDESKSV---FTAPADPRFARDTNVRVPQLEPHSHRIIYINNSPPHTTNKDTYQIDNFNELELINSRKVFSMDVAYQNILTKKLIIEERNIFCGSYSVMIILESQSRNRDPLRTISYNGGLLVAVSGTNKIIQFLDKRGIQTEIMKNSIRGHAGSIKVVKFLNKHNKKFFGKRTYDSYNNICHEDVEILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATMRHKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVGEFDTCIGNFHHPKSVLSMEFQFLRAVTGCADGKIRIWNILNGHCIRVIRGNSRSDPILNLVVKDDTLIINTVSNILVLNFEPIDWMY 2092
            DFI +LP+H+SK I+  LD+ SLN C  V + W  +  +V+ +  +++ I+ Q  +LQ  K+E ++    +T   DP +A   ++ VP++         +++     +    +++    +  L N         AYQN  T+ + +EERN+FCG+Y++ ++ ++  +NR     I YNGG L+A+S +N+ I  LD   +QT+ +    RGHAGS++ + FL++                   ED  +LSGSYD SIR WD  TG C++I+ GH GTI+ +D  +    SG+ DG  K W  +      T +HK PI A  ISE   VS    G++KVW++      K+L+GH   +  +  + WH++S   D  VM WS VG+++ C+  F HPK VL +   +LR ++ C DGKIRI+N LNG+C++VI+ ++R DP+L+   + + ++ +T SNILV  FE + W Y
Sbjct:  281 DFIRDLPLHLSKYILRMLDKHSLNRCIFVSQHWATLAQQVKVDQSMHSFIQNQISLLQVTKEEKQAYTGSYTRGIDPNYANKVSIPVPKI---------VDDGKRSRSKNQKWKLRTKTDYNLWN---------AYQNQETQLVQMEERNVFCGTYNIRVLSDTFDQNR----IIHYNGGDLMAIS-SNRKIHLLDI--MQTKELPIEFRGHAGSVRAL-FLSE-------------------EDNILLSGSYDLSIRYWDVKTGACVRIFYGHQGTITCLDVYKNRLVSGAKDGQVKEWDIETGKCLKTFKHKDPILAAKISETYIVSSCERGIVKVWHVVTAQLQKTLTGHEGAVKCLFFNEWHLVSGGADGLVMAWSMVGKYERCLMAFKHPKEVLQVSLLYLRVISACGDGKIRIYNFLNGNCLKVIKVDARGDPVLSFFYQGNRMVAHTDSNILVFQFENVKWQY 705          
BLAST of F-box/WD repeat-containing protein 10 vs. UniProt/SwissProt
Match: sp|O95170|CDRT1_HUMAN (CMT1A duplicated region transcript 1 protein OS=Homo sapiens OX=9606 GN=CDRT1 PE=2 SV=3)

HSP 1 Score: 293.123 bits (749), Expect = 5.355e-84
Identity = 160/453 (35.32%), Postives = 246/453 (54.30%), Query Frame = 2
Query:  692 DFISNLPVHISKRIINFLDEKSLNVCSKVCEIWQQIVYEVRREDIVNAKIKKQAMMLQSQKDESKSVFTAPADPRFARDTNVRVPQLEPHSHRIIYINNSPPHTTNKDTYQIDNFNELELINSRKVFSMDVAYQNILTKKLIIEERNIFCGSYSVMIILESQSRNRDPLRTISYNGGLLVAVSGTNKIIQFLDKRGIQTEIMKNSIRGHAGSIKVVKFLNKHNKKFFGKRTYDSYNNICHEDVEILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATMRHKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVGEFDTCIGNFHHPKSVLSMEFQFLRAVTGCADGKIRIWNILNGHCIRVIRGNSRSDPILNLVVKDDTLIINTVS 2050
            DFI  LP+H+SK I+  LD  +LN C+ V + W  +  +V+ +   +  I+ Q   LQ         +T   DP +A   ++ VP++         +++          +++   NE         +++  AYQN  T+++++EERN+FCG+Y+V I+ ++  +NR     I Y+GG L+AVS +N+ I  LD   IQ + +    RGHAGS++ + FL                   C E+  +LSGSYD SIR WD  +G C +I+ GH GTI+ +D  +    SG  D   K+W  D      T RHK PI A  I++   VS    GL+KVW+I     +K+LSGH   +  +  D WH+LS S D  VM WS VG+++ C+  F HPK VL +   FLR ++ CADGKIRI+N  NG+C++VI+ N R DP+L+  ++ + + +  +S
Sbjct:  276 DFIRYLPIHLSKYILRMLDRHTLNKCASVSQHWAAMAQQVKMDLSAHGFIQNQITFLQGS-------YTRGIDPNYANKVSIPVPKM---------VDDGKSMRVKHPKWKLRTKNE---------YNLWTAYQNEETQQVLMEERNVFCGTYNVRILSDTWDQNR----VIHYSGGDLIAVS-SNRKIHLLDI--IQVKAIPVEFRGHAGSVRAL-FL-------------------CEEENFLLSGSYDLSIRYWDLKSGVCTRIFGGHQGTITCMDLCKNRLVSGGRDCQVKVWDVDTGKCLKTFRHKDPILATRINDTYIVSSCERGLVKVWHIAMAQLVKTLSGHEGAVKCLFFDQWHLLSGSTDGLVMAWSMVGKYERCLMAFKHPKEVLDVSLLFLRVISACADGKIRIYNFFNGNCMKVIKANGRGDPVLSFFIQGNRISVCHIS 676          
BLAST of F-box/WD repeat-containing protein 10 vs. UniProt/SwissProt
Match: sp|Q8VBV4|FBXW7_MOUSE (F-box/WD repeat-containing protein 7 OS=Mus musculus OX=10090 GN=Fbxw7 PE=1 SV=2)

HSP 1 Score: 115.546 bits (288), Expect = 6.761e-25
Identity = 75/256 (29.30%), Postives = 120/256 (46.88%), Query Frame = 2
Query: 1283 QTEIMKNSIRGHAGSIKVVKFLNKH---NKKFFGKRTYDSYNNICHEDVEILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATM-RHKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVGEFDTCIGNFH-HPKSVLSMEFQFLRAVTGCADGKIRIWNILNGHCIRVIRGNSRSDPILNLVVKDDTLI 2035
            Q  I  N  RG   S KV+K  + H     +F G R              I+SGS D +++ W   TGKCL+  +GH+G +      + I  SGS D T K+W  +      T+  H   +  + + EK  VSG     ++VW+I+ G  +  L GH   +  ++ D   ++S + D  V +W    E +TC+     H   V S++F  +  V+G  D  IR+W++  G+CI  + G+      + L  KD+ L+
Sbjct:  361 QHRIDTNWRRGELKSPKVLKGHDDHVITCLQFCGNR--------------IVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDP--ETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMEL--KDNILV 598          

HSP 2 Score: 101.293 bits (251), Expect = 1.946e-20
Identity = 56/191 (29.32%), Postives = 98/191 (51.31%), Query Frame = 2
Query: 1424 ILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSF-ATMRHKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVGEFDTCIGNFHHPKSVLS-MEFQFLRAVTGCADGKIRIWNILNGHCIRVIRGNSR 1990
            I+SGS D +++ W+  TG+C+    GH+ T+  +   E+   SGS D T ++W  +        M H   +  V    +  VSG    ++KVW+ +    + +L GH   + +++ D  H++S SLD  + +W    E   CI      +S+ S ME +    V+G AD  ++IW+I  G C++ ++G S+
Sbjct:  437 IISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDV--ETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGPSK 625          

HSP 3 Score: 87.4261 bits (215), Expect = 4.167e-16
Identity = 51/185 (27.57%), Postives = 91/185 (49.19%), Query Frame = 2
Query: 1424 ILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATMR-HKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLW--STVGEFDTCIGNFHHPKSVLSMEFQFLRAVTGCADGKIRIWNILNGHCIR 1969
            ++SGS D ++R WD  TG+CL + +GH   +  +        SG+YD   K+W  + +    T++ H + + ++       VSG     I+VW+++ G  I +L+GH    S + L    ++S + D+ V +W   T     T  G   H  +V  ++F     +T   DG +++W++  G  IR
Sbjct:  477 VVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGPSKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIR 661          

HSP 4 Score: 75.8702 bits (185), Expect = 1.502e-12
Identity = 86/401 (21.45%), Postives = 162/401 (40.40%), Query Frame = 2
Query:  683 FAVDFISNLPVHISKRIINFLDEKSLNVCSKVCEIWQQIVYE--VRREDIVNAKIKKQAMMLQSQKDESKSVFTAPADPRFAR----DTNVRVPQLEPHSHRIIYINNSPPHTTNKDTYQIDNFNELELINSRKVFSMD---VAYQNILTKKLIIEERNIFCGSYSVMI---ILESQSRNRDPLRTISYNGG----LLVAVSGTNKIIQFLDKR-------------GIQTEIMKNSIRGHAGSIKVVKFLNKH---NKKFFGKRTYDSYNNIC---------------HEDVEILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATM----RHKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSL 1732
            F  DFIS LP  ++  +++FL+ K L   ++ C  W+ +  +  + RE      I  + + ++ +K        +P    + R    DTN R  +L+           SP      D + I     L+   +R V   D   +   + +T K +        G +S  +   I+ S S +R  L+  +   G     L   + T + +   +KR              I+T    + + GH  +++ V++  +        F  + +D     C                + + ++SGS DTSIR WD  TG C+    GH    S ++  + I  SG+ D T K+W         T+    +H+  +T +  ++   ++    G +K+W+++ G +I++L
Sbjct:  279 FQRDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLLWREKCKEEGID-EPLHIKRRKIIKPGFIHSPWKSAYIRQHRIDTNWRRGELK-----------SPKVLKGHDDHVI---TCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRDNIIISGSTDR-TLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGPSKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNL 663          
BLAST of F-box/WD repeat-containing protein 10 vs. UniProt/SwissProt
Match: sp|D3Z902|FBXW7_RAT (F-box/WD repeat-containing protein 7 OS=Rattus norvegicus OX=10116 GN=Fbxw7 PE=1 SV=2)

HSP 1 Score: 115.546 bits (288), Expect = 6.826e-25
Identity = 75/256 (29.30%), Postives = 120/256 (46.88%), Query Frame = 2
Query: 1283 QTEIMKNSIRGHAGSIKVVKFLNKH---NKKFFGKRTYDSYNNICHEDVEILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATM-RHKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVGEFDTCIGNFH-HPKSVLSMEFQFLRAVTGCADGKIRIWNILNGHCIRVIRGNSRSDPILNLVVKDDTLI 2035
            Q  I  N  RG   S KV+K  + H     +F G R              I+SGS D +++ W   TGKCL+  +GH+G +      + I  SGS D T K+W  +      T+  H   +  + + EK  VSG     ++VW+I+ G  +  L GH   +  ++ D   ++S + D  V +W    E +TC+     H   V S++F  +  V+G  D  IR+W++  G+CI  + G+      + L  KD+ L+
Sbjct:  364 QHRIDTNWRRGELRSPKVLKGHDDHVITCLQFCGNR--------------IVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDP--ETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMEL--KDNILV 601          

HSP 2 Score: 101.679 bits (252), Expect = 1.620e-20
Identity = 56/191 (29.32%), Postives = 98/191 (51.31%), Query Frame = 2
Query: 1424 ILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSF-ATMRHKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVGEFDTCIGNFHHPKSVLS-MEFQFLRAVTGCADGKIRIWNILNGHCIRVIRGNSR 1990
            I+SGS D +++ W+  TG+C+    GH+ T+  +   E+   SGS D T ++W  +        M H   +  V    +  VSG    ++KVW+ +    + +L GH   + +++ D  H++S SLD  + +W    E   CI      +S+ S ME +    V+G AD  ++IW+I  G C++ ++G S+
Sbjct:  440 IISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDV--ETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGPSK 628          

HSP 3 Score: 87.8113 bits (216), Expect = 3.348e-16
Identity = 51/185 (27.57%), Postives = 91/185 (49.19%), Query Frame = 2
Query: 1424 ILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATMR-HKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWS--TVGEFDTCIGNFHHPKSVLSMEFQFLRAVTGCADGKIRIWNILNGHCIR 1969
            ++SGS D ++R WD  TG+CL + +GH   +  +        SG+YD   K+W  + +    T++ H + + ++       VSG     I+VW+++ G  I +L+GH    S + L    ++S + D+ V +W   T     T  G   H  +V  ++F     +T   DG +++W++  G  IR
Sbjct:  480 VVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGPSKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIR 664          

HSP 4 Score: 73.1738 bits (178), Expect = 1.069e-11
Identity = 42/183 (22.95%), Postives = 86/183 (46.99%), Query Frame = 2
Query: 1196 LRTISYNGGLLVAVSGTNKIIQFLDKRGIQTEIMKNSIRGHAGSIKVVKFLNKHNKKFFGKRTYDSYNNICHEDVEILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATM----RHKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSL 1732
            +R + Y+G  +V+    + +++  D    +TE   ++++GH   +  ++F                      + + ++SGS DTSIR WD  TG C+    GH    S ++  + I  SG+ D T K+W         T+    +H+  +T +  ++   ++    G +K+W+++ G +I++L
Sbjct:  510 VRCVQYDGRRVVS-GAYDFMVKVWDP---ETETCLHTLQGHTNRVYSLQF----------------------DGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGPSKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNL 666          
BLAST of F-box/WD repeat-containing protein 10 vs. TrEMBL
Match: R7TCY2 (WD_REPEATS_REGION domain-containing protein (Fragment) OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_142339 PE=4 SV=1)

HSP 1 Score: 362.844 bits (930), Expect = 1.155e-107
Identity = 191/476 (40.13%), Postives = 279/476 (58.61%), Query Frame = 2
Query:  689 VDFISNLPVHISKRIINFLDEKSLNVCSKVCEIWQQIVYEVRREDIVNAKIKKQAMMLQSQKDESKSVFTAPADPRFARDTNVRVPQLEPHSHRIIYINNSPPHTTNKDTYQIDNFNELELINSRKVFSMDVAYQNILTKKLIIEERNIFCGSYSVMIILESQSRNRDPLRTISYNGGLLVAVSGTNKIIQFLDKRGIQTEIMKNSIRGHAGSIKVVKFLNKHNKKFFGKRTYDSYNNICHEDVEILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATMRHKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVGEFDTCIGNFHHPKSVLSMEFQFLRAVTGCADGKIRIWNILNGHCIRVIRGNSRSDPILNLVVKDDTLIINTVSNILVLNFEPIDWMYENGKDYTL 2116
            VDFI+ LPV +SK +++FL+  +L+ C  V + W+++   V RED VN ++K++ M++Q     +        +P +A+D +V VP +  HS   I  N                  E+  +N +   SM  AY    T+ +I+EERN++CG Y+V+I+    S N DP R I  +G  LV +  T++ ++FL+    + +  + +I GH+GSIK V   +K  +KF                  +LSGSYDTSIR+W   TGKCLKI+ GH  TI+ I    ++ ASGS D TCK+W  D        +HK  +TAV  S+ +C++G + G +KVW++ +G  IK L+GH   ++ IR D WHI++A  D + + WS+ G+   C+  F HPK VL +EF FLR VTG ADGKIRIWN++ G C+R++RGNSRSDPI NLV  D+ + INTV N++V NFEPI +      DYTL
Sbjct:  275 VDFIARLPVQLSKYVLSFLETTTLSNCLCVSQHWRELTEGVLREDAVNQRLKEEIMLMQGTAAHT-------CNPIYAKDIDVAVPNIRLHSWETIRTNE-----------------EVRSLNHKSEASMTNAYAGCSTRNIIMEERNVYCGPYNVLIL----SDNHDPGRVIHTDGSPLVTMGSTDRKVRFLNCETARED--EKAIAGHSGSIKCVALDSK--RKF------------------VLSGSYDTSIRKWSMETGKCLKIFHGHRDTINCIQLHGDMAASGSKDHTCKVWNIDSMECIHMFKHKDAVTAVCFSDDVCITGCAAGKVKVWDMASGKLIKRLTGHQSGVTGIRFDRWHIITAGRDGYALAWSSQGDHARCLNAFRHPKEVLCVEFMFLRVVTGAADGKIRIWNMVTGQCLRIMRGNSRSDPITNLVAIDNRITINTVKNVIVFNFEPITY------DYTL 694          
BLAST of F-box/WD repeat-containing protein 10 vs. TrEMBL
Match: A0A267GEZ8 (WD_REPEATS_REGION domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig026756g1 PE=4 SV=1)

HSP 1 Score: 374.785 bits (961), Expect = 2.655e-106
Identity = 230/706 (32.58%), Postives = 351/706 (49.72%), Query Frame = 2
Query:  689 VDFISNLPVHISKRIINFLDEKSLNVCSKVCEIWQQIVYEVRREDIVNAKIKKQAMMLQSQKDESKSVFTAPADPRFARDTNVRVPQLEPHSHRIIYINNSPPHTTNKDTYQIDNFNELELINSRKVFSMDVAYQNILTKKLIIEERNIFCGSYSVMIILESQSRNRDPLRTISYNGGLLVAVSGTNKIIQFLDKR-GIQTEIMKNSIRGHAGSIKVVKFLNKHNKKFFGKRTYDSYNNICHEDVEILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATMRHKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVGEFDTCIGNFHHPKSVLSMEFQFLRAVTGCADGKIRIWNILNGHCIRVIRGNSRSDPILNLVVKDDTLIINTVSNILVLNFEPIDWMYENGKDYTLNQPSCSLSLPENKKSQIKRNNFR---HISQRCERSRLAGNIDPRIFITPNTEG-------LEMNSKCLLSNQEFSYARSFENGNPMTRSTAWHVSPSFYKSQNHSMKPPLHKS-----------KDLVDSVEDNKFTTESRINLVKXXXXX-----XXXXXXXYGFERQDHLLI-DSDLQEIKQTLRNHIRSPPQIAAEAMPEFIKTMVSQLKTSNLTGRSVSAFSLNR 2722
            VDFI  LPVH+SK I+N LD+KS    + V   W  +V EV +E  +N +IK++ M+LQ              +PR+A D +V VP  E  SH++       P T  +D       NE          + +  Y+ + T+ +I+EERN++CG Y+V+++   +    DP R   Y+GG L+A S  N+ I F D R G         +RGHAG ++ +                     +C     +LSGSYDTS+RRWD  TGKC KIY GH GT+  +D       SGS DG+ K+W  ++  +  T++HK  ++AVAI+E   V+GD+ G +KVW++ NG  +K L GH  E++AI+ D WHIL+ S D++ +LWS +G    C+G   HPK +L  EFQF+RA+T   DG++RIWN+++ +C R++RGNSRSDPILN+      +++NT +N+L L FE ++W      DY+L   S     P  + S  +    R   H   R +R +LAG  D RI     T G       +   S      ++ S + +   G   + +     +P     ++   +P  H+             + V   E+ + TT  +         S        RR+S+ FE     +  D  L E+K+ LR  +R+P        P+F++ +   L  +    R+ S   L R
Sbjct:  440 VDFIRQLPVHLSKYIVNLLDDKSAKQAAAVSTYWSNVVDEVSKESGMNLQIKEEVMLLQG-------TLANTVNPRYASDLDVPVPNQERGSHKVRLTGE--PLTDQRDPNGHLFKNEC---------NFEAGYRGVSTRNVIMEERNVYCGPYNVLVLFSEE----DPQRVTHYSGGNLLAYSDNNRRIHFADVRTGATPAAGTQPLRGHAGPVRCLL--------------------LCEARGFLLSGSYDTSLRRWDIATGKCAKIYRGHMGTVLAVDIYLNTIVSGSADGSAKVWNLEDWKAVRTLKHKSAVSAVAINENTAVTGDAKGKVKVWDLVNGSLVKKLIGHSAEVTAIKCDHWHILTCSKDSYALLWSAIGNHAQCLGAHRHPKPILCAEFQFMRAITASEDGRVRIWNVVSRNCCRIMRGNSRSDPILNISAVGQKILVNTKTNVLALTFESVNW------DYSLETDSMP---PLIRYSSYRDAPVRWQPHGYIRAQRLQLAGAADSRIVWRHETRGRGVGETDMTDGSAAPAGMRQLSLSLASRGGVGKSPTAPGSAAPPSGLFESRVPQPKHHRQCRTASGRRSQMGEAVAGNENQQPTTPGKPTTAGKPTRSLVDQGVGERRLSWAFEHPPRPVTKDPGLAEMKRRLRAQLRAP----GADPPDFVRQLRRALHAAGERPRTESDRELRR 1090          
BLAST of F-box/WD repeat-containing protein 10 vs. TrEMBL
Match: A0A267GFD1 (WD_REPEATS_REGION domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig033301g1 PE=4 SV=1)

HSP 1 Score: 374.015 bits (959), Expect = 6.622e-106
Identity = 229/706 (32.44%), Postives = 351/706 (49.72%), Query Frame = 2
Query:  689 VDFISNLPVHISKRIINFLDEKSLNVCSKVCEIWQQIVYEVRREDIVNAKIKKQAMMLQSQKDESKSVFTAPADPRFARDTNVRVPQLEPHSHRIIYINNSPPHTTNKDTYQIDNFNELELINSRKVFSMDVAYQNILTKKLIIEERNIFCGSYSVMIILESQSRNRDPLRTISYNGGLLVAVSGTNKIIQFLDKR-GIQTEIMKNSIRGHAGSIKVVKFLNKHNKKFFGKRTYDSYNNICHEDVEILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATMRHKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVGEFDTCIGNFHHPKSVLSMEFQFLRAVTGCADGKIRIWNILNGHCIRVIRGNSRSDPILNLVVKDDTLIINTVSNILVLNFEPIDWMYENGKDYTLNQPSCSLSLPENKKSQIKRNNFR---HISQRCERSRLAGNIDPRIFITPNTEG-------LEMNSKCLLSNQEFSYARSFENGNPMTRSTAWHVSPSFYKSQNHSMKPPLHKS-----------KDLVDSVEDNKFTTESRINLVKXXXXX-----XXXXXXXYGFERQDHLLI-DSDLQEIKQTLRNHIRSPPQIAAEAMPEFIKTMVSQLKTSNLTGRSVSAFSLNR 2722
            VDFI  LPVH+SK I+N LD+KS    + V   W  +V EV +E  +N +IK++ M+LQ              +PR+A D +V VP  E  SH++       P +  +D       NE          + +  Y+ + T+ +I+EERN++CG Y+V+++   +    DP R   Y+GG L+A S  N+ I F D R G         +RGHAG ++ +                     +C     +LSGSYDTS+RRWD  TGKC KIY GH GT+  +D       SGS DG+ K+W  ++  +  T++HK  ++AVAI+E   V+GD+ G +KVW++ NG  +K L GH  E++AI+ D WHIL+ S D++ +LWS +G    C+G   HPK +L  EFQF+RA+T   DG++RIWN+++ +C R++RGNSRSDPILN+      +++NT +N+L L FE ++W      DY+L   S     P  + S  +    R   H   R +R +LAG  D RI     T G       +   S      ++ S + +   G   + +     +P     ++   +P  H+             + V   E+ + TT  +         S        RR+S+ FE     +  D  L E+K+ LR  +R+P        P+F++ +   L  +    R+ S   L R
Sbjct:  441 VDFIRQLPVHLSKYIVNLLDDKSAKQAAAVSTYWSNVVDEVSKESGMNLQIKEEVMLLQG-------TLANTVNPRYASDLDVPVPNQERGSHKVRLTGE--PLSDQRDPNGHLFKNEC---------NFEAGYRGVSTRNVIMEERNVYCGPYNVLVLFSEE----DPQRVTHYSGGNLLAYSDNNRRIHFADVRTGATPAAGTQPLRGHAGPVRCLL--------------------LCEARGFLLSGSYDTSLRRWDIATGKCAKIYRGHMGTVLAVDIYLNTIVSGSADGSAKVWNLEDWKAVRTLKHKSAVSAVAINENTAVTGDAKGKVKVWDLVNGSLVKKLIGHSAEVTAIKCDHWHILTCSKDSYALLWSAIGNHAQCLGALRHPKPILCAEFQFMRAITASEDGRVRIWNVVSRNCCRIMRGNSRSDPILNISAVGQKILVNTKTNVLALTFESVNW------DYSLETDSMP---PLIRYSSYRDAPVRWQPHGYIRAQRLQLAGAADSRIVWRHETRGRGVGETDMTDGSAAPAGMRQLSLSLASRGGVGKSPTAPGSAAPPSGLFESRVPQPKHHRQCRTASGRRSQVGEAVAGNENQQPTTPGKPTTAGKLTRSLVDQGVGERRLSWAFEHPPRPVTKDPGLAEMKRRLRAQLRAP----GADPPDFVRQLRRALHAAEERPRTESDRELRR 1091          
BLAST of F-box/WD repeat-containing protein 10 vs. TrEMBL
Match: A0A267GET0 (WD_REPEATS_REGION domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig030229g1 PE=4 SV=1)

HSP 1 Score: 373.629 bits (958), Expect = 7.295e-106
Identity = 229/706 (32.44%), Postives = 350/706 (49.58%), Query Frame = 2
Query:  689 VDFISNLPVHISKRIINFLDEKSLNVCSKVCEIWQQIVYEVRREDIVNAKIKKQAMMLQSQKDESKSVFTAPADPRFARDTNVRVPQLEPHSHRIIYINNSPPHTTNKDTYQIDNFNELELINSRKVFSMDVAYQNILTKKLIIEERNIFCGSYSVMIILESQSRNRDPLRTISYNGGLLVAVSGTNKIIQFLDKR-GIQTEIMKNSIRGHAGSIKVVKFLNKHNKKFFGKRTYDSYNNICHEDVEILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATMRHKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVGEFDTCIGNFHHPKSVLSMEFQFLRAVTGCADGKIRIWNILNGHCIRVIRGNSRSDPILNLVVKDDTLIINTVSNILVLNFEPIDWMYENGKDYTLNQPSCSLSLPENKKSQIKRNNFR---HISQRCERSRLAGNIDPRIFITPNTEG-------LEMNSKCLLSNQEFSYARSFENGNPMTRSTAWHVSPSFYKSQNHSMKPPLHKS-----------KDLVDSVEDNKFTTESRINLVKXXXXX-----XXXXXXXYGFERQDHLLI-DSDLQEIKQTLRNHIRSPPQIAAEAMPEFIKTMVSQLKTSNLTGRSVSAFSLNR 2722
            VDFI  LPVH+SK I+N LD+KS    + V   W  +V EV +E  +N +IK++ M+LQ              +PR+A D +V VP  E  SH++       P +  +D       NE          + +  Y+ + T+ +I+EERN++CG Y+V+++   +    DP R   Y+GG L+A S  N+ I F D R G         +RGHAG ++ +                     +C     +LSGSYDTS+RRWD  TGKC KIY GH GT+  +D       SGS DG+ K+W  ++  +  T++HK  ++AVAI+E   V+GD+ G +KVW++ NG  +K L GH  E++AI+ D WHIL+ S D++ +LWS +G    C+G   HPK +L  EFQF+RA+T   DG++RIWN+++ +C R++RGNSRSDPILN+      +++NT +N+L L FE ++W      DY+L   S     P  + S  +    R   H   R +R +LAG  D RI     T G       +   S      ++ S + +   G   + +     +P     ++   +P  H+             + V   E+ + TT  +         S        RR+S+ FE        D  L E+K+ LR  +R+P        P+F++ +   L  +    R+ S   L R
Sbjct:  440 VDFIRQLPVHLSKYIVNLLDDKSAKQAAAVSTYWSNVVDEVSKESGMNLQIKEEVMLLQG-------TLANTVNPRYASDLDVPVPNQERGSHKVRLTGE--PLSDQRDPKGHLFKNEC---------NFEAGYRGVSTRNVIMEERNVYCGPYNVLVLFSEE----DPQRVTHYSGGNLLAYSDNNRRIHFADVRTGATPAAGTQPLRGHAGPVRCLL--------------------LCEARGFLLSGSYDTSLRRWDIATGKCAKIYRGHMGTVLAVDIYLNTIVSGSADGSAKVWNLEDWKAVRTLKHKSAVSAVAINENTAVTGDAKGKVKVWDLVNGSLVKKLIGHSAEVTAIKCDHWHILTCSKDSYALLWSAIGNHAQCLGALRHPKPILCAEFQFMRAITASEDGRVRIWNVVSRNCCRIMRGNSRSDPILNISAVGQKILVNTKTNVLALTFESVNW------DYSLETDSMP---PLIRYSSYRDAPVRWQPHGYIRAQRLQLAGAADSRIVWRHETRGRGVGETDMTDGSAAPAGMRQLSLSLASRGGVGKSPTAPGSAAPPSGLFESRVPQPKHHRQCRTASGRRSQMGEAVAGNENQQPTTPGKPTTAGKPTRSLVDQGVGERRLSWAFEHPPRPATKDPGLAEMKRRLRAQLRAP----GADPPDFVRQLRRALHAAEERPRTESDRELRR 1090          
BLAST of F-box/WD repeat-containing protein 10 vs. TrEMBL
Match: A0A2C9MA43 (WD_REPEATS_REGION domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106069137 PE=4 SV=1)

HSP 1 Score: 368.622 bits (945), Expect = 6.652e-105
Identity = 247/790 (31.27%), Postives = 380/790 (48.10%), Query Frame = 2
Query:  110 CKENPNPNPCQNCITCKLV-ILKDFSVSLLNHMPDNDVINFITKCSKTESYTELTGVLQHILYPLKAKDRLYSLSRNVPSLNTDLSDFSIKNFTIDKAQLEYVTHRISNWISLQPDTFRIQFIISLL----AHL--------KLAVLSEIYNAISTNKDSSTDSSYTSNEI-INTDSDPVTLLQRVCKISANHIFED---------------------KHSEKNNNFAV----------------------DFISNLPVHISKRIINFLDEKSLNVCSKVCEIWQQIVYEVRREDIVNAKIKKQAMMLQSQKDESKSVFTAPADPRFARDTNVRVPQLEPHSHRIIYINNSPPHTTNKDTYQIDNFNELELINSRKVFSMDVAYQNILTKKLIIEERNIFCGSYSVMIILESQSRNRDPLRTISYNGGLLVAVSGTNKIIQFLDKRGIQTEIMKNSIRGHAGSIKVVKFLNKHNKKFFGKRTYDSYNNICHEDVEILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATMRHKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVGEFDTCIGNFHHPKSVLSMEFQFLRAVTGCADGKIRIWNILNGHCIRVIRGNSRSDPILNLVVKDDTLIINTVSNILVLNFEPIDWMYENGKDYTLNQPSCS--LSLPENKKSQIKRNNFRHISQRCERSRLAGNIDPRIFITPNTEGLEMNSKCLLSNQ 2302
            CK +     C  C TC L   L++      +   D+    F+    +     +L   L  +L P+  KD  Y+ +R  PSL TD +  S  +  +    +EYVT     W S      ++ F++S+     AHL        K  + SE+  A +T  D    +S  S+E  +NT+  P   L  + +   + I ED                      HS   ++                         DFI  LPVHI+K I++ LD  SL     V   W+++  EV+ E  VN +I+++ +++Q             A+P +A D +V VP ++P S+ +I  +     TT K                    S +  Y  + TKK+I+EERNI+CG+Y+VM++ +    N D  R +  +G  L+AV   ++ ++F+D  G   E     I GHAGSI+    L    K                    +LSGSYDTS+R W   TG+CLKI  GH  T++ I    +I A+G+ D  CK+W  +      T +H  P+ AVA+SE++C+SG   G +KVW + +G  IK+LSGH   I+ I+ D WHI++ S D + + WS +G    C+    HPK VL +EF +LR +TG ADG+IRIWN++ G C R++RGNSRSDPIL +V   D + +NT++N+LV+NFE ++W      DYTL        +       + ++   + +I  R +R R AG  + +I I  ++   E+N++ LL NQ
Sbjct:   61 CKSSTAFTDCGECETCLLANKLRELH-GWFHRFGDHSKKRFMLGLLRRTKSVDLLRNLVMLLQPVLNKDGTYARARTHPSLPTDSATLS-SDRAVKVDNVEYVTSSTWEWFSHSTYWTKMNFLLSMCQRCDAHLLYQLFMQAKTLLASELNIAEATEGDCCETASIKSSEYSVNTEERPDLELLSLARPDYSQIIEDPFTGEILLDKIKTCQNDAANEAHSTTASSVNTVDPLILIIPTSAKAYSGVSAHRDFIRCLPVHIAKVILSMLDMASLYNALCVSPNWRKLAEEVKHEFSVNQQIREEVLLMQGASAHG-------ANPVYANDIDVLVPNIDPGSNEVIPSSGDVIKTTFKSE-----------------MSFETGYSGVSTKKVIMEERNIYCGAYNVMVVDD----NEDANRVMHTDGSHLIAVGSKDRKVRFIDC-GTGKE-SGPVIIGHAGSIRCCYLLQDQGK--------------------VLSGSYDTSVRCWSIETGQCLKILRGHQDTVTVIAVLGDIVATGAKDNQCKIWSLESGKCRKTFKHHAPVMAVALSEEICISGCEAGKVKVWELASGNLIKTLSGHHGPITGIKFDRWHIVTGSKDGYALGWSAIGSHSRCLAALRHPKEVLCLEFVYLRVITGSADGRIRIWNLITGQCCRIMRGNSRSDPILAMVAIGDRITVNTLNNLLVMNFEKVNW------DYTLKTDHVPPLIQYGSYSDAPVRTQPYPYI--RAQRMRKAGAANSKI-INHDSSPQELNTQVLLQNQ 789          
BLAST of F-box/WD repeat-containing protein 10 vs. Ensembl Cavefish
Match: fbxw10 (CMT1A duplicated region transcript 1 protein [Source:NCBI gene;Acc:103023686])

HSP 1 Score: 287.345 bits (734), Expect = 1.226e-80
Identity = 178/555 (32.07%), Postives = 271/555 (48.83%), Query Frame = 2
Query:  515 EIYNAISTNKDSSTDSSYTSNEIINTDSDPVTLLQRVCKISANHIFEDKHSEKNNNFAVDFISNLPVHISKRIINFLDEKSLNVCSKVCEIWQQIVYEVRREDIVNAKIKKQAMMLQSQKDESKSVFTAPADPRFARDTNVRVPQLEPHSHRIIYINNSPPHTTNKDTYQIDNFNELELINSRKVFSMDVAYQNILTKKLIIEERNIFCGSYSVMIILESQSRNRDPLRTISYNGGLLVAVSGTNKIIQFLDKRGIQTEIMKNSIRGHAGSIKVVKFLNKHNKKFFGKRTYDSYNNICHEDVEILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATMR--HKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVGEFDTCIGNFHHPKSVLSMEFQFLRAVTGCADGKIRIWNILNGHCIRVIRGNSRSDPILNLVVKDDTLIINTVSNILVLNFEPIDWMYENGKD----YTLNQPSCSLSLPENKKS 2161
            EI       +DS TDS        N+  DP  ++          +     S    +   DFI  LPV ISKRI+  LD+ +L  C +V + W  +  EV  E  V   ++K+AM LQ          T+  +P +AR   V VP  E                   DT+ I         + ++V  ++  Y  + TK + +EERN+FCG ++++I+L+ +    DP R I Y+GG +VAV   ++ ++ LD   I+   +   ++GHAGS++ V                     IC E   I+S SYD SIR W+  TG+C  +  GH GTI+ +D  E++  SG+ D   K+W       +  ++  H+ P+  V IS  L +S    GL+KVW  +    +K ++GH   +  +  D WHILS   D  V+ WST   F   +  FHHPK VL++ F FLR +TGC DGKIRI+N L+G C+R+I+ ++   P+L++   D+ +++N+ S +L+L F    W Y  G        L+ P  S   PE K S
Sbjct:  250 EITYIAQKRQDSDTDS--------NSSEDPALMV----------VPGSSKSMSGVSLHRDFIGGLPVDISKRILGLLDKATLQHCKRVSQHWCYLTEEVLGEMEVKKMVEKEAMNLQGSS-------TSGVNPVYARIRKVLVPLGE----------------EEDDTHPIKTGPS----SIKEVGCLESVYTGVKTKAVELEERNVFCGDFNILILLDRE----DPSRVIHYSGGQMVAVGSKDRAVRLLDVTQIKEVPLL--MQGHAGSVRAVL--------------------ICEERGLIISASYDLSIRCWNLKTGECTMLLSGHMGTITCLDLHEDLLVSGARDCRVKVWSLQSGQCYEKLKMGHRKPVLCVKISASLVLSSCEEGLVKVWETETADLLKIITGHQGYVKCLFFDQWHILSGGADGQVLAWSTKTHFTNSLMTFHHPKEVLTLSFLFLRVITGCLDGKIRIFNFLSGDCLRIIKISTHQSPVLSIHTHDNRIVVNSSSRVLLLQFTEQRWDYSAGPKRRSWAALHPPPHSNLHPEPKSS 733          
BLAST of F-box/WD repeat-containing protein 10 vs. Ensembl Cavefish
Match: fbxw10 (CMT1A duplicated region transcript 1 protein [Source:NCBI gene;Acc:103023686])

HSP 1 Score: 209.92 bits (533), Expect = 1.308e-55
Identity = 132/449 (29.40%), Postives = 209/449 (46.55%), Query Frame = 2
Query:  710 PVHISKRIIN--FLDEKSLNVCSKVCEIWQQIVYEVRREDIVNAKIKKQAMMLQSQKDESKSVFTAPADPRFARDTNVRVPQLEPHSHRIIYINNSPPHTTNKDTYQIDNFNELELINSRKVFSMDVAYQNILTKKLIIEERNIFCGSYSV-MIILESQSRNRDPLRTISYNGGLLVAVSGTNKIIQFLDKRGIQTEIMKNSIRGHAGSIKVVKFLNKHNKKFFGKRTYDSYNNICHEDVEILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATMR--HKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVGEFDTCIGNFHHPKSVLSMEFQFLRAVTGCADGKIRIWNILNGHCIRVIRGNSRSDPILNLVVKDDTLIIN 2041
            P HI   +++   LD+ +L  C +V + W  +  EV  E  V   ++K+AM L                 R A D +      E + + +++I+N                                           ++ER    GS++  M+I+  +    DP R I Y+GG +VAV   ++ ++ LD   I+   +   ++GHAGS++ V                     IC E   I+S SYD SIR W+  TG+C  +  GH GTI+ +D  E++  SG+ D   K+W       +  ++  H+ P+  V IS  L +S    GL+KVW  +    +K ++GH   +  +  D WHILS   D  V+ WST   F   +  FHHPK VL++ F FLR +TGC DGKIRI+N L+G C+R+I+ ++   P+L++   D+ L+  
Sbjct:  196 PTHIHNNVLSPGLLDKATLQHCKRVSQHWCYLTEEVLGEMEVKKMVEKEAMNLD-------------GGSRMAPDGHTGEQLAELNCNAVLWISNC------------------------------------------VDERKSAAGSFNPEMMIMPCRE---DPSRVIHYSGGQMVAVGSKDRAVRLLDVTQIKEVPLL--MQGHAGSVRAVL--------------------ICEERGLIISASYDLSIRCWNLKTGECTMLLSGHMGTITCLDLHEDLLVSGARDCRVKVWSLQSGQCYEKLKMGHRKPVLCVKISASLVLSSCEEGLVKVWETETADLLKIITGHQGYVKCLFFDQWHILSGGADGQVLAWSTKTHFTNSLMTFHHPKEVLTLSFLFLRVITGCLDGKIRIFNFLSGDCLRIIKISTHQSPVLSIHTHDNRLVFT 564          
BLAST of F-box/WD repeat-containing protein 10 vs. Ensembl Cavefish
Match: fbxw7 (F-box and WD repeat domain containing 7 [Source:NCBI gene;Acc:103046885])

HSP 1 Score: 113.62 bits (283), Expect = 1.310e-25
Identity = 75/256 (29.30%), Postives = 121/256 (47.27%), Query Frame = 2
Query: 1283 QTEIMKNSIRGHAGSIKVVKFLNKH---NKKFFGKRTYDSYNNICHEDVEILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATM-RHKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVGEFDTCIGNFH-HPKSVLSMEFQFLRAVTGCADGKIRIWNILNGHCIRVIRGNSRSDPILNLVVKDDTLI 2035
            Q  I  N  RG   S KV+K  + H     +F G R              I+SGS D +++ W   TGKCL+  +GH+G +      + I  SGS D T K+W  +  +   T+  H   +  + + EK  VSG     ++VW+I+ G  +  L GH   +  ++ D   ++S + D  V +W    E +TC+     H   V S++F  +  V+G  D  IR+W++  G+CI  + G+      + L  KD+ L+
Sbjct:  199 QHRIDTNWRRGDLKSPKVLKGHDDHVITCLQFCGNR--------------IVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRDNIIISGSTDRTLKVWNAETGDCIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDP--ETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMEL--KDNILV 436          

HSP 2 Score: 97.0561 bits (240), Expect = 2.725e-20
Identity = 55/188 (29.26%), Postives = 95/188 (50.53%), Query Frame = 2
Query: 1424 ILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSF-ATMRHKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVGEFDTCIGNFHHPKSVLS-MEFQFLRAVTGCADGKIRIWNILNGHCIRVIRG 1981
            I+SGS D +++ W+  TG C+    GH+ T+  +   E+   SGS D T ++W  +        M H   +  V    +  VSG    ++KVW+ +    + +L GH   + +++ D  H++S SLD  + +W    E   CI      +S+ S ME +    V+G AD  ++IW+I  G C++ ++G
Sbjct:  275 IISGSTDRTLKVWNAETGDCIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDV--ETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQG 460          

HSP 3 Score: 89.7373 bits (221), Expect = 6.112e-18
Identity = 101/483 (20.91%), Postives = 192/483 (39.75%), Query Frame = 2
Query:  680 NFAVDFISNLPVHISKRIINFLDEKSLNVCSKVCEIWQQIVYEVRREDIVNAKIKKQAMMLQSQKDESKSVFTAPADPRFARDTNVRVPQLEPHSHRIIYINNSPPHTTNKDTYQIDNFNELELINSRKVFSMDVAYQNILTKKLIIEERNIFCGSYSVMIILESQSRNRDPLRTISYNGGLLVAVSGTNKIIQFLDKRGI-----QTEIMKNSIRGHAGSIKVVKFLNKHNKKFFGKRTYDSYNNICHEDVEILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATMR-HKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLW--STVGEFDTCIGNFHHPKSVLSMEFQFLRAVTGCADGKIRIWNILNGHCIR--VIRGNSRSDPILNLVVKDDTLIINTV--------SNILVLNFE 2074
             F  DFIS LP  ++  +++FL+ K L   ++ C  W               +I  +  +L  +K   + +     +P   +   V  P       +  YI            ++ID       + S KV      + + +   L      I  GS    + + S    +     + + GG+  +    N II     R +     +T    +++ GH  +++ +     H K+                   ++SGS D ++R WD  TG+CL + +GH   +  +        SG+YD   K+W  + +    T++ H + + ++       VSG     I+VW+++ G  I +L+GH    S + L    ++S + D+ V +W   T     T  G   H  +V  ++F     +T   DG +++W++  G  IR  V   +  S  ++  +   +T ++  V        + +LVL+F+
Sbjct:  116 QFQRDFISLLPKELALYVLSFLEPKDLLQAAQTCRYW---------------RILAEDNLLWREKCREEGI----DEPLHGKRRKVVKPGFSHSPWKSAYIRQ----------HRIDTNWRRGDLKSPKVLK---GHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRDNIIISGSTDRTLKVWNAETGDCIHTLYGHTSTVRCMHL---HEKR-------------------VVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGPHKHQSAVTCLQFNKNFVITSSDDGTVKLWDLRTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFD 544          

HSP 4 Score: 60.8474 bits (146), Expect = 5.517e-9
Identity = 42/169 (24.85%), Postives = 77/169 (45.56%), Query Frame = 2
Query: 1580 WRYDEKNSFATMR--HKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVGEFDTCIGNFH-HPKSVLSMEFQFLRAVTGCADGKIRIWNILNGHCIRVIRGNSRSDPILNLVVKDDTLIINTVSNILVLNFEP 2077
            WR  +  S   ++    H IT +       VSG     +KVW+   G  +++L GH   + + ++    I+S S D  + +W+   E   CI   + H  +V  M     R V+G  D  +R+W+I  G C+ V+ G+  +   +  V  D   +++   + +V  ++P
Sbjct:  206 WRRGDLKSPKVLKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRDNIIISGSTDRTLKVWN--AETGDCIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGHVAA---VRCVQYDGRRVVSGAYDFMVKVWDP 369          
BLAST of F-box/WD repeat-containing protein 10 vs. Ensembl Cavefish
Match: fbxw7 (F-box and WD repeat domain containing 7 [Source:NCBI gene;Acc:103046885])

HSP 1 Score: 114.775 bits (286), Expect = 1.720e-25
Identity = 75/256 (29.30%), Postives = 121/256 (47.27%), Query Frame = 2
Query: 1283 QTEIMKNSIRGHAGSIKVVKFLNKH---NKKFFGKRTYDSYNNICHEDVEILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATM-RHKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVGEFDTCIGNFH-HPKSVLSMEFQFLRAVTGCADGKIRIWNILNGHCIRVIRGNSRSDPILNLVVKDDTLI 2035
            Q  I  N  RG   S KV+K  + H     +F G R              I+SGS D +++ W   TGKCL+  +GH+G +      + I  SGS D T K+W  +  +   T+  H   +  + + EK  VSG     ++VW+I+ G  +  L GH   +  ++ D   ++S + D  V +W    E +TC+     H   V S++F  +  V+G  D  IR+W++  G+CI  + G+      + L  KD+ L+
Sbjct:  441 QHRIDTNWRRGDLKSPKVLKGHDDHVITCLQFCGNR--------------IVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRDNIIISGSTDRTLKVWNAETGDCIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDP--ETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMEL--KDNILV 678          

HSP 2 Score: 97.8265 bits (242), Expect = 2.854e-20
Identity = 55/188 (29.26%), Postives = 95/188 (50.53%), Query Frame = 2
Query: 1424 ILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSF-ATMRHKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVGEFDTCIGNFHHPKSVLS-MEFQFLRAVTGCADGKIRIWNILNGHCIRVIRG 1981
            I+SGS D +++ W+  TG C+    GH+ T+  +   E+   SGS D T ++W  +        M H   +  V    +  VSG    ++KVW+ +    + +L GH   + +++ D  H++S SLD  + +W    E   CI      +S+ S ME +    V+G AD  ++IW+I  G C++ ++G
Sbjct:  517 IISGSTDRTLKVWNAETGDCIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDV--ETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQG 702          

HSP 3 Score: 90.8929 bits (224), Expect = 4.605e-18
Identity = 101/483 (20.91%), Postives = 192/483 (39.75%), Query Frame = 2
Query:  680 NFAVDFISNLPVHISKRIINFLDEKSLNVCSKVCEIWQQIVYEVRREDIVNAKIKKQAMMLQSQKDESKSVFTAPADPRFARDTNVRVPQLEPHSHRIIYINNSPPHTTNKDTYQIDNFNELELINSRKVFSMDVAYQNILTKKLIIEERNIFCGSYSVMIILESQSRNRDPLRTISYNGGLLVAVSGTNKIIQFLDKRGI-----QTEIMKNSIRGHAGSIKVVKFLNKHNKKFFGKRTYDSYNNICHEDVEILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATMR-HKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWS--TVGEFDTCIGNFHHPKSVLSMEFQFLRAVTGCADGKIRIWNILNGHCIR--VIRGNSRSDPILNLVVKDDTLIINTV--------SNILVLNFE 2074
             F  DFIS LP  ++  +++FL+ K L   ++ C  W               +I  +  +L  +K   + +     +P   +   V  P       +  YI            ++ID       + S KV      + + +   L      I  GS    + + S    +     + + GG+  +    N II     R +     +T    +++ GH  +++ +     H K+                   ++SGS D ++R WD  TG+CL + +GH   +  +        SG+YD   K+W  + +    T++ H + + ++       VSG     I+VW+++ G  I +L+GH    S + L    ++S + D+ V +W   T     T  G   H  +V  ++F     +T   DG +++W++  G  IR  V   +  S  ++  +   +T ++  V        + +LVL+F+
Sbjct:  358 QFQRDFISLLPKELALYVLSFLEPKDLLQAAQTCRYW---------------RILAEDNLLWREKCREEGI----DEPLHGKRRKVVKPGFSHSPWKSAYIRQ----------HRIDTNWRRGDLKSPKVLK---GHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRDNIIISGSTDRTLKVWNAETGDCIHTLYGHTSTVRCMHL---HEKR-------------------VVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGPHKHQSAVTCLQFNKNFVITSSDDGTVKLWDLRTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFD 786          

HSP 4 Score: 61.2326 bits (147), Expect = 5.286e-9
Identity = 42/169 (24.85%), Postives = 77/169 (45.56%), Query Frame = 2
Query: 1580 WRYDEKNSFATMR--HKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVGEFDTCIGNFH-HPKSVLSMEFQFLRAVTGCADGKIRIWNILNGHCIRVIRGNSRSDPILNLVVKDDTLIINTVSNILVLNFEP 2077
            WR  +  S   ++    H IT +       VSG     +KVW+   G  +++L GH   + + ++    I+S S D  + +W+   E   CI   + H  +V  M     R V+G  D  +R+W+I  G C+ V+ G+  +   +  V  D   +++   + +V  ++P
Sbjct:  448 WRRGDLKSPKVLKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRDNIIISGSTDRTLKVWNA--ETGDCIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGHVAA---VRCVQYDGRRVVSGAYDFMVKVWDP 611          
BLAST of F-box/WD repeat-containing protein 10 vs. Ensembl Cavefish
Match: fbxw11b (F-box/WD repeat-containing protein 11-like [Source:NCBI gene;Acc:103029337])

HSP 1 Score: 97.8265 bits (242), Expect = 1.511e-20
Identity = 62/219 (28.31%), Postives = 111/219 (50.68%), Query Frame = 2
Query: 1349 NKHNKKFFGKRTYDSYNNIC--HEDVEILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATM-RHKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYI---KSLSGHFKEISAIRLDSWHILSASLDNFVMLWST-VGEFDTCIGNFHHPKSVLSMEFQFLRAVTGCADGKIRIWNILNGHCIRVIRGN 1984
             +HN +    R+ +S    C  ++D +I+SG  D SI+ WD  + +CLKI  GH+G++  +   E +  +GS D T ++W  +      T+  H   +  +     L V+      I VW++ +   I   + L GH   ++ +  D  +I+SAS D  + +WST   EF   +    H + +  ++++    V+G +D  IR+W+I  G C+RV+ G+
Sbjct:  217 GRHNLQRIQCRSENSKGVYCLQYDDDKIISGLRDNSIKIWDKQSLECLKILTGHTGSVLCLQYDERVIVTGSSDSTVRVWDVNSGEVLNTLIHHNEAVLHLRFCNGLMVTCSKDRSIAVWDMASPTDISLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWSTSTCEFVRTLNG--HKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGH 433          

HSP 2 Score: 80.4925 bits (197), Expect = 4.513e-15
Identity = 64/258 (24.81%), Postives = 113/258 (43.80%), Query Frame = 2
Query: 1223 LLVAVSGTNKIIQFLDKRGIQTEIMKNSIR-GHAGSIKVVKFLNKHNKKFFGKRTYDSYNNICHEDVEI----LSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATMR-HKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVGEFDT-------CIGNF-HHPKSVLSMEFQFLRAVTGCADGKIRIWNILN 1954
            +L   +G+   +Q+ D+R I T    +++R     S +V+  L  HN+     R  +     C +D  I    ++   D S+RR          + +GH   ++ +D  ++   S S D T K+W         T+  HK  I  +   ++L VSG S   I++W+I+ G  ++ L GH + +  IR D+  I+S + D  + +W      D        C+     H   V  ++F   + ++   D  I IW+ LN
Sbjct:  266 ILTGHTGSVLCLQY-DERVIVTGSSDSTVRVWDVNSGEVLNTLIHHNEAVLHLRFCNGLMVTCSKDRSIAVWDMASPTDISLRR----------VLVGHRAAVNVVDFDDKYIVSASGDRTIKVWSTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAALDPRAPASTLCLRTLVEHSGRVFRLQFDEFQIISSSHDDTILIWDFLN 512          
BLAST of F-box/WD repeat-containing protein 10 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000436.1 (pep scaffold:Pmarinus_7.0:GL480679:1850:10097:-1 gene:ENSPMAG00000000392.1 transcript:ENSPMAT00000000436.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 180.259 bits (456), Expect = 1.010e-50
Identity = 108/345 (31.30%), Postives = 175/345 (50.72%), Query Frame = 2
Query:  692 DFISNLPVHISKRIINFLDEKSLNVCSKVCEIWQQIVYEVRREDIVNAKIKKQAMMLQSQKDESKSVFTAPADPRFARDTNVRVPQLEPHSHRIIYINNSPPHTTNKDTYQIDNFNELELINSRKVFSMDVAYQNILTKKLIIEERNIFCGSYSVMIILESQSRNRDPLRTISYNGGLLVAVSGTNKIIQFLDKRGIQTEIMKNSIRGHAGSIKVVKFLNKHNKKFFGKRTYDSYNNICHEDVEILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATMRHKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIK 1726
            D I +LPVH++K I+  LD+ SL+ C  V   W+ +V EV++E IV   ++ +AM LQ     +K V     +P +AR   V VP L  +   +I   +   H+ +              +NS    S   A Q I T+ + +EERN++C  Y+V+I+L+ +    +P R ++Y GG L A+   ++ ++ LD    + + +   IRGHAGS++ V                     +C E   +LSGSYD SIR W+  +G CL+I+ GH GT++ +    +   SG+ D   K+W         T++H+  I AV  +     SG   GL+K+W++++G  IK
Sbjct:    7 DLIRSLPVHLAKYILGILDQASLSACRHVSLHWRYLVTEVQKESIVKQVVRDEAMALQG--TSAKRV-----NPVYARLREVEVPALAENGLDLISTGDMASHSASTK------------VNS----SFSSALQGIATRVVHMEERNVYCSPYNVLIVLQKE----EPCRVVAYAGGHLAALGSIDRHVRLLDVE--RAKEVPPVIRGHAGSVRAVL--------------------VCQERGLLLSGSYDLSIRSWNMHSGACLRIFRGHQGTVTCLALHGDCLVSGAKDAHVKVWDIHTGRCLHTLKHRRCIRAVGANAGHVASGCEGGLVKLWHLESGSLIK 302          
BLAST of F-box/WD repeat-containing protein 10 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008862.1 (pep scaffold:Pmarinus_7.0:GL476579:86637:114999:1 gene:ENSPMAG00000008000.1 transcript:ENSPMAT00000008862.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 104.375 bits (259), Expect = 2.357e-23
Identity = 64/230 (27.83%), Postives = 104/230 (45.22%), Query Frame = 2
Query: 1319 AGSIKVVKFLNKHNK------KFFGKRTYDSYNNICHEDVEILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATM-RHKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVGEFDTCIGNFH-HPKSVLSMEFQFLRAVTGCADGKIRIWNILNGHCIRVIRGN 1984
             G I+  K L  H+       +F G R              I+SGS D +++ W   TGKCL+  +GH+G +        I  SGS D T K+W  D      T+  H   +  + +     VSG     ++VW+I+ G  +  L+GH   +  ++ D   ++S + D  V +W    E +TC+     H   V S++F  +  V+G  D  IR+W+   G C+  + G+
Sbjct:  220 CGEIRAPKVLKGHDDHVITCLQFCGNR--------------IVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRGNIIVSGSTDRTLKVWNADTGQCVHTLYGHTSTVRCMHLHGNRVVSGSRDATLRVWDIETGQCLHVLAGHVAAVRCVQYDGRRVVSGAYDYTVKVWDP--ESETCLHTLQGHTNRVYSLQFDGVHIVSGSLDTSIRVWDAETGTCLHTLVGH 433          

HSP 2 Score: 92.8189 bits (229), Expect = 1.409e-19
Identity = 55/209 (26.32%), Postives = 103/209 (49.28%), Query Frame = 2
Query: 1424 ILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATMR-HKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVGEFDTCIGNFHHPKSVLS-MEFQFLRAVTGCADGKIRIWNILNGHCIRVIRGNSRSDPILNLVVKDDTLIINT 2044
            I+SGS D +++ W+  TG+C+    GH+ T+  +        SGS D T ++W  +       +  H   +  V    +  VSG     +KVW+ ++   + +L GH   + +++ D  HI+S SLD  + +W    E  TC+      +S+ S ME +    V+G AD  ++IW+I  G C++ ++G ++    +  +     L++ +
Sbjct:  287 IVSGSTDRTLKVWNADTGQCVHTLYGHTSTVRCMHLHGNRVVSGSRDATLRVWDIETGQCLHVLAGHVAAVRCVQYDGRRVVSGAYDYTVKVWDPESETCLHTLQGHTNRVYSLQFDGVHIVSGSLDTSIRVWDA--ETGTCLHTLVGHQSLTSGMELRDNILVSGNADSTVKIWDIKTGQCLQTLQGPNKHQSAVTCLQFSRKLVVTS 493          

HSP 3 Score: 78.5666 bits (192), Expect = 4.070e-15
Identity = 45/173 (26.01%), Postives = 81/173 (46.82%), Query Frame = 2
Query: 1280 IQTEIMKNSIRGHAGSIKVVKFLNKH---NKKFFGKRTYDSYNNIC---------------HEDVEILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATM----RHKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSL 1732
            I+T    + + GH  +++ V++  +        +  + +D  +  C                + V I+SGS DTSIR WD  TG CL   +GH    S ++  + I  SG+ D T K+W         T+    +H+  +T +  S KL V+    G +K+W+++ G ++++L
Sbjct:  341 IETGQCLHVLAGHVAAVRCVQYDGRRVVSGAYDYTVKVWDPESETCLHTLQGHTNRVYSLQFDGVHIVSGSLDTSIRVWDAETGTCLHTLVGHQSLTSGMELRDNILVSGNADSTVKIWDIKTGQCLQTLQGPNKHQSAVTCLQFSRKLVVTSSDDGTVKLWDLRTGDFLRNL 513          
BLAST of F-box/WD repeat-containing protein 10 vs. Ensembl Sea Lamprey
Match: BTRC (beta-transducin repeat containing E3 ubiquitin protein ligase [Source:HGNC Symbol;Acc:HGNC:1144])

HSP 1 Score: 79.337 bits (194), Expect = 2.038e-15
Identity = 51/189 (26.98%), Postives = 88/189 (46.56%), Query Frame = 2
Query: 1424 ILSGSYDTSIRRWDTFTGKCL---KIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATMR-HKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVGEFD-------TCIGNF-HHPKSVLSMEFQFLRAVTGCADGKIRIWNILN 1954
            +++ S D SI  WD  +   +   ++ +GH   ++ +D  ++   S S D T K+W         T+  HK  I  +   ++L VSG S   I++W+I+ G  ++ L GH + +  IR D+  I+S + D  + +W  V   D        C+     H   V  ++F   + V+   D  I IW+ LN
Sbjct:  362 MVTCSKDRSIAVWDLASPTDISLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWNTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLVAALDPRAPAGTLCLRTLVEHSGRVFRLQFDEFQIVSSSHDDTILIWDFLN 550          

HSP 2 Score: 60.8474 bits (146), Expect = 1.217e-9
Identity = 54/219 (24.66%), Postives = 101/219 (46.12%), Query Frame = 2
Query: 1349 NKHNKKFFGKRTYDSYNNIC--HEDVEILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATM-RHKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYI---KSLSGHFKEISAIRLDSWHILSASLDNFVMLWST-VGEFDTCIGNFHHPKSVLSMEFQFLRAVTGCADGKIRIWNILNGHCIRVIRGN 1984
             +HN +    R+  S    C  ++D +I+SG  D +I+   T   K    + GH      +   +    +GS D T ++W  +      T+  H   +  +  +  L V+      I VW++ +   I   + L GH   ++ +  D  +I+SAS D  + +W+T   EF   +    H + +  ++++    V+G +D  IR+W+I  G C+RV+ G+
Sbjct:  256 GRHNLQRIQCRSESSKGVYCLQYDDEKIVSGLRDNTIKVKATIKVKA-TTHHGHLIFFMFLLYVQLYVFTGSSDSTVRVWDVNTGEMVNTLIHHCEAVLHLRFTNGLMVTCSKDRSIAVWDLASPTDISLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWNTSTCEFVRTLNG--HKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGH 471          

HSP 3 Score: 60.4622 bits (145), Expect = 1.853e-9
Identity = 50/223 (22.42%), Postives = 91/223 (40.81%), Query Frame = 2
Query: 1205 ISYNGGLLVAVSGTNKIIQFLDKRGIQTEIMKNSIRGHAGSIKVVKFLNKHNKKFFGKRTYDSYNN------------------ICHEDVEILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATMRHKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLW 1819
            + +  GL+V  S  ++ I   D        ++  + GH  ++ VV F +K+     G RT   +N                   + + D  ++SGS D +IR WD   G CL++  GH   +  I    +   SG+YDG  K+W     +  A +  + P      +  LC                   +++L  H   +  ++ D + I+S+S D+ +++W
Sbjct:  355 LRFTNGLMVTCS-KDRSIAVWDLASPTDISLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWNTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVW-----DLVAALDPRAP------AGTLC-------------------LRTLVEHSGRVFRLQFDEFQIVSSSHDDTILIW 546          
BLAST of F-box/WD repeat-containing protein 10 vs. Ensembl Sea Lamprey
Match: pafah1b1b (platelet-activating factor acetylhydrolase 1b, regulatory subunit 1b [Source:NCBI gene;Acc:394247])

HSP 1 Score: 67.781 bits (164), Expect = 4.325e-12
Identity = 58/215 (26.98%), Postives = 94/215 (43.72%), Query Frame = 2
Query: 1424 ILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDI--DAGEEIFASGSYDGTCKLWRYDEKNSFATMR-HKHPITAVAI--SEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIR--LDSWHILSASLDNFVMLWSTVGE-----------FDTCIGNFHHPKSVLSMEFQFLRA----------VTGCADGKIRIWNILNGHCIRVIRGN 1984
            I+S S D +I+ WD  TG   +   GH+ ++ DI  D   ++ AS S D T KLW +       TM  H H +++VA   +    VS      +K+W +Q G  +K+ +GH + +  +R   D   I S S D  V +W T  +              C+       S + +E     A          ++G  D  I++W+I  G C+  + G+
Sbjct:   62 IVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDLSGKMLASCSADMTVKLWDFQSFECLRTMHGHDHNVSSVAFMPNGDHLVSASRDKTMKMWEVQTGYCVKTFTGHREWVRMVRPNQDGSLIASCSNDQTVRVWVTATKECKAELREHEHVVECVSWAPDAASPVILEATGAEAKKGGKPGPYLLSGSRDKTIKMWDISTGICVITLVGH 276          

HSP 2 Score: 49.6766 bits (117), Expect = 2.464e-6
Identity = 46/204 (22.55%), Postives = 85/204 (41.67%), Query Frame = 2
Query: 1424 ILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEE--IFASGSYDGTCKLWRYDEKNSFATMR-HKHPITAVAISEKLC----------------------VSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSW--HILSASLDNFVMLWSTVGEFDTCIGNF-HHPKSVLSMEFQFLR--AVTGCADGKIRIWN 1945
            ++S S D +++ W+  TG C+K + GH   +  +   ++  + AS S D T ++W    K   A +R H+H +  V+ +                          +SG     IK+W+I  G+ + +L GH   +  +        ILS + D  + +W    +   C  +   H   V S++F       +TG  D  +++W 
Sbjct:  146 LVSASRDKTMKMWEVQTGYCVKTFTGHREWVRMVRPNQDGSLIASCSNDQTVRVWVTATKECKAELREHEHVVECVSWAPDAASPVILEATGAEAKKGGKPGPYLLSGSRDKTIKMWDISTGICVITLVGHDNWVRGVLFHPGGKFILSCADDKTLRVWDYKNK--RCQKSLAAHEHFVTSLDFHKTAPYVITGSVDQSVKVWE 347          
BLAST of F-box/WD repeat-containing protein 10 vs. Ensembl Sea Lamprey
Match: utp15 (UTP15 small subunit processome component [Source:NCBI gene;Acc:325106])

HSP 1 Score: 68.1662 bits (165), Expect = 5.495e-12
Identity = 61/236 (25.85%), Postives = 107/236 (45.34%), Query Frame = 2
Query: 1202 TISYNGGLLVAVSGTNKIIQFLDKRGIQTEIMKNSIRGHAGSIKVVKFLNKHNKKFFGKRTYDSYNNICHEDVEILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDA---GEEIFASGSYDGTCKLWRYDEKNSFATMRHKHPITAVAI--SEKLCVSGDSLGLIKVWN-IQNGVYIKSLSGHFKEISAIRLDSW--HILSASLDNFVMLWSTVGEFDTCIGNFHHPKSVLSM 1885
            T   +G LLVA S    +++  +  G    +   S  GH  +++V  F++                    + + +LSGS D + R WD  TG  L  +  H   +           +F +GSYD   +++   + ++  T+ H  P+ +V    SE L  S     L+KVW+ ++ G  +  L  H K ++A+ L+     +L+ASLD  V + ST   F   + +F +P ++LS+
Sbjct:   87 TFRADGRLLVAGS-EEGVVRVFEAHG---RVPLRSFDGHKRAVRVSCFMS--------------------DGLRVLSGSDDCTARLWDVATGAQLSSFASHGDYVRSAHVCTLNPNLFITGSYDHMVRVFDVRQPDAVLTLDHGFPVESVLAFPSEGLYASAGGR-LVKVWDAVRGGHLLACLRHHHKTVTALTLNGAGDRLLTASLDRHVKVLSTT-TFKP-VHSFDYPAAILSL 295          
BLAST of F-box/WD repeat-containing protein 10 vs. Ensembl Yeast
Match: MET30 (F-box protein containing five copies of the WD40 motif; controls cell cycle function, sulfur metabolism, and methionine biosynthesis as part of the ubiquitin ligase complex; interacts with and regulates Met4p, localizes within the nucleus; dissociation of Met30p from SCF complex in response to cadmium stress is regulated by Cdc48p [Source:SGD;Acc:S000001308])

HSP 1 Score: 88.9669 bits (219), Expect = 1.828e-18
Identity = 58/250 (23.20%), Postives = 103/250 (41.20%), Query Frame = 2
Query: 1388 DSYNNICHEDVEILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATMRHKHPITAVAISEKL--CVSGDSLGLIKVWNIQNGVYIKSLSGH-----------FKEISAIRLDSW--------------------------------------HILSASLDNFVMLWSTVGEFDTCI-GNFHHPKSVLSMEFQFLRAVTGCADGKIRIWNILNGHCIRVIRG 1981
            D    +  +D ++++GS D +IR W+  TG+C+  Y GHS ++  +D+ +++  SGS D T K+W  + +  +    H   +  V +  K   C S      I++W+I+    +K   GH            K++  +  D+                                       H+LS  LDN + LW    +   CI   F H + V  +     R ++G  DG I++W++ +G C+    G
Sbjct:  343 DGVKTLYFDDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSYQKVIVSGSADKTVKVWHVESRTCYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPYPTHLLSCGLDNTIKLWDV--KTGKCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKVWDLQSGKCMHTFNG 590          

HSP 2 Score: 73.9442 bits (180), Expect = 7.036e-14
Identity = 53/203 (26.11%), Postives = 92/203 (45.32%), Query Frame = 2
Query: 1424 ILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATMR-HKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVGEFDTCIGNFHHPKSVLSMEFQFLRAVTGCADG-KIRIWNILNGHCIRVIRGN-SRSDPILNLVVKD 2023
            + +GSYD++I  WD FTGK ++   GHS  +  +   +    +GS D T ++W Y      +T R H   + +V   +K+ VSG +   +KVW++++     +L GH + ++ ++L                               HPKS          +   C+D   IR+W+I    C++V RG+  +   I+ L +KD
Sbjct:  315 LFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSYQKVIVSGSADKTVKVWHVESRT-CYTLRGHTEWVNCVKL-------------------------------HPKSF---------SCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKD 476          

HSP 3 Score: 58.9214 bits (141), Expect = 3.132e-9
Identity = 33/110 (30.00%), Postives = 47/110 (42.73%), Query Frame = 2
Query: 1424 ILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATMRHKH------------------PITAVAISEKLCVSGDSLGLIKVW 1699
            +LS   D +I+ WD  TGKC++   GH   + DI A      SGS+DG+ K+W         T   +                   PI  V I +  C SGD  G +K++
Sbjct:  525 LLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKVWDLQSGKCMHTFNGRRLQRETQHTQTQSLGDKVAPIACVCIGDSECFSGDEFGCVKMY 634          

HSP 4 Score: 55.4546 bits (132), Expect = 4.472e-8
Identity = 33/125 (26.40%), Postives = 64/125 (51.20%), Query Frame = 2
Query: 1619 HKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTV-GEFDTCIGNFH-HPKSVLSMEFQFLRAVTGCADGKIRIWNILNGHCIRVIRGNS 1987
            H   +  +  + +L  +G     I +W++  G  I+ LSGH   +  +  D   +++ SLD  + +W+ + GE   CI  +  H  SVLS++      V+G AD  +++W++ +  C   +RG++
Sbjct:  301 HMDGVLTLQFNYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRKLITGSLDKTIRVWNYITGE---CISTYRGHSDSVLSVDSYQKVIVSGSADKTVKVWHVESRTCY-TLRGHT 421          
BLAST of F-box/WD repeat-containing protein 10 vs. Ensembl Yeast
Match: MDV1 (Peripheral protein of cytosolic face of mitochondrial outer membrane; required for mitochondrial fission; interacts with Fis1p and with the self-assembled oligomeric form of the dynamin-related GTPase Dnm1p; contains WD repeats; MDV1 has a paralog, CAF4, that arose from the whole genome duplication [Source:SGD;Acc:S000003648])

HSP 1 Score: 67.3958 bits (163), Expect = 7.673e-12
Identity = 48/178 (26.97%), Postives = 92/178 (51.69%), Query Frame = 2
Query: 1424 ILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATMRHKHP-ITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVGEFDTCIGNFHHPKS--VLSME-FQFLRAVTGCADGKIRIWN 1945
            ++SGS D +IR+WD  +GKCL+          D+     +  S + D +        K++  T R++ P I A+   +    +G   G++++W++++G  I++L GH   I++++ DS  +++ S D  V +W    +  T + N  H  S  VLS++ FQ   AV    +  ++I++
Sbjct:  515 LVSGSQDRTIRQWDLRSGKCLQTI--------DLSFANVLTTSTNVDLS--------KSTLLTQRNERPSIGALQSFDAALATGTKDGVVRLWDLRSGKVIRTLKGHTDAITSLKFDSACLVTGSYDRTVRIW----DLRTGLLNKFHAYSAPVLSLDLFQENAAVVVADEPSVQIYD 672          
BLAST of F-box/WD repeat-containing protein 10 vs. Ensembl Yeast
Match: PWP2 (Conserved 90S pre-ribosomal component; essential for proper endonucleolytic cleavage of the 35 S rRNA precursor at A0, A1, and A2 sites; contains eight WD-repeats; PWP2 deletion leads to defects in cell cycle and bud morphogenesis [Source:SGD;Acc:S000000653])

HSP 1 Score: 62.3882 bits (150), Expect = 3.115e-10
Identity = 44/160 (27.50%), Postives = 79/160 (49.38%), Query Frame = 2
Query: 1385 YDSYNNICH--EDVEILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGE--EIFASGSYDGTCKLW---RYDEKNSF-ATMRHKHPITAVAISEKLCVSGDSLGL-IKVWNIQNGVYIKSLSGHFKEISAIRLDSWH--ILSASLDNFVMLWSTVG 1831
            +DS N++ +  +   +++ S D  I+ WD  +G CL  +  H+ +++ +   +  ++  S S DGT + W   RY    +F  T R +    AV  S ++  +G      I VW++Q G  + +LSGH   +S +     +  + SAS D  + +WS  G
Sbjct:  345 FDSTNSLAYSPDGSRVVTASEDGKIKVWDITSGFCLATFEEHTSSVTAVQFAKRGQVMFSSSLDGTVRAWDLIRYRNFRTFTGTERIQFNCLAVDPSGEVVCAGSLDNFDIHVWSVQTGQLLDALSGHEGPVSCLSFSQENSVLASASWDKTIRIWSIFG 504          
BLAST of F-box/WD repeat-containing protein 10 vs. Ensembl Yeast
Match: CAF4 (WD40 repeat-containing protein associated with the CCR4-NOT complex; interacts in a Ccr4p-dependent manner with Ssn2p; also interacts with Fis1p, Mdv1p and Dnm1p and plays a role in mitochondrial fission; CAF4 has a paralog, MDV1, that arose from the whole genome duplication [Source:SGD;Acc:S000001744])

HSP 1 Score: 60.4622 bits (145), Expect = 1.247e-9
Identity = 44/176 (25.00%), Postives = 85/176 (48.30%), Query Frame = 2
Query: 1424 ILSGSYDTSIRRWDTFTGKCLK-IYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATMRHKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVGEFDTCIGNFHHPKSVLSMEFQFLRAVTGCADGKIRIWNI 1948
            ++SGS D  I  WD  TGKC++ + +  + T SDI    ++ A    +G C L       + A M     I A+        +G   G++++W+++ G  ++ L GH   I++++ DS  +++ S+DN V +W       + +    +   V S++F       G  +G + ++N+
Sbjct:  437 LVSGSRDKKIFHWDLTTGKCIQQLDLIFTPTHSDI----KMPARSLNNGACLL------GTEAPM-----IGALQCYNSALATGTKDGIVRLWDLRVGKPVRLLEGHTDGITSLKFDSEKLVTGSMDNSVRIWDL--RTSSILDVIAYDLPVSSLDFDGKLITVGANEGGVNVFNM 595          

HSP 2 Score: 50.0618 bits (118), Expect = 2.039e-6
Identity = 36/142 (25.35%), Postives = 63/142 (44.37%), Query Frame = 2
Query: 1616 RHKHPITAVAISEK---LCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWH---ILSASLDNFVMLW------------STVGE-----FDTCIGNFH-HPKSVLSMEFQFLRAVTGCADGKIRIWNILNGHCIR 1969
             H + ITA+        LC S     ++KVW++ +G+ +  L GH   ++ +++D  +   +++ S D  + LW            S + E        CI NF  H   + ++ F     V+G  D KI  W++  G CI+
Sbjct:  317 EHGNSITALDFDTPWGTLCSSSYQDRIVKVWDLNHGIQVGELPGHLATVNCMQIDKKNYNMLITGSKDATLKLWDLNLSREIYLDHSPLKEKTEEIVTPCIHNFELHKDEITALSFDSEALVSGSRDKKIFHWDLTTGKCIQ 458          

HSP 3 Score: 48.9062 bits (115), Expect = 3.581e-6
Identity = 22/95 (23.16%), Postives = 48/95 (50.53%), Query Frame = 2
Query: 1424 ILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATMRHKHPITAVAISEKLCVSGDSLGLIKVWNIQ 1708
            + +G+ D  +R WD   GK +++  GH+  I+ +    E   +GS D + ++W     +    + +  P++++    KL   G + G + V+N++
Sbjct:  502 LATGTKDGIVRLWDLRVGKPVRLLEGHTDGITSLKFDSEKLVTGSMDNSVRIWDLRTSSILDVIAYDLPVSSLDFDGKLITVGANEGGVNVFNME 596          
BLAST of F-box/WD repeat-containing protein 10 vs. Ensembl Yeast
Match: PRP46 (Member of the NineTeen Complex (NTC); this complex contains Prp19p and stabilizes U6 snRNA in catalytic forms of the spliceosome containing U2, U5, and U6 snRNAs [Source:SGD;Acc:S000006072])

HSP 1 Score: 55.8398 bits (133), Expect = 2.566e-8
Identity = 52/191 (27.23%), Postives = 87/191 (45.55%), Query Frame = 2
Query: 1427 LSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEE--IFASGSYDGTCKLWRYDEKNSFATMRHKH--PITAVAI--SEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIR---LDSWHILSASLDNFVMLWSTVGEFDTCIGNFHHPKSV--LSMEFQFLRAVTGCADGKIRIWNILNGHCI 1966
            ++GS DT+++ WD  TGK      GH  T+ D+   +      S S D T K W   EKN      + H   +  V+I  +  L  +     +IK+W+++  + + +L GH   I+ ++   +D   ++S+S D  V LW  V    T     HH +SV   ++  +     + C D  IR W +  G  +
Sbjct:  156 ITGSNDTTMKVWDLATGKLKTTLAGHVMTVRDVAVSDRHPYLFSVSEDKTVKCWDL-EKNQIIRDYYGHLSGVRTVSIHPTLDLIATAGRDSVIKLWDMRTRIPVITLVGHKGPINQVQCTPVDP-QVVSSSTDATVRLWDVVAG-KTMKVLTHHKRSVRATALHPKEFSVASACTD-DIRSWGLAEGSLL 342          
BLAST of F-box/WD repeat-containing protein 10 vs. Ensembl Nematostella
Match: EDO29886 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T2C5])

HSP 1 Score: 123.25 bits (308), Expect = 1.061e-32
Identity = 51/132 (38.64%), Postives = 81/132 (61.36%), Query Frame = 2
Query: 1544 FASGSYDGTCKLWRYDEKNSFATMRHKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVGEFDTCIGNFHHPKSVLSMEFQFLRAVTGCADGKIRI 1939
             ASGS D + K+W ++      T RH+H +  V++S+ L +SG   G +KVW+I++    KSL GH   I+ ++ D++H+++ S D + M WS +G    C+  F HPK VL +EF + R +TG ADGK+ +
Sbjct:    3 LASGSRDKSVKVWNFETGKCRRTFRHRHVVQTVSVSDALVISGCEGGKVKVWDIESATLQKSLDGHHGAITCVKFDAYHVITGSTDCYAMAWSVIGSHKKCLQAFRHPKEVLCLEFLYCRVITGSADGKVSL 134          
BLAST of F-box/WD repeat-containing protein 10 vs. Ensembl Nematostella
Match: EDO42306 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1V2])

HSP 1 Score: 102.834 bits (255), Expect = 2.230e-22
Identity = 59/191 (30.89%), Postives = 98/191 (51.31%), Query Frame = 2
Query: 1424 ILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATM-RHKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVGEFDTCIGNFHHPKSVLS-MEFQFLRAVTGCADGKIRIWNILNGHCIRVIRGNSR 1990
            I+SGS D +++ W+  TG C+    GH+ T+  +D  EE+  SGS DGT ++W     N    +  H   +  V       VSG    L+KVW+ +    I +L GH   + +++ D  +I+S SLD  + +W    E   C+      +S+ S ME +    V+G AD  ++IW+I  G C++ + G ++
Sbjct:  344 IVSGSTDRTLKVWNAETGYCMHTLYGHTSTVRCMDMHEEVVVSGSRDGTLRVWDTTTGNCLHVLVGHLAAVRCVKYDGHRVVSGAYDFLVKVWDPETEQCIHTLQGHTNRVYSLQFDGTYIVSGSLDTSIRVWH--AETGQCLHTLVGHQSLTSGMELRNNTLVSGNADSTVKIWDITTGQCLQTLAGPNK 532          

HSP 2 Score: 101.679 bits (252), Expect = 4.604e-22
Identity = 54/189 (28.57%), Postives = 91/189 (48.15%), Query Frame = 2
Query: 1424 ILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATM-RHKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVGEFDTCIGNFH-HPKSVLSMEFQFLRAVTGCADGKIRIWNILNGHCIRVIRGN 1984
            ++SGS D +++ W   +GKCL+   GH+G +        I  SGS D T K+W  +      T+  H   +  + + E++ VSG   G ++VW+   G  +  L GH   +  ++ D   ++S + D  V +W    E + CI     H   V S++F     V+G  D  IR+W+   G C+  + G+
Sbjct:  304 VVSGSDDGTLKVWSALSGKCLRTLTGHTGGVWSSQLSGHIIVSGSTDRTLKVWNAETGYCMHTLYGHTSTVRCMDMHEEVVVSGSRDGTLRVWDTTTGNCLHVLVGHLAAVRCVKYDGHRVVSGAYDFLVKVWDP--ETEQCIHTLQGHTNRVYSLQFDGTYIVSGSLDTSIRVWHAETGQCLHTLVGH 490          

HSP 3 Score: 65.855 bits (159), Expect = 6.309e-11
Identity = 41/152 (26.97%), Postives = 76/152 (50.00%), Query Frame = 2
Query: 1625 HPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVGEFDTCIGNFH-HPKSVLSMEFQFLRAVTGCADGKIRIWNILNGHCIRVIRGNSRSDPILNLVVKDDTLIINTVSNILVLNFEP 2077
            H IT +  S    VSG   G +KVW+  +G  +++L+GH   + + +L    I+S S D  + +W+   E   C+   + H  +V  M+      V+G  DG +R+W+   G+C+ V+ G+  +   +  V  D   +++   + LV  ++P
Sbjct:  292 HVITCLQFSGSRVVSGSDDGTLKVWSALSGKCLRTLTGHTGGVWSSQLSGHIIVSGSTDRTLKVWN--AETGYCMHTLYGHTSTVRCMDMHEEVVVSGSRDGTLRVWDTTTGNCLHVLVGHLAA---VRCVKYDGHRVVSGAYDFLVKVWDP 438          

HSP 4 Score: 64.3142 bits (155), Expect = 2.026e-10
Identity = 35/143 (24.48%), Postives = 72/143 (50.35%), Query Frame = 2
Query: 1424 ILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATM-RHKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSG---HFKEISAIRLDSWHILSASLDNFVMLWS-TVGEF 1837
            ++SG+YD  ++ WD  T +C+    GH+  +  +        SGS D + ++W  +      T+  H+   + + +     VSG++   +K+W+I  G  +++L+G   H   ++ ++  S  ++++S D  V +W    GEF
Sbjct:  424 VVSGAYDFLVKVWDPETEQCIHTLQGHTNRVYSLQFDGTYIVSGSLDTSIRVWHAETGQCLHTLVGHQSLTSGMELRNNTLVSGNADSTVKIWDITTGQCLQTLAGPNKHQSAVTCLQFSSKFVITSSDDGTVKIWDLQTGEF 566          
BLAST of F-box/WD repeat-containing protein 10 vs. Ensembl Nematostella
Match: EDO48720 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIJ5])

HSP 1 Score: 92.4337 bits (228), Expect = 1.846e-19
Identity = 55/197 (27.92%), Postives = 103/197 (52.28%), Query Frame = 2
Query: 1409 HEDVEILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATM-RHKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYI---KSLSGHFKEISAIRLDSWHILSASLDNFVMLWST-VGEFDTCIGNFHHPKSVLSMEFQFLRAVTGCADGKIRIWNILNGHCIRVIRGN 1984
            ++D +I+SG  D +I+ WD  +  C+K+  GH+G++  +   E +  +GS D T ++W     +   T+  H   +  +   E + V+      I VW++Q+   I   + L GH   ++ +  D  +I+SAS D  + +WST   EF   +    H + +  ++++    V+G +D  IR+W+I  G C+RV+ G+
Sbjct:  172 YDDHKIVSGLRDNTIKVWDKKSLACVKVLTGHTGSVLCLQYDENVIVTGSSDSTVRVWNVHAGDMLNTLIHHCEAVLHLRFQEGMMVTCSKDRSIAVWDMQSPTDISLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWSTSTCEFVRTLNG--HRRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGH 366          

HSP 2 Score: 86.6557 bits (213), Expect = 1.063e-17
Identity = 103/484 (21.28%), Postives = 196/484 (40.50%), Query Frame = 2
Query:  611 LLQRVCKISANHIFEDKHSEKNNNFAVDFISNLPV----HISKRIINFLDEKSLNVCSKVCEIWQQIVYE-VRREDIVNAKIKKQAMM--LQSQKDESKSVFTAPADPRFARDTNVRVPQLEPHSHRIIYINNSPPHTTNKDTYQIDNFNELELINSRKVFSMDVAYQNILTKKLIIEERNIFCGSYSVMIILESQSRNRDPLRTISYNGGLLVAVSGTNKIIQFLDKRGIQTEIMKNSIRGHAGSIKVVKF--------LNKHNKKFFGKRTYDSYNNICH----------EDVEILSGSYDTSIRRWDTFTGKCL---KIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATMR-HKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVGEFD-------TCIGNF-HHPKSVLSMEFQFLRAVTGCADGKIRIWNIL 1951
            LL R+C     H+    ++        DFI+ LP     HI++ I++FLD KSL     VC+ W +++ + +  + ++  K++   +   L  ++   + +F +            +VP               PP+         D F +L              Y  I+ + L   E N  CG++++  I   +S N   +  + Y+   +V+    N I +  DK+ +        + GH GS+  +++         +    + +     D  N + H          ++  +++ S D SI  WD  +   +   ++ +GH   ++ +D  ++   S S D T K+W         T+  H+  I  +   ++L VSG S   I++W+I+ G  ++ L GH + +  IR D+  I+S + D  + +W      D        C+     H   V  ++F   + V+   D  I IW+ L
Sbjct:   19 LLSRMCHFQHGHV----NAFLKPMLQRDFITALPAKGLDHIAENILSFLDAKSLCAAEVVCKEWHRVIADGMLWKKLIERKVRTDPLWHGLSERRGWGQYLFKS------------KVP--------------DPPNN--------DFFRKL--------------YPKII-QDLETIETNWRCGNHALHKI-PCRSENSKGVYCLQYDDHKIVSGLRDNTI-KVWDKKSLAC---VKVLTGHTGSVLCLQYDENVIVTGSSDSTVRVWNVHAGDMLNTLIHHCEAVLHLRFQEGMMVTCSKDRSIAVWDMQSPTDISLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWSTSTCEFVRTLNGHRRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAALDPRAPAGTLCLRTLVEHTGRVFRLQFDDFQIVSSSHDDTILIWDFL 444          
BLAST of F-box/WD repeat-containing protein 10 vs. Ensembl Nematostella
Match: EDO34865 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN68])

HSP 1 Score: 88.5817 bits (218), Expect = 1.880e-18
Identity = 69/221 (31.22%), Postives = 108/221 (48.87%), Query Frame = 2
Query: 1427 LSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDID----AGEEIFASGSYDGTCKLWRYDEKNSFATMR-HKHPITAVAISEKLCV--SGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDS--WHILSASLDNFVMLWSTVG--EFDTCIGNFHHPKSVLSMEFQFLRA--VTGCADGKIRIWNILNGHCIRVIRGNSRSDPILNLVVKDDTLIINTVS 2050
            ++GSYD + + WDT +G+      GH   +  I      G++I A+GS+D TCKLW  +    + T R H   I  +A + +  V  +G      K+W++Q G  I +LSGH  EI +   +S    +L+ S D+ V +W T       T IG   H   + + +F F  +  VTG  D   +IW+   G CI  +RG+   D +L++       +I T S
Sbjct:  108 ITGSYDRTCKVWDTASGEETLTLEGHKNVVYAIAFNNPYGDKI-ATGSFDKTCKLWNAETGKCYHTYRGHSAEIVCLAFNPQSTVIATGSMDTTAKLWDVQTGAEISTLSGHSAEIISCAFNSTGTQLLTGSFDHTVSVWDTRSGRRVHTLIG---HRGEISNAQFNFDCSFIVTGSMDKTCKIWDAGTGKCIGTLRGH--DDEVLDVAFDYTGQLIATAS 322          

HSP 2 Score: 82.0333 bits (201), Expect = 2.543e-16
Identity = 59/199 (29.65%), Postives = 95/199 (47.74%), Query Frame = 2
Query: 1421 EILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDI--DAGEEIFASGSYDGTCKLWRYDEKNSFATMR-HKHPITAVAI--SEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEIS--AIRLDSWHILSASLDNFVMLW-STVGEFDTCIGNFH-HPKSVLSMEFQFLRAV--TGCADGKIRIWNILNGHCIRVIRGN 1984
            +I +GS+D + + W+  TGKC   Y GHS  I  +  +    + A+GS D T KLW        +T+  H   I + A   +    ++G     + VW+ ++G  + +L GH  EIS      D   I++ S+D    +W +  G+   CIG    H   VL + F +   +  T  ADG  R++N L  HC+  + G+
Sbjct:  149 KIATGSFDKTCKLWNAETGKCYHTYRGHSAEIVCLAFNPQSTVIATGSMDTTAKLWDVQTGAEISTLSGHSAEIISCAFNSTGTQLLTGSFDHTVSVWDTRSGRRVHTLIGHRGEISNAQFNFDCSFIVTGSMDKTCKIWDAGTGK---CIGTLRGHDDEVLDVAFDYTGQLIATASADGTGRVYNALTHHCLSKLEGH 344          

HSP 3 Score: 65.4698 bits (158), Expect = 4.854e-11
Identity = 53/186 (28.49%), Postives = 85/186 (45.70%), Query Frame = 2
Query: 1418 VEILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEE--IFASGSYDGTCKLWRYDEKNSFATMR-HKHPITAVAI--SEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSW--HILSASLDNFVMLWS-TVGEFDTCIGNFH-HPKSVLSMEFQFLR--AVTGCADGKIRIW 1942
             ++L+GS+D ++  WDT +G+ +   IGH G IS+     +     +GS D TCK+W         T+R H   +  VA   + +L  +  + G  +V+N      +  L GH  EIS I  ++    +L+AS D    LW    G+   C+     H   + S  F +     +TG  D   R+W
Sbjct:  232 TQLLTGSFDHTVSVWDTRSGRRVHTLIGHRGEISNAQFNFDCSFIVTGSMDKTCKIWDAGTGKCIGTLRGHDDEVLDVAFDYTGQLIATASADGTGRVYNALTHHCLSKLEGHEGEISKITFNAQGTRLLTASSDKTARLWDPNTGK---CLQVLEGHTDEIFSCAFNYDGDIIITGSKDNTCRLW 414          
BLAST of F-box/WD repeat-containing protein 10 vs. Ensembl Nematostella
Match: EDO44093 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RWV7])

HSP 1 Score: 84.7297 bits (208), Expect = 3.935e-17
Identity = 80/345 (23.19%), Postives = 150/345 (43.48%), Query Frame = 2
Query:  986 NSPPHT-TNKDTYQIDNFNELELINSRKVFSMDVAYQNIL-TKKLIIEERNIFCGSYSVMIILESQSRNRDPLRTISYNGGLLVAVSGTNKIIQFLDKRGIQTEIMKNSIRGHAGSIKVVKFLNK--------------HNKKFFGKRTYDSYNN------ICHEDVEILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATMR-HKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVGEFDTCIGNFH-HPKSVLSMEFQFLRAVTGCADGKIRIWNI 1948
             +P H  +   TY I ++  L L + +     D   +  L  +  +++  N+  G   V++ L+   R               V    +++ I+  D R  ++      ++GH G ++ ++F N+              H  KF   R +  Y +      +  ++  ++SGS+D++IR WD  T +C+ +  GH G +S ++       SGS D T KLW  +  +   T+R H   +T+V +  +L +SG + G+I  W++ +G    ++  H   + ++   + H  SA  DN +  W  VG   TC+     H   V  +       +    DG +RIW++
Sbjct:   93 TNPAHIYSTVHTYCILSYVALGLAHCKHQSLFDKEEELALDVRPALVQAANVLKGHMDVVLCLQFDRRR--------------VVTGSSDRTIRMWDVRSGRS---IRKMKGHKGGVRCLQFDNERIISGSWDMTIMVWHIVKF--TRLHVLYGHKGCVSCLRFDENTLVSGSHDSTIRVWDMRTWECVLVLQGHEGAVSCLEFDAPFVLSGSADKTIKLWNVESGDCLNTLRGHADAVTSVKVIGELILSGSADGMILFWDLDSGHCEAAIQAHEGPVHSLSYANDHFFSAGGDNMIKEWD-VGTC-TCLRTLQGHRGPVQDVMVGHHYILVEHYDGSVRIWDL 416          

HSP 2 Score: 84.3445 bits (207), Expect = 4.925e-17
Identity = 56/204 (27.45%), Postives = 98/204 (48.04%), Query Frame = 2
Query: 1421 EILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATMR-HKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVGEFDTCIGNFH-HPKSVLSMEFQFLRAVTGCADGKIRIWNILNGHCIRVIRGNSRSDPILNLVVKDD 2026
             +++GS D +IR WD  +G+ ++   GH G +  +    E   SGS+D T  +W   +      +  HK  ++ +   E   VSG     I+VW+++    +  L GH   +S +  D+  +LS S D  + LW+   E   C+     H  +V S++      ++G ADG I  W++ +GHC   I+ +    P+ +L   +D
Sbjct:  161 RVVTGSSDRTIRMWDVRSGRSIRKMKGHKGGVRCLQFDNERIISGSWDMTIMVWHIVKFTRLHVLYGHKGCVSCLRFDENTLVSGSHDSTIRVWDMRTWECVLVLQGHEGAVSCLEFDAPFVLSGSADKTIKLWNV--ESGDCLNTLRGHADAVTSVKVIGELILSGSADGMILFWDLDSGHCEAAIQAH--EGPVHSLSYAND 360          
BLAST of F-box/WD repeat-containing protein 10 vs. Ensembl Medaka
Match: fbxw7 (F-box and WD repeat domain containing 7 [Source:NCBI gene;Acc:101155087])

HSP 1 Score: 116.701 bits (291), Expect = 4.476e-26
Identity = 76/256 (29.69%), Postives = 120/256 (46.88%), Query Frame = 2
Query: 1283 QTEIMKNSIRGHAGSIKVVKFLNKH---NKKFFGKRTYDSYNNICHEDVEILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATM-RHKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVGEFDTCIGNFH-HPKSVLSMEFQFLRAVTGCADGKIRIWNILNGHCIRVIRGNSRSDPILNLVVKDDTLI 2035
            Q  I  N  RG   S KV+K  + H     +F G R              I+SGS D +++ W   TGKCL+  +GH+G +      E I  SGS D T K+W  +      T+  H   +  + + EK  VSG     ++VW+I+ G  +  L GH   +  ++ D   ++S + D  V +W    E +TC+     H   V S++F  +  V+G  D  IR+W++  G+CI  + G+      + L  KD+ L+
Sbjct:  429 QHRIDTNWRRGDLKSPKVLKGHDDHVITCLQFCGNR--------------IVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRENIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDP--ETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMEL--KDNILV 666          

HSP 2 Score: 99.7525 bits (247), Expect = 8.090e-21
Identity = 55/188 (29.26%), Postives = 96/188 (51.06%), Query Frame = 2
Query: 1424 ILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSF-ATMRHKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVGEFDTCIGNFHHPKSVLS-MEFQFLRAVTGCADGKIRIWNILNGHCIRVIRG 1981
            I+SGS D +++ W+  TG+C+    GH+ T+  +   E+   SGS D T ++W  +        M H   +  V    +  VSG    ++KVW+ +    + +L GH   + +++ D  H++S SLD  + +W    E   CI      +S+ S ME +    V+G AD  ++IW+I  G C++ ++G
Sbjct:  505 IISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDV--ETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQG 690          

HSP 3 Score: 87.4261 bits (215), Expect = 4.290e-17
Identity = 51/185 (27.57%), Postives = 91/185 (49.19%), Query Frame = 2
Query: 1424 ILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATMR-HKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWS--TVGEFDTCIGNFHHPKSVLSMEFQFLRAVTGCADGKIRIWNILNGHCIR 1969
            ++SGS D ++R WD  TG+CL + +GH   +  +        SG+YD   K+W  + +    T++ H + + ++       VSG     I+VW+++ G  I +L+GH    S + L    ++S + D+ V +W   T     T  G   H  +V  ++F     +T   DG +++W++  G  IR
Sbjct:  545 VVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGPHKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIR 729          

HSP 4 Score: 76.2554 bits (186), Expect = 1.318e-13
Identity = 90/403 (22.33%), Postives = 164/403 (40.69%), Query Frame = 2
Query:  680 NFAVDFISNLPVHISKRIINFLDEKSLNVCSKVCEIWQQIVYE--VRREDIVNAKIKKQAMMLQSQKDESKSVFT-APADPRFAR----DTNVRVPQLEPHSHRIIYINNSPPHTTNKDTYQIDNFNELELINSRKVFSMD---VAYQNILTKKLIIEERNIFCGSYSVMI---ILESQSRNRDPLRTISYNGG----LLVAVSGTNKIIQFLDKR-------------GIQTEIMKNSIRGHAGSIKVVKFLNKH---NKKFFGKRTYDSYNNIC---------------HEDVEILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATMR--HKH--PITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSL 1732
             F  DFIS LP  ++  +++FL+ K L   ++ C  W+ +  +  + RE      I +   +   ++   K+ FT +P    + R    DTN R   L+           SP      D + I     L+   +R V   D   +   + +T K +        G +S  +   I+ S S +R  L+  +   G     L   + T + +   +KR              I+T    + + GH  +++ V++  +        F  + +D     C                + + ++SGS DTSIR WD  TG C+    GH    S ++  + I  SG+ D T K+W         T++  HKH   +T +  ++   ++    G +K+W+++ G +I++L
Sbjct:  346 QFQRDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLLWREKCREEGIDEP--LAPKKRGNVKAGFTHSPWKSAYIRQHRIDTNWRRGDLK-----------SPKVLKGHDDHVITC---LQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRENIIISGSTDRT-LKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGPHKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNL 731          

HSP 5 Score: 62.3882 bits (150), Expect = 2.151e-9
Identity = 42/169 (24.85%), Postives = 77/169 (45.56%), Query Frame = 2
Query: 1580 WRYDEKNSFATMR--HKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVGEFDTCIGNFH-HPKSVLSMEFQFLRAVTGCADGKIRIWNILNGHCIRVIRGNSRSDPILNLVVKDDTLIINTVSNILVLNFEP 2077
            WR  +  S   ++    H IT +       VSG     +KVW+   G  +++L GH   + + ++    I+S S D  + +W+   E   CI   + H  +V  M     R V+G  D  +R+W+I  G C+ V+ G+  +   +  V  D   +++   + +V  ++P
Sbjct:  436 WRRGDLKSPKVLKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRENIIISGSTDRTLKVWNA--ETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGHVAA---VRCVQYDGRRVVSGAYDFMVKVWDP 599          
BLAST of F-box/WD repeat-containing protein 10 vs. Ensembl Medaka
Match: fbxw7 (F-box and WD repeat domain containing 7 [Source:NCBI gene;Acc:101155087])

HSP 1 Score: 114.005 bits (284), Expect = 1.034e-25
Identity = 76/256 (29.69%), Postives = 120/256 (46.88%), Query Frame = 2
Query: 1283 QTEIMKNSIRGHAGSIKVVKFLNKH---NKKFFGKRTYDSYNNICHEDVEILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATM-RHKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVGEFDTCIGNFH-HPKSVLSMEFQFLRAVTGCADGKIRIWNILNGHCIRVIRGNSRSDPILNLVVKDDTLI 2035
            Q  I  N  RG   S KV+K  + H     +F G R              I+SGS D +++ W   TGKCL+  +GH+G +      E I  SGS D T K+W  +      T+  H   +  + + EK  VSG     ++VW+I+ G  +  L GH   +  ++ D   ++S + D  V +W    E +TC+     H   V S++F  +  V+G  D  IR+W++  G+CI  + G+      + L  KD+ L+
Sbjct:  204 QHRIDTNWRRGDLKSPKVLKGHDDHVITCLQFCGNR--------------IVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRENIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDP--ETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMEL--KDNILV 441          

HSP 2 Score: 97.4413 bits (241), Expect = 2.266e-20
Identity = 55/188 (29.26%), Postives = 96/188 (51.06%), Query Frame = 2
Query: 1424 ILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSF-ATMRHKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVGEFDTCIGNFHHPKSVLS-MEFQFLRAVTGCADGKIRIWNILNGHCIRVIRG 1981
            I+SGS D +++ W+  TG+C+    GH+ T+  +   E+   SGS D T ++W  +        M H   +  V    +  VSG    ++KVW+ +    + +L GH   + +++ D  H++S SLD  + +W    E   CI      +S+ S ME +    V+G AD  ++IW+I  G C++ ++G
Sbjct:  280 IISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDV--ETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQG 465          

HSP 3 Score: 88.1965 bits (217), Expect = 1.691e-17
Identity = 94/438 (21.46%), Postives = 176/438 (40.18%), Query Frame = 2
Query:  680 NFAVDFISNLPVHISKRIINFLDEKSLNVCSKVCEIWQQIVYEVRREDIVNAKIKKQAMMLQSQKDESKSVFTAPADPRFARDTNVRVPQLEPHSHRIIYINNSPPHTTNKDTYQIDNFNELELINSRKVFSMDVAYQNILTKKLIIEERNIFCGSYSVMIILESQSRNRDPLRTISYNGGLLVAVSGTNKIIQFLDKRGI-----QTEIMKNSIRGHAGSIKVVKFLNKHNKKFFGKRTYDSYNNICHEDVEILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATMR-HKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLW--STVGEFDTCIGNFHHPKSVLSMEFQFLRAVTGCADGKIRIWNILNGHCIR 1969
             F  DFIS LP  ++  +++FL+ K L   ++ C  W               +I  +  +L  +K   + +   P  P+  +  NV+               +SP  +     ++ID       + S KV      + + +   L      I  GS    + + S    +     + + GG+  +    N II     R +     +T    +++ GH  +++ +     H K+                   ++SGS D ++R WD  TG+CL + +GH   +  +        SG+YD   K+W  + +    T++ H + + ++       VSG     I+VW+++ G  I +L+GH    S + L    ++S + D+ V +W   T     T  G   H  +V  ++F     +T   DG +++W++  G  IR
Sbjct:  121 QFQRDFISLLPKELALYVLSFLEPKDLLQAAQTCRYW---------------RILAEDNLLWREKCREEGI-DEPLAPK--KRGNVKAG-----------FTHSPWKSAYIRQHRIDTNWRRGDLKSPKVLK---GHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRENIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHL---HEKR-------------------VVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGPHKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIR 504          

HSP 4 Score: 60.8474 bits (146), Expect = 5.428e-9
Identity = 42/169 (24.85%), Postives = 77/169 (45.56%), Query Frame = 2
Query: 1580 WRYDEKNSFATMRH--KHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVGEFDTCIGNFH-HPKSVLSMEFQFLRAVTGCADGKIRIWNILNGHCIRVIRGNSRSDPILNLVVKDDTLIINTVSNILVLNFEP 2077
            WR  +  S   ++    H IT +       VSG     +KVW+   G  +++L GH   + + ++    I+S S D  + +W+   E   CI   + H  +V  M     R V+G  D  +R+W+I  G C+ V+ G+  +   +  V  D   +++   + +V  ++P
Sbjct:  211 WRRGDLKSPKVLKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRENIIISGSTDRTLKVWN--AETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGHVAA---VRCVQYDGRRVVSGAYDFMVKVWDP 374          
BLAST of F-box/WD repeat-containing protein 10 vs. Ensembl Medaka
Match: fbxw11a (F-box and WD repeat domain containing 11 [Source:NCBI gene;Acc:101174029])

HSP 1 Score: 100.138 bits (248), Expect = 2.493e-21
Identity = 63/219 (28.77%), Postives = 111/219 (50.68%), Query Frame = 2
Query: 1349 NKHNKKFFGKRTYDSYNNIC--HEDVEILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATM-RHKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYI---KSLSGHFKEISAIRLDSWHILSASLDNFVMLWST-VGEFDTCIGNFHHPKSVLSMEFQFLRAVTGCADGKIRIWNILNGHCIRVIRGN 1984
             +HN +    R+ +S    C  ++D +I+SG  D SI+ WD  T +CLKI  GH+G++  +   E +  +GS D T ++W         T+  H   +  +  +  L V+      I VW++ +   I   + L GH   ++ +  D  +I+SAS D  + +WST   EF   +    H + +  ++++    V+G +D  IR+W+I  G C+RV+ G+
Sbjct:  211 GRHNLQRIQCRSENSKGVYCLQYDDEKIISGLRDNSIKIWDKQTLECLKILTGHTGSVLCLQYDERVIVTGSSDSTVRVWEVTTGEVLNTLIHHNEAVLHLRFANGLMVTCSKDRSIAVWDMASPTDISLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWSTSTCEFVRTLNG--HKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGH 427          

HSP 2 Score: 80.8777 bits (198), Expect = 3.600e-15
Identity = 71/307 (23.13%), Postives = 134/307 (43.65%), Query Frame = 2
Query: 1124 ERNIFCGSYSVMIILESQSRNRDPLRTISYNGGLLVAVSGTNKIIQFLDKRGIQTEIMKNSIRGHAGSIKVVKFLNK--------HNKKFFGKRTYDSYNNICHEDVEIL----------SGSYDTSIRRWDTFTGKCL---KIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATMR-HKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVGEFDT-------CIGNF-HHPKSVLSMEFQFLRAVTGCADGKIRIWNILN 1954
            E N  CG +++  I + +S N   +  + Y+   +++    N I +  DK+ +  E +K  + GH GS+  +++  +           + +   T +  N + H +  +L          + S D SI  WD  +   +   ++ +GH   ++ +D  ++   S S D T K+W         T+  HK  I  +   ++L VSG S   I++W+I+ G  ++ L GH + +  IR D+  I+S + D  + +W      D        C+     H   V  ++F   + ++   D  I IW+ LN
Sbjct:  205 EANWRCGRHNLQRI-QCRSENSKGVYCLQYDDEKIISGLRDNSI-KIWDKQTL--ECLK-ILTGHTGSVLCLQYDERVIVTGSSDSTVRVWEVTTGEVLNTLIHHNEAVLHLRFANGLMVTCSKDRSIAVWDMASPTDISLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWSTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAALDPRAPASTLCLRTLVEHSGRVFRLQFDEFQIISSSHDDTILIWDFLN 506          
BLAST of F-box/WD repeat-containing protein 10 vs. Ensembl Medaka
Match: fbxw11a (F-box and WD repeat domain containing 11 [Source:NCBI gene;Acc:101174029])

HSP 1 Score: 100.138 bits (248), Expect = 3.330e-21
Identity = 63/219 (28.77%), Postives = 111/219 (50.68%), Query Frame = 2
Query: 1349 NKHNKKFFGKRTYDSYNNIC--HEDVEILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATM-RHKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYI---KSLSGHFKEISAIRLDSWHILSASLDNFVMLWST-VGEFDTCIGNFHHPKSVLSMEFQFLRAVTGCADGKIRIWNILNGHCIRVIRGN 1984
             +HN +    R+ +S    C  ++D +I+SG  D SI+ WD  T +CLKI  GH+G++  +   E +  +GS D T ++W         T+  H   +  +  +  L V+      I VW++ +   I   + L GH   ++ +  D  +I+SAS D  + +WST   EF   +    H + +  ++++    V+G +D  IR+W+I  G C+RV+ G+
Sbjct:  246 GRHNLQRIQCRSENSKGVYCLQYDDEKIISGLRDNSIKIWDKQTLECLKILTGHTGSVLCLQYDERVIVTGSSDSTVRVWEVTTGEVLNTLIHHNEAVLHLRFANGLMVTCSKDRSIAVWDMASPTDISLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWSTSTCEFVRTLNG--HKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGH 462          

HSP 2 Score: 80.8777 bits (198), Expect = 3.827e-15
Identity = 71/307 (23.13%), Postives = 134/307 (43.65%), Query Frame = 2
Query: 1124 ERNIFCGSYSVMIILESQSRNRDPLRTISYNGGLLVAVSGTNKIIQFLDKRGIQTEIMKNSIRGHAGSIKVVKFLNK--------HNKKFFGKRTYDSYNNICHEDVEIL----------SGSYDTSIRRWDTFTGKCL---KIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATMR-HKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVGEFDT-------CIGNF-HHPKSVLSMEFQFLRAVTGCADGKIRIWNILN 1954
            E N  CG +++  I + +S N   +  + Y+   +++    N I +  DK+ +  E +K  + GH GS+  +++  +           + +   T +  N + H +  +L          + S D SI  WD  +   +   ++ +GH   ++ +D  ++   S S D T K+W         T+  HK  I  +   ++L VSG S   I++W+I+ G  ++ L GH + +  IR D+  I+S + D  + +W      D        C+     H   V  ++F   + ++   D  I IW+ LN
Sbjct:  240 EANWRCGRHNLQRI-QCRSENSKGVYCLQYDDEKIISGLRDNSI-KIWDKQTL--ECLK-ILTGHTGSVLCLQYDERVIVTGSSDSTVRVWEVTTGEVLNTLIHHNEAVLHLRFANGLMVTCSKDRSIAVWDMASPTDISLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWSTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAALDPRAPASTLCLRTLVEHSGRVFRLQFDEFQIISSSHDDTILIWDFLN 541          
BLAST of F-box/WD repeat-containing protein 10 vs. Ensembl Medaka
Match: ENSORLT00000003546.2 (F-box/WD repeat-containing protein 7 [Source:NCBI gene;Acc:101171440])

HSP 1 Score: 90.5077 bits (223), Expect = 2.914e-18
Identity = 52/189 (27.51%), Postives = 86/189 (45.50%), Query Frame = 2
Query: 1424 ILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATM-RHKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVGEFDTCIGNFH-HPKSVLSMEFQFLRAVTGCADGKIRIWNILNGHCIRVIRGN 1984
            I+SGS D +++ W   TGKCL+   GH+G +           SGS D T ++W  +      T+  H   +  + +     VSG     ++VWN+  G     L+GH   +  ++ D   ++S   D  V +W    E + C+     H   V S++F     V+G  D  IR+W+   G C+  + G+
Sbjct:  239 IVSGSDDNTLKVWSAVTGKCLQTLTGHTGGVWCSQMAVATVISGSTDRTLRVWDAESGECVHTLYGHTSTVRCMHLHGNRVVSGSRDTTLRVWNVTTGQCEHVLTGHVAAVRCVQYDGRRVVSGGYDYMVKVWDP--ETEVCLHTLQGHTNRVYSLQFDGAFVVSGSLDTSIRVWDAETGGCVHTLTGH 425          

HSP 2 Score: 86.6557 bits (213), Expect = 5.421e-17
Identity = 52/188 (27.66%), Postives = 92/188 (48.94%), Query Frame = 2
Query: 1424 ILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATMR-HKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVGEFDTCIGNFHHPKSVLS-MEFQFLRAVTGCADGKIRIWNILNGHCIRVIRG 1981
            ++SGS D ++R WD  +G+C+    GH+ T+  +        SGS D T ++W          +  H   +  V    +  VSG    ++KVW+ +  V + +L GH   + +++ D   ++S SLD  + +W    E   C+      +S+ S ME +    V+G AD  +R+W+I  G C+  ++G
Sbjct:  279 VISGSTDRTLRVWDAESGECVHTLYGHTSTVRCMHLHGNRVVSGSRDTTLRVWNVTTGQCEHVLTGHVAAVRCVQYDGRRVVSGGYDYMVKVWDPETEVCLHTLQGHTNRVYSLQFDGAFVVSGSLDTSIRVWDA--ETGGCVHTLTGHQSLTSGMELRDNILVSGNADSTVRVWDIRTGLCLHTLQG 464          

HSP 3 Score: 82.8037 bits (203), Expect = 9.658e-16
Identity = 93/480 (19.38%), Postives = 186/480 (38.75%), Query Frame = 2
Query:  680 NFAVDFISNLPVHISKRIINFLDEKSLNVCSKVCEIWQQIVYE--VRREDIVNAKIKKQAMMLQSQKDESKSVFTAPADPRFARDTNVRVPQLEPHSHRIIYINNSPPHTTNKDTYQIDNFNELELINSRKVFSMDVAYQNILTKKLIIEERNIFCGSYSVMIILESQSRNRDPLRTISYNGGLLVAVSGTNKIIQFLDKRGIQTEIMKNSIRGHAGSIKVVKFLNKHNKKFFGKRTYDSYNNICHEDVEILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCKLWRYDEKNSFATMR-HKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWS--TVGEFDTCIGNFHHPKSVLSMEFQFLRAVTGCADGKIRIWNILNGHCIR-VIRGNSR-SDPILNLVVKDDTLIINTV--------SNILVLNFE 2074
             F  DFIS LP  ++  ++ FL  + L   ++ C  W+ +  +  + RE      I + A   + +     +   +P    + R   +     +  +   + +     H      +  D        N+ KV+S   A      + L      ++C   +V  ++ S S +R  LR      G  V                       +++ GH  +++ +     H  +                   ++SGS DT++R W+  TG+C  +  GH   +  +        SG YD   K+W  + +    T++ H + + ++       VSG     I+VW+ + G  + +L+GH    S + L    ++S + D+ V +W   T     T  G   H  +V  ++F     ++   DG +++W++  G  +R V+   SR S  ++  +   DT ++           + +L+++F+
Sbjct:  119 QFQRDFISLLPKELALYVLTFLPPRDLLRAAQTCRYWRILAEDNLLWREKCREEGISESASYRRRESVRPSAAAVSPWKSAYIRQHRIETNWRKGDTGEPMVLKGHDDHVITCLQFSGDLIVSGSDDNTLKVWS---AVTGKCLQTLTGHTGGVWCSQMAVATVI-SGSTDR-TLRVWDAESGECV-----------------------HTLYGHTSTVRCMHL---HGNR-------------------VVSGSRDTTLRVWNVTTGQCEHVLTGHVAAVRCVQYDGRRVVSGGYDYMVKVWDPETEVCLHTLQGHTNRVYSLQFDGAFVVSGSLDTSIRVWDAETGGCVHTLTGHQSLTSGMELRDNILVSGNADSTVRVWDIRTGLCLHTLQGPNKHQSAVTCLQFCRGLVLSSSDDGTVKLWDLRTGAWLRDVVALQSRGSGGVVWRIKASDTRLVCAAGSRNGTEETKLLIMDFD 548          
BLAST of F-box/WD repeat-containing protein 10 vs. Planmine SMEST
Match: SMESG000002351.1 (SMESG000002351.1)

HSP 1 Score: 1143.26 bits (2956), Expect = 0.000e+0
Identity = 564/567 (99.47%), Postives = 565/567 (99.65%), Query Frame = 2
Query: 1613 MRHKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVGEFDTCIGNFHHPKSVLSMEFQFLRAVTGCADGKIRIWNILNGHCIRVIRGNSRSDPILNLVVKDDTLIINTVSNILVLNFEPIDWMYENGKDYTLNQPSCSLSLPENKKSQIKRNNFRHISQRCERSRLAGNIDPRIFITPNTEGLEMNSKCLLSNQEFSYARSFENGNPMTRSTAWHVSPSFYKSQNHSMKPPLHKSKDLVDSVEDNKFTTESRINLVKXXXXXXXXXXXXYGFERQDHLLIDSDLQEIKQTLRNHIRSPPQIAAEAMPEFIKTMVSQLKTSNLTGRSVSAFSLNRFVRPSSGPSKIDSKSKIGFEEMKAVVSPLTQQTVKDFSETINPKNHSKNQINQPVNEENIWKPVFSSNFKTSNNSISQSKFGSFFIPPDYRQRLAEKKFEFDQKHHSNVNHQPINGGVETSKRSKCKLVVNDLNLQTFENAQQCFEQIEKRQVRYKMEQKSKIDKEYHLKWIKRATESPNIKFGKDALMKRPRSAKI 3313
            MRHKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVGEFDTCIGNFHHPKSVLSMEFQFLRAVTGCADGKIRIWNILNGHCIRVIRGNSRSDPILNLVVKDDTLIINTVSNILVLNFEPIDWMYENGKDYTLNQPS S+SLPENKKSQIKRNNFRHISQRCERSRLAGNIDPRIFITPNTEGLEMNSKCLLSNQEFSYARSFENGNPMTRSTAWHVSPSFYKSQNHSMKPPLHKSKDLVDSVEDNKFTTESRINLVKSTRVSQSTRRVSYGFERQDHLLIDSDLQEIKQTLRNHIRSPPQIAAEAMPEFIKTMVSQLKTSNLTGRSVSAFSLNRFVRPSSGPSKIDSKSKIGFEEMK VVSPLTQQTVKDFSETINPKNHSKNQINQPVNEENIWKPVFSSNFKTSNNSISQSKFGSFFIPPDYRQRLAEKKFEFDQKHHSNVNHQPINGGVETSKRSKCKLVVNDLNLQTFENAQQCFEQIEKRQVRYKMEQKSKIDKEYHLKWIKRATESPNIKFGKDALMKRPRSAKI
Sbjct:    1 MRHKHPITAVAISEKLCVSGDSLGLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVGEFDTCIGNFHHPKSVLSMEFQFLRAVTGCADGKIRIWNILNGHCIRVIRGNSRSDPILNLVVKDDTLIINTVSNILVLNFEPIDWMYENGKDYTLNQPSFSVSLPENKKSQIKRNNFRHISQRCERSRLAGNIDPRIFITPNTEGLEMNSKCLLSNQEFSYARSFENGNPMTRSTAWHVSPSFYKSQNHSMKPPLHKSKDLVDSVEDNKFTTESRINLVKSTRVSQSTRRVSYGFERQDHLLIDSDLQEIKQTLRNHIRSPPQIAAEAMPEFIKTMVSQLKTSNLTGRSVSAFSLNRFVRPSSGPSKIDSKSKIGFEEMKTVVSPLTQQTVKDFSETINPKNHSKNQINQPVNEENIWKPVFSSNFKTSNNSISQSKFGSFFIPPDYRQRLAEKKFEFDQKHHSNVNHQPINGGVETSKRSKCKLVVNDLNLQTFENAQQCFEQIEKRQVRYKMEQKSKIDKEYHLKWIKRATESPNIKFGKDALMKRPRSAKI 567          
BLAST of F-box/WD repeat-containing protein 10 vs. Planmine SMEST
Match: SMESG000002342.1 (SMESG000002342.1)

HSP 1 Score: 1049.65 bits (2713), Expect = 0.000e+0
Identity = 511/515 (99.22%), Postives = 513/515 (99.61%), Query Frame = 2
Query:   32 MDEHILKCLDSIEISKNNIFNGTIFICKENPNPNPCQNCITCKLVILKDFSVSLLNHMPDNDVINFITKCSKTESYTELTGVLQHILYPLKAKDRLYSLSRNVPSLNTDLSDFSIKNFTIDKAQLEYVTHRISNWISLQPDTFRIQFIISLLAHLKLAVLSEIYNAISTNKDSSTDSSYTSNEIINTDSDPVTLLQRVCKISANHIFEDKHSEKNNNFAVDFISNLPVHISKRIINFLDEKSLNVCSKVCEIWQQIVYEVRREDIVNAKIKKQAMMLQSQKDESKSVFTAPADPRFARDTNVRVPQLEPHSHRIIYINNSPPHTTNKDTYQIDNFNELELINSRKVFSMDVAYQNILTKKLIIEERNIFCGSYSVMIILESQSRNRDPLRTISYNGGLLVAVSGTNKIIQFLDKRGIQTEIMKNSIRGHAGSIKVVKFLNKHNKKFFGKRTYDSYNNICHEDVEILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCK 1576
            MDEHILKCLDSIEISKNNIFNGTIFICKENPNPNPCQNCITCKLVILKDFSVSLLNHMPDNDVINFITKCSKTESYTELTGVLQHILYPLKAKDRLYSLSRNVPSLNTDLSDFSIKNFTIDKAQLEYVTHRISNWISLQPDTFRIQFIISLLAHLKLAVLSEIYNAISTNKDSSTDSSYTSNEIINTDSDPVTLLQRVCKISANHIFEDKHSEKNNNFAVDFISNLPVHISKRIINFLDEKSLNVCSKVCEIWQQIVYEVRREDIVNAKIKKQAMMLQSQKDESKSVFTAPADPRFARDTNVRVPQLEPHSHRIIYINNSPPHTTNKDTYQIDNFNELELINSRK+FSMDVAYQNILTKKLIIEERNIFCGSYSVMIILESQSRNRDPLRTISYNGGLLVAVSGTNKIIQFLDKRGIQTEIMKNSIRGHAGSIKVVKFLNKHNKKFFG RTYDSYNNICHEDVEILSGSYDTSIRRWDTFTGKCLKIY+GHSGTISDID GEEIFASGSYDGTCK
Sbjct:    1 MDEHILKCLDSIEISKNNIFNGTIFICKENPNPNPCQNCITCKLVILKDFSVSLLNHMPDNDVINFITKCSKTESYTELTGVLQHILYPLKAKDRLYSLSRNVPSLNTDLSDFSIKNFTIDKAQLEYVTHRISNWISLQPDTFRIQFIISLLAHLKLAVLSEIYNAISTNKDSSTDSSYTSNEIINTDSDPVTLLQRVCKISANHIFEDKHSEKNNNFAVDFISNLPVHISKRIINFLDEKSLNVCSKVCEIWQQIVYEVRREDIVNAKIKKQAMMLQSQKDESKSVFTAPADPRFARDTNVRVPQLEPHSHRIIYINNSPPHTTNKDTYQIDNFNELELINSRKIFSMDVAYQNILTKKLIIEERNIFCGSYSVMIILESQSRNRDPLRTISYNGGLLVAVSGTNKIIQFLDKRGIQTEIMKNSIRGHAGSIKVVKFLNKHNKKFFGNRTYDSYNNICHEDVEILSGSYDTSIRRWDTFTGKCLKIYLGHSGTISDIDTGEEIFASGSYDGTCK 515          
BLAST of F-box/WD repeat-containing protein 10 vs. Planmine SMEST
Match: SMESG000002342.1 (SMESG000002342.1)

HSP 1 Score: 1029.62 bits (2661), Expect = 0.000e+0
Identity = 504/515 (97.86%), Postives = 506/515 (98.25%), Query Frame = 2
Query:   32 MDEHILKCLDSIEISKNNIFNGTIFICKENPNPNPCQNCITCKLVILKDFSVSLLNHMPDNDVINFITKCSKTESYTELTGVLQHILYPLKAKDRLYSLSRNVPSLNTDLSDFSIKNFTIDKAQLEYVTHRISNWISLQPDTFRIQFIISLLAHLKLAVLSEIYNAISTNKDSSTDSSYTSNEIINTDSDPVTLLQRVCKISANHIFEDKHSEKNNNFAVDFISNLPVHISKRIINFLDEKSLNVCSKVCEIWQQIVYEVRREDIVNAKIKKQAMMLQSQKDESKSVFTAPADPRFARDTNVRVPQLEPHSHRIIYINNSPPHTTNKDTYQIDNFNELELINSRKVFSMDVAYQNILTKKLIIEERNIFCGSYSVMIILESQSRNRDPLRTISYNGGLLVAVSGTNKIIQFLDKRGIQTEIMKNSIRGHAGSIKVVKFLNKHNKKFFGKRTYDSYNNICHEDVEILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCK 1576
            MDEHILKCLDSIEISKNNIFNGTIFICKENPNPNPCQNCITCKLVILKDFSVSLLNHMPDNDVINFITKCSKTESYTELTGVLQHILYPLKAKDRLYSLSRNVPSLNTDLSDFSIKNFTIDKAQLEYVTHRISNWISLQPDTFRIQFIISLLAHLKLAVLSEIYNAISTNKDSSTDSSYTSNEIINTDSDPVTLLQRVCKISANHIFEDKHSEKNNNFAVDFISNLPVHISKRIINFLDEKSLNVCSKVCEIWQQIVYEVRREDIVNAKIKKQAMMLQ       SVFTAPADPRFARDTNVRVPQLEPHSHRIIYINNSPPHTTNKDTYQIDNFNELELINSRK+FSMDVAYQNILTKKLIIEERNIFCGSYSVMIILESQSRNRDPLRTISYNGGLLVAVSGTNKIIQFLDKRGIQTEIMKNSIRGHAGSIKVVKFLNKHNKKFFG RTYDSYNNICHEDVEILSGSYDTSIRRWDTFTGKCLKIY+GHSGTISDID GEEIFASGSYDGTCK
Sbjct:    1 MDEHILKCLDSIEISKNNIFNGTIFICKENPNPNPCQNCITCKLVILKDFSVSLLNHMPDNDVINFITKCSKTESYTELTGVLQHILYPLKAKDRLYSLSRNVPSLNTDLSDFSIKNFTIDKAQLEYVTHRISNWISLQPDTFRIQFIISLLAHLKLAVLSEIYNAISTNKDSSTDSSYTSNEIINTDSDPVTLLQRVCKISANHIFEDKHSEKNNNFAVDFISNLPVHISKRIINFLDEKSLNVCSKVCEIWQQIVYEVRREDIVNAKIKKQAMMLQ-------SVFTAPADPRFARDTNVRVPQLEPHSHRIIYINNSPPHTTNKDTYQIDNFNELELINSRKIFSMDVAYQNILTKKLIIEERNIFCGSYSVMIILESQSRNRDPLRTISYNGGLLVAVSGTNKIIQFLDKRGIQTEIMKNSIRGHAGSIKVVKFLNKHNKKFFGNRTYDSYNNICHEDVEILSGSYDTSIRRWDTFTGKCLKIYLGHSGTISDIDTGEEIFASGSYDGTCK 508          
BLAST of F-box/WD repeat-containing protein 10 vs. Planmine SMEST
Match: SMESG000002342.1 (SMESG000002342.1)

HSP 1 Score: 1003.82 bits (2594), Expect = 0.000e+0
Identity = 492/515 (95.53%), Postives = 495/515 (96.12%), Query Frame = 2
Query:   32 MDEHILKCLDSIEISKNNIFNGTIFICKENPNPNPCQNCITCKLVILKDFSVSLLNHMPDNDVINFITKCSKTESYTELTGVLQHILYPLKAKDRLYSLSRNVPSLNTDLSDFSIKNFTIDKAQLEYVTHRISNWISLQPDTFRIQFIISLLAHLKLAVLSEIYNAISTNKDSSTDSSYTSNEIINTDSDPVTLLQRVCKISANHIFEDKHSEKNNNFAVDFISNLPVHISKRIINFLDEKSLNVCSKVCEIWQQIVYEVRREDIVNAKIKKQAMMLQSQKDESKSVFTAPADPRFARDTNVRVPQLEPHSHRIIYINNSPPHTTNKDTYQIDNFNELELINSRKVFSMDVAYQNILTKKLIIEERNIFCGSYSVMIILESQSRNRDPLRTISYNGGLLVAVSGTNKIIQFLDKRGIQTEIMKNSIRGHAGSIKVVKFLNKHNKKFFGKRTYDSYNNICHEDVEILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCK 1576
            MDEHILKCLDSIEISKNNIFNGTIFICKENPNPNPCQNCITCKLVILKDFSVSLLNHMPDNDVINFITKCSKTESYTELTGVLQHILYPLKAKDRLYSLSRNVPSLNTDLSDFSIKNFTIDKAQLEYVTHRISNWISLQPDTFRIQFIISLLAHLKLAVLSEIYNAISTNKDSSTDSSYTSNEIINTDSDPVTLLQRVCKISANHIFEDKHSEKNNNFAVDFISNLPVHI                  +CEIWQQIVYEVRREDIVNAKIKKQAMMLQSQKDESKSVFTAPADPRFARDTNVRVPQLEPHSHRIIYINNSPPHTTNKDTYQIDNFNELELINSRK+FSMDVAYQNILTKKLIIEERNIFCGSYSVMIILESQSRNRDPLRTISYNGGLLVAVSGTNKIIQFLDKRGIQTEIMKNSIRGHAGSIKVVKFLNKHNKKFFG RTYDSYNNICHEDVEILSGSYDTSIRRWDTFTGKCLKIY+GHSGTISDID GEEIFASGSYDGTCK
Sbjct:    1 MDEHILKCLDSIEISKNNIFNGTIFICKENPNPNPCQNCITCKLVILKDFSVSLLNHMPDNDVINFITKCSKTESYTELTGVLQHILYPLKAKDRLYSLSRNVPSLNTDLSDFSIKNFTIDKAQLEYVTHRISNWISLQPDTFRIQFIISLLAHLKLAVLSEIYNAISTNKDSSTDSSYTSNEIINTDSDPVTLLQRVCKISANHIFEDKHSEKNNNFAVDFISNLPVHI------------------ICEIWQQIVYEVRREDIVNAKIKKQAMMLQSQKDESKSVFTAPADPRFARDTNVRVPQLEPHSHRIIYINNSPPHTTNKDTYQIDNFNELELINSRKIFSMDVAYQNILTKKLIIEERNIFCGSYSVMIILESQSRNRDPLRTISYNGGLLVAVSGTNKIIQFLDKRGIQTEIMKNSIRGHAGSIKVVKFLNKHNKKFFGNRTYDSYNNICHEDVEILSGSYDTSIRRWDTFTGKCLKIYLGHSGTISDIDTGEEIFASGSYDGTCK 497          
BLAST of F-box/WD repeat-containing protein 10 vs. Planmine SMEST
Match: SMESG000002342.1 (SMESG000002342.1)

HSP 1 Score: 932.939 bits (2410), Expect = 0.000e+0
Identity = 454/458 (99.13%), Postives = 456/458 (99.56%), Query Frame = 2
Query:  203 MPDNDVINFITKCSKTESYTELTGVLQHILYPLKAKDRLYSLSRNVPSLNTDLSDFSIKNFTIDKAQLEYVTHRISNWISLQPDTFRIQFIISLLAHLKLAVLSEIYNAISTNKDSSTDSSYTSNEIINTDSDPVTLLQRVCKISANHIFEDKHSEKNNNFAVDFISNLPVHISKRIINFLDEKSLNVCSKVCEIWQQIVYEVRREDIVNAKIKKQAMMLQSQKDESKSVFTAPADPRFARDTNVRVPQLEPHSHRIIYINNSPPHTTNKDTYQIDNFNELELINSRKVFSMDVAYQNILTKKLIIEERNIFCGSYSVMIILESQSRNRDPLRTISYNGGLLVAVSGTNKIIQFLDKRGIQTEIMKNSIRGHAGSIKVVKFLNKHNKKFFGKRTYDSYNNICHEDVEILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDAGEEIFASGSYDGTCK 1576
            MPDNDVINFITKCSKTESYTELTGVLQHILYPLKAKDRLYSLSRNVPSLNTDLSDFSIKNFTIDKAQLEYVTHRISNWISLQPDTFRIQFIISLLAHLKLAVLSEIYNAISTNKDSSTDSSYTSNEIINTDSDPVTLLQRVCKISANHIFEDKHSEKNNNFAVDFISNLPVHISKRIINFLDEKSLNVCSKVCEIWQQIVYEVRREDIVNAKIKKQAMMLQSQKDESKSVFTAPADPRFARDTNVRVPQLEPHSHRIIYINNSPPHTTNKDTYQIDNFNELELINSRK+FSMDVAYQNILTKKLIIEERNIFCGSYSVMIILESQSRNRDPLRTISYNGGLLVAVSGTNKIIQFLDKRGIQTEIMKNSIRGHAGSIKVVKFLNKHNKKFFG RTYDSYNNICHEDVEILSGSYDTSIRRWDTFTGKCLKIY+GHSGTISDID GEEIFASGSYDGTCK
Sbjct:    1 MPDNDVINFITKCSKTESYTELTGVLQHILYPLKAKDRLYSLSRNVPSLNTDLSDFSIKNFTIDKAQLEYVTHRISNWISLQPDTFRIQFIISLLAHLKLAVLSEIYNAISTNKDSSTDSSYTSNEIINTDSDPVTLLQRVCKISANHIFEDKHSEKNNNFAVDFISNLPVHISKRIINFLDEKSLNVCSKVCEIWQQIVYEVRREDIVNAKIKKQAMMLQSQKDESKSVFTAPADPRFARDTNVRVPQLEPHSHRIIYINNSPPHTTNKDTYQIDNFNELELINSRKIFSMDVAYQNILTKKLIIEERNIFCGSYSVMIILESQSRNRDPLRTISYNGGLLVAVSGTNKIIQFLDKRGIQTEIMKNSIRGHAGSIKVVKFLNKHNKKFFGNRTYDSYNNICHEDVEILSGSYDTSIRRWDTFTGKCLKIYLGHSGTISDIDTGEEIFASGSYDGTCK 458          
The following BLAST results are available for this feature:
BLAST of F-box/WD repeat-containing protein 10 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FBXW105.089e-9236.40F-box and WD repeat domain containing 10 [Source:H... [more]
FBXW102.052e-8634.27F-box and WD repeat domain containing 10 [Source:H... [more]
CDRT11.074e-8535.05CMT1A duplicated region transcript 1 [Source:HGNC ... [more]
CDRT11.115e-8435.32CMT1A duplicated region transcript 1 [Source:HGNC ... [more]
FBXW101.109e-6434.64F-box and WD repeat domain containing 10 [Source:H... [more]
back to top
BLAST of F-box/WD repeat-containing protein 10 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lin-234.998e-1821.53F-box/WD repeat-containing protein lin-23 [Source... [more]
lin-235.374e-1821.53F-box/WD repeat-containing protein lin-23 [Source... [more]
lin-237.224e-1820.50F-box/WD repeat-containing protein lin-23 [Source... [more]
lin-237.224e-1820.50F-box/WD repeat-containing protein lin-23 [Source... [more]
lin-237.447e-1821.53F-box/WD repeat-containing protein lin-23 [Source... [more]
back to top
BLAST of F-box/WD repeat-containing protein 10 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ago8.227e-2229.63gene:FBgn0041171 transcript:FBtr0073246[more]
ago8.227e-2229.63gene:FBgn0041171 transcript:FBtr0073245[more]
ago8.227e-2229.63gene:FBgn0041171 transcript:FBtr0073247[more]
slmb7.285e-2023.09gene:FBgn0283468 transcript:FBtr0084032[more]
slmb7.285e-2023.09gene:FBgn0283468 transcript:FBtr0333931[more]
back to top
BLAST of F-box/WD repeat-containing protein 10 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fbxw102.555e-7834.29F-box and WD repeat domain containing 10 [Source:Z... [more]
CR381538.11.919e-2529.30F-box and WD repeat domain containing 7 [Source:NC... [more]
AL954386.12.231e-2529.30F-box and WD repeat domain containing 7 [Source:NC... [more]
fbxw72.324e-2529.30F-box and WD repeat domain containing 7 [Source:ZF... [more]
fbxw73.021e-2529.30F-box and WD repeat domain containing 7 [Source:ZF... [more]
back to top
BLAST of F-box/WD repeat-containing protein 10 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptbp28.719e-9728.97polypyrimidine tract binding protein 2 [Source:Xen... [more]
ptbp22.040e-7837.68polypyrimidine tract binding protein 2 [Source:Xen... [more]
ENSXETT00000008237.11.662e-2529.30F-box and WD repeat domain containing 7 [Source:NC... [more]
ENSXETT00000008205.12.022e-2529.30F-box and WD repeat domain containing 7 [Source:NC... [more]
ENSXETT00000008111.12.494e-2529.30F-box and WD repeat domain containing 7 [Source:NC... [more]
back to top
BLAST of F-box/WD repeat-containing protein 10 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Fbxw107.602e-8834.89F-box and WD-40 domain protein 10 [Source:MGI Symb... [more]
Fbxw104.915e-8634.69F-box and WD-40 domain protein 10 [Source:MGI Symb... [more]
Fbxw107.043e-8434.32F-box and WD-40 domain protein 10 [Source:MGI Symb... [more]
Fbxw107.234e-7734.33F-box and WD-40 domain protein 10 [Source:MGI Symb... [more]
Fbxw79.665e-2629.30F-box and WD-40 domain protein 7 [Source:MGI Symbo... [more]
back to top
BLAST of F-box/WD repeat-containing protein 10 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5XX13|FBW10_HUMAN2.444e-9136.40F-box/WD repeat-containing protein 10 OS=Homo sapi... [more]
sp|Q5SUS0|FBW10_MOUSE5.318e-8734.89F-box/WD repeat-containing protein 10 OS=Mus muscu... [more]
sp|O95170|CDRT1_HUMAN5.355e-8435.32CMT1A duplicated region transcript 1 protein OS=Ho... [more]
sp|Q8VBV4|FBXW7_MOUSE6.761e-2529.30F-box/WD repeat-containing protein 7 OS=Mus muscul... [more]
sp|D3Z902|FBXW7_RAT6.826e-2529.30F-box/WD repeat-containing protein 7 OS=Rattus nor... [more]
back to top
BLAST of F-box/WD repeat-containing protein 10 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
R7TCY21.155e-10740.13WD_REPEATS_REGION domain-containing protein (Fragm... [more]
A0A267GEZ82.655e-10632.58WD_REPEATS_REGION domain-containing protein (Fragm... [more]
A0A267GFD16.622e-10632.44WD_REPEATS_REGION domain-containing protein (Fragm... [more]
A0A267GET07.295e-10632.44WD_REPEATS_REGION domain-containing protein (Fragm... [more]
A0A2C9MA436.652e-10531.27WD_REPEATS_REGION domain-containing protein OS=Bio... [more]
back to top
BLAST of F-box/WD repeat-containing protein 10 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fbxw101.226e-8032.07CMT1A duplicated region transcript 1 protein [Sour... [more]
fbxw101.308e-5529.40CMT1A duplicated region transcript 1 protein [Sour... [more]
fbxw71.310e-2529.30F-box and WD repeat domain containing 7 [Source:NC... [more]
fbxw71.720e-2529.30F-box and WD repeat domain containing 7 [Source:NC... [more]
fbxw11b1.511e-2028.31F-box/WD repeat-containing protein 11-like [Source... [more]
back to top
BLAST of F-box/WD repeat-containing protein 10 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000436.11.010e-5031.30pep scaffold:Pmarinus_7.0:GL480679:1850:10097:-1 g... [more]
ENSPMAT00000008862.12.357e-2327.83pep scaffold:Pmarinus_7.0:GL476579:86637:114999:1 ... [more]
BTRC2.038e-1526.98beta-transducin repeat containing E3 ubiquitin pro... [more]
pafah1b1b4.325e-1226.98platelet-activating factor acetylhydrolase 1b, reg... [more]
utp155.495e-1225.85UTP15 small subunit processome component [Source:N... [more]
back to top
BLAST of F-box/WD repeat-containing protein 10 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
MET301.828e-1823.20F-box protein containing five copies of the WD40 m... [more]
MDV17.673e-1226.97Peripheral protein of cytosolic face of mitochondr... [more]
PWP23.115e-1027.50Conserved 90S pre-ribosomal component; essential f... [more]
CAF41.247e-925.00WD40 repeat-containing protein associated with the... [more]
PRP462.566e-827.23Member of the NineTeen Complex (NTC); this complex... [more]
back to top
BLAST of F-box/WD repeat-containing protein 10 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO298861.061e-3238.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO423062.230e-2230.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO487201.846e-1927.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO348651.880e-1831.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO440933.935e-1723.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of F-box/WD repeat-containing protein 10 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fbxw74.476e-2629.69F-box and WD repeat domain containing 7 [Source:NC... [more]
fbxw71.034e-2529.69F-box and WD repeat domain containing 7 [Source:NC... [more]
fbxw11a2.493e-2128.77F-box and WD repeat domain containing 11 [Source:N... [more]
fbxw11a3.330e-2128.77F-box and WD repeat domain containing 11 [Source:N... [more]
ENSORLT00000003546.22.914e-1827.51F-box/WD repeat-containing protein 7 [Source:NCBI ... [more]
back to top
BLAST of F-box/WD repeat-containing protein 10 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000002351.10.000e+099.47SMESG000002351.1[more]
SMESG000002342.10.000e+099.22SMESG000002342.1[more]
SMESG000002342.10.000e+097.86SMESG000002342.1[more]
SMESG000002342.10.000e+095.53SMESG000002342.1[more]
SMESG000002342.10.000e+099.13SMESG000002342.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011948 ID=SMED30011948|Name=F-box/WD repeat-containing protein 10|organism=Schmidtea mediterranea sexual|type=transcript|length=3386bp
TATAAATCTTATATGAAAATTAAAATTGTTCATGGATGAACATATTCTAA
AATGCTTAGACAGCATTGAAATAAGTAAAAATAATATTTTTAATGGAACA
ATCTTTATTTGTAAGGAGAATCCAAATCCAAATCCTTGTCAAAATTGTAT
AACTTGTAAGTTAGTTATTCTAAAAGACTTCAGTGTATCTTTACTTAACC
ATATGCCTGACAACGATGTAATTAATTTCATCACAAAATGTTCGAAAACC
GAATCTTACACAGAACTAACTGGTGTTTTGCAACATATTCTTTATCCACT
GAAAGCTAAAGATCGATTATATTCATTATCCAGAAATGTACCAAGCCTTA
ATACAGATCTGTCTGATTTTAGTATAAAAAACTTCACTATTGATAAAGCT
CAATTAGAGTATGTTACTCACCGAATTTCAAATTGGATATCACTACAGCC
GGATACTTTTCGAATTCAATTTATTATTTCATTGCTTGCTCATCTAAAAT
TGGCCGTTCTTTCAGAAATATATAACGCAATCAGCACCAATAAAGATTCC
TCAACAGATTCATCATATACCTCGAATGAAATCATTAACACTGACTCTGA
TCCGGTGACTCTTTTACAGAGAGTTTGCAAAATTTCAGCTAACCATATCT
TCGAAGACAAACATTCTGAAAAGAACAATAACTTCGCCGTTGATTTCATA
TCAAATCTTCCAGTACATATAAGTAAACGAATTATTAACTTTTTGGATGA
AAAATCGCTAAATGTCTGTTCCAAAGTATGTGAAATTTGGCAGCAAATAG
TTTACGAAGTTAGAAGAGAAGATATTGTTAATGCGAAAATCAAAAAACAA
GCTATGATGTTACAAAGTCAAAAAGATGAATCAAAATCAGTATTCACTGC
CCCAGCTGATCCTAGATTCGCTAGAGACACAAACGTTAGAGTTCCACAAC
TTGAGCCCCATTCACATAGAATAATATATATAAATAATTCTCCACCACAT
ACTACGAATAAAGATACTTATCAAATTGATAATTTCAACGAATTGGAGTT
GATAAATTCTCGAAAGGTTTTCAGTATGGATGTGGCCTACCAGAATATTT
TGACGAAAAAGCTAATTATTGAAGAAAGAAATATATTCTGTGGAAGTTAT
AGTGTTATGATAATTTTAGAAAGCCAATCAAGAAATAGAGACCCGTTGCG
TACTATATCATATAATGGAGGTTTGTTGGTTGCTGTTTCTGGAACAAATA
AAATTATCCAGTTTCTTGATAAAAGAGGTATCCAAACTGAAATTATGAAA
AATAGCATTCGTGGACACGCAGGCTCAATCAAAGTTGTGAAATTTTTAAA
TAAACATAACAAAAAATTTTTCGGCAAAAGAACTTATGATAGTTACAATA
ATATCTGTCATGAAGATGTAGAAATTCTATCTGGGAGTTATGATACATCA
ATTAGAAGATGGGACACATTTACTGGCAAGTGTCTAAAAATTTATATTGG
ACATTCGGGAACTATTTCAGATATAGATGCTGGTGAAGAAATTTTCGCGT
CAGGAAGTTATGATGGAACTTGCAAATTGTGGCGATACGATGAAAAAAAT
AGTTTTGCTACAATGCGCCACAAGCATCCAATCACAGCTGTGGCAATATC
CGAGAAATTATGCGTATCAGGTGATTCGCTGGGACTAATTAAAGTCTGGA
ATATTCAAAATGGCGTATATATTAAAAGTTTGTCAGGTCATTTTAAAGAG
ATTTCAGCAATACGACTCGACAGTTGGCATATTCTTTCGGCTAGTCTAGA
CAATTTTGTCATGCTGTGGAGCACTGTCGGGGAGTTTGACACTTGCATTG
GAAATTTTCATCACCCTAAATCAGTTCTCAGTATGGAGTTTCAATTCTTA
AGAGCTGTAACTGGATGTGCAGACGGAAAAATCCGAATTTGGAATATTCT
AAATGGACATTGCATTAGAGTTATTCGTGGAAATAGTAGATCGGATCCAA
TTTTGAATTTAGTTGTAAAAGATGATACACTGATTATTAATACAGTCTCG
AATATTTTGGTGCTAAATTTTGAACCAATAGATTGGATGTATGAAAACGG
CAAAGATTATACTTTAAACCAACCCTCGTGTTCTCTAAGCTTACCGGAAA
ACAAAAAATCTCAAATTAAAAGAAACAATTTCCGTCATATTTCACAACGA
TGTGAAAGATCTAGATTGGCAGGAAATATAGATCCAAGAATTTTTATTAC
TCCCAACACTGAAGGATTAGAAATGAATTCGAAATGTTTGCTTTCAAATC
AAGAATTTAGTTATGCGAGATCATTTGAAAATGGCAATCCTATGACTCGT
TCAACAGCCTGGCACGTTTCACCAAGTTTTTATAAATCTCAGAATCATTC
GATGAAACCACCACTACACAAATCAAAGGATCTTGTAGACTCAGTTGAAG
ATAATAAGTTCACTACCGAGTCGCGTATTAATTTAGTGAAAAGTACCAGA
GTATCACAGTCAACTAGACGCGTCAGCTATGGATTTGAACGGCAAGATCA
CTTGTTGATTGATTCAGATTTGCAAGAAATCAAACAAACTCTTCGAAATC
ATATTCGTAGCCCTCCACAAATTGCAGCAGAAGCCATGCCAGAATTTATT
AAGACAATGGTTTCCCAATTAAAAACATCTAATTTGACAGGACGTTCAGT
ATCAGCTTTTTCTTTAAATCGTTTCGTGAGACCTTCATCTGGACCGAGTA
AAATTGATTCAAAGTCTAAAATTGGATTTGAAGAAATGAAAGCGGTCGTG
TCCCCTTTAACTCAACAAACTGTGAAAGATTTTTCAGAAACCATAAATCC
TAAAAATCATTCAAAGAACCAAATCAATCAACCAGTAAATGAGGAGAACA
TTTGGAAGCCTGTCTTTTCTTCTAATTTTAAAACTTCAAATAATTCCATC
AGTCAGTCGAAGTTTGGATCCTTTTTTATTCCACCAGATTATCGTCAAAG
ATTAGCCGAAAAAAAATTTGAATTCGATCAAAAACATCACTCAAATGTCA
ATCATCAACCAATAAATGGCGGCGTTGAAACTTCCAAAAGGTCTAAATGT
AAACTTGTTGTCAACGATTTGAATTTACAGACTTTTGAAAATGCACAACA
ATGTTTTGAGCAAATTGAAAAGAGGCAAGTCAGATACAAAATGGAACAAA
AGTCCAAAATTGACAAGGAATATCATTTAAAATGGATTAAAAGAGCCACA
GAATCCCCAAACATAAAGTTTGGTAAAGATGCTTTGATGAAAAGACCAAG
ATCAGCTAAAATATAATCCGTTTCAATCGGTTTTTATAATTTCGCGCTAT
CGTATTAAACAAAAATTTTTAAATATAACTCTATTG
back to top

protein sequence of SMED30011948-orf-1

>SMED30011948-orf-1 ID=SMED30011948-orf-1|Name=SMED30011948-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1095bp
MDEHILKCLDSIEISKNNIFNGTIFICKENPNPNPCQNCITCKLVILKDF
SVSLLNHMPDNDVINFITKCSKTESYTELTGVLQHILYPLKAKDRLYSLS
RNVPSLNTDLSDFSIKNFTIDKAQLEYVTHRISNWISLQPDTFRIQFIIS
LLAHLKLAVLSEIYNAISTNKDSSTDSSYTSNEIINTDSDPVTLLQRVCK
ISANHIFEDKHSEKNNNFAVDFISNLPVHISKRIINFLDEKSLNVCSKVC
EIWQQIVYEVRREDIVNAKIKKQAMMLQSQKDESKSVFTAPADPRFARDT
NVRVPQLEPHSHRIIYINNSPPHTTNKDTYQIDNFNELELINSRKVFSMD
VAYQNILTKKLIIEERNIFCGSYSVMIILESQSRNRDPLRTISYNGGLLV
AVSGTNKIIQFLDKRGIQTEIMKNSIRGHAGSIKVVKFLNKHNKKFFGKR
TYDSYNNICHEDVEILSGSYDTSIRRWDTFTGKCLKIYIGHSGTISDIDA
GEEIFASGSYDGTCKLWRYDEKNSFATMRHKHPITAVAISEKLCVSGDSL
GLIKVWNIQNGVYIKSLSGHFKEISAIRLDSWHILSASLDNFVMLWSTVG
EFDTCIGNFHHPKSVLSMEFQFLRAVTGCADGKIRIWNILNGHCIRVIRG
NSRSDPILNLVVKDDTLIINTVSNILVLNFEPIDWMYENGKDYTLNQPSC
SLSLPENKKSQIKRNNFRHISQRCERSRLAGNIDPRIFITPNTEGLEMNS
KCLLSNQEFSYARSFENGNPMTRSTAWHVSPSFYKSQNHSMKPPLHKSKD
LVDSVEDNKFTTESRINLVKSTRVSQSTRRVSYGFERQDHLLIDSDLQEI
KQTLRNHIRSPPQIAAEAMPEFIKTMVSQLKTSNLTGRSVSAFSLNRFVR
PSSGPSKIDSKSKIGFEEMKAVVSPLTQQTVKDFSETINPKNHSKNQINQ
PVNEENIWKPVFSSNFKTSNNSISQSKFGSFFIPPDYRQRLAEKKFEFDQ
KHHSNVNHQPINGGVETSKRSKCKLVVNDLNLQTFENAQQCFEQIEKRQV
RYKMEQKSKIDKEYHLKWIKRATESPNIKFGKDALMKRPRSAKI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0008270zinc ion binding
GO:0005515protein binding
GO:0004842ubiquitin-protein transferase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036322WD40_repeat_dom_sf
IPR036047F-box-like_dom_sf
IPR001680WD40_repeat
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR001810F-box_dom
IPR019775WD40_repeat_CS
IPR017986WD40_repeat_dom
Vocabulary: biological process
TermDefinition
GO:0000209protein polyubiquitination
Vocabulary: cellular component
TermDefinition
GO:0005829cytosol
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001680WD40 repeatSMARTSM00320WD40_4coord: 424..483
e-value: 12.0
score: 10.2
coord: 565..602
e-value: 0.052
score: 22.7
coord: 486..523
e-value: 2.9E-5
score: 33.5
coord: 526..562
e-value: 0.35
score: 19.8
coord: 607..643
e-value: 0.081
score: 22.0
IPR001680WD40 repeatPFAMPF00400WD40coord: 487..522
e-value: 1.3E-4
score: 22.7
coord: 610..643
e-value: 0.11
score: 13.4
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 631..652
score: 8.537
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 493..532
score: 10.007
IPR001810F-box domainPFAMPF00646F-boxcoord: 228..265
e-value: 1.2E-4
score: 21.9
IPR001810F-box domainPROSITEPS50181FBOXcoord: 225..275
score: 9.312
NoneNo IPR availableGENE3DG3DSA:1.20.1280.50coord: 219..308
e-value: 2.3E-8
score: 36.2
NoneNo IPR availablePANTHERPTHR19872:SF7CMT1A DUPLICATED REGION TRANSCRIPT 1 PROTEIN-RELATEDcoord: 463..936
NoneNo IPR availablePANTHERPTHR19872:SF7CMT1A DUPLICATED REGION TRANSCRIPT 1 PROTEIN-RELATEDcoord: 22..445
NoneNo IPR availablePANTHERPTHR19872UBIQUITIN LIGASE SPECIFICITY FACTOR/HREP PROTEINcoord: 22..445
NoneNo IPR availablePANTHERPTHR19872UBIQUITIN LIGASE SPECIFICITY FACTOR/HREP PROTEINcoord: 463..936
NoneNo IPR availableCDDcd00200WD40coord: 397..655
e-value: 2.88052E-38
score: 142.859
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 384..686
e-value: 4.8E-45
score: 155.6
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 630..644
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 470..652
score: 23.572
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 391..691
IPR036047F-box-like domain superfamilySUPERFAMILYSSF81383F-box domaincoord: 225..263