slc29a-2

Overview
Nameslc29a-2 (AKN21620.1)
Smed IDSMED30011936
Length (bp)2006
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc29a-2 (SMED30011936) t-SNE clustered cells

Violin plots show distribution of expression levels for slc29a-2 (SMED30011936) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc29a-2 (SMED30011936) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc29a-2 (SMED30011936) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011936

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30011936SMESG000078543.1 SmedASXL_014717SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30011936SMESG000078543.1 dd_Smed_v4_15290_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30011936SMESG000078543.1 dd_Smed_v6_15290_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
photoreceptor neuronSMED30011936SMESG000078543.1 SMED30011936smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30011936SMESG000078543.1 OX_Smed_1.0.11285ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc29a-2 vs. Ensembl Human
Match: SLC29A4 (solute carrier family 29 member 4 [Source:HGNC Symbol;Acc:HGNC:23097])

HSP 1 Score: 200.29 bits (508), Expect = 6.510e-56
Identity = 150/497 (30.18%), Postives = 253/497 (50.91%), Query Frame = 1
Query:  388 PKDPKNLIFFSLILSGVGFLFPYNCLINAADYFQLKYCNNHLIYSISVAYVLAAVTTVSLNNLIVQSVHFIRRIIFGYXXXXXXXXXXXXXXXWFHVLSKEASYYWIVVATIITAVGCSIQQSSFYGYSSLLPRRYTQALMIGESLSGVLASAFRISTFMLL--DRTPT-VYFFLCVGQMFICLIIFHISVRSGFVQHHLHRHQHNVLNVNSNSLIKSTHSLSYQINTPXXXXXXXXXXXXXXXXXXWTKTVSMEINNPAYAIEEDHLPQNEPPYLESSDDDEIEEAFDNDLESSDVDQSENSFSHLRKSSHTSKAIMINSRSTNQSNSAVINFLSNVKDGLKFRLQICKLIWPHMIAMFLAYFVTLSVFPGVVTDIESRKWKETFPLFVMLVFNISDFIGKICTSIFRKTKGICLFXXXXXXXXXXXXXXXXXXXHNAPVIYGDFWVLFLISILGLSNGYFGCQPMLQAPQIVKDNQKEVSGNLMTTAYSLGLSMG 1869
            P D  + I+F+++L+GVGFL PYN  I   DY   KY    +++ +S+ Y+L A+  V LNN++V+ +    RI  GY+LA+  +L ++I  +W  + S++ +Y   + A    A GC++QQSSFYGY+ +LP+RYTQ +M GES +GV+ S  RI T +LL  +R  T ++F + V    +C ++  +  RS FV  +  R + +  +     L +      Y+++                          +   +PA A+  +  P++ P + E +        FD  +    V +S  +F          +A++++                        R  + ++IW  M+++ + YF+TL +FPG+ ++I      E  P+ +M VFN+SDF+GKI  ++    +G  L  CS  R++ IPL I+C+ P   P +    W      ++G+SNGYFG  PM+ A   V   Q+E++GN MT +Y  GL++G
Sbjct:   63 PDDRYHAIYFAMLLAGVGFLLPYNSFITDVDYLHHKYPGTSIVFDMSLTYILVALAAVLLNNVLVERLTLHTRITAGYLLALGPLLFISICDVWLQLFSRDQAYAINLAAVGTVAFGCTVQQSSFYGYTGMLPKRYTQGVMTGESTAGVMISLSRILTKLLLPDERASTLIFFLVSVALELLCFLLHLLVRRSRFVLFYTTRPRDS--HRGRPGLGRG---YGYRVHHDVVAG-------------------DVHFEHPAPALAPNESPKDSPAH-EVTGSGGAYMRFD--VPRPRVQRSWPTF----------RALLLH------------------------RYVVARVIWADMLSIAVTYFITLCLFPGLESEIRHCILGEWLPILIMAVFNLSDFVGKILAALPVDWRGTHLLACSCLRVVFIPLFILCVYPSGMPALRHPAWPCIFSLLMGISNGYFGSVPMILAAGKVSPKQRELAGNTMTVSYMSGLTLG 498          
BLAST of slc29a-2 vs. Ensembl Human
Match: SLC29A4 (solute carrier family 29 member 4 [Source:HGNC Symbol;Acc:HGNC:23097])

HSP 1 Score: 200.29 bits (508), Expect = 6.510e-56
Identity = 150/497 (30.18%), Postives = 253/497 (50.91%), Query Frame = 1
Query:  388 PKDPKNLIFFSLILSGVGFLFPYNCLINAADYFQLKYCNNHLIYSISVAYVLAAVTTVSLNNLIVQSVHFIRRIIFGYXXXXXXXXXXXXXXXWFHVLSKEASYYWIVVATIITAVGCSIQQSSFYGYSSLLPRRYTQALMIGESLSGVLASAFRISTFMLL--DRTPT-VYFFLCVGQMFICLIIFHISVRSGFVQHHLHRHQHNVLNVNSNSLIKSTHSLSYQINTPXXXXXXXXXXXXXXXXXXWTKTVSMEINNPAYAIEEDHLPQNEPPYLESSDDDEIEEAFDNDLESSDVDQSENSFSHLRKSSHTSKAIMINSRSTNQSNSAVINFLSNVKDGLKFRLQICKLIWPHMIAMFLAYFVTLSVFPGVVTDIESRKWKETFPLFVMLVFNISDFIGKICTSIFRKTKGICLFXXXXXXXXXXXXXXXXXXXHNAPVIYGDFWVLFLISILGLSNGYFGCQPMLQAPQIVKDNQKEVSGNLMTTAYSLGLSMG 1869
            P D  + I+F+++L+GVGFL PYN  I   DY   KY    +++ +S+ Y+L A+  V LNN++V+ +    RI  GY+LA+  +L ++I  +W  + S++ +Y   + A    A GC++QQSSFYGY+ +LP+RYTQ +M GES +GV+ S  RI T +LL  +R  T ++F + V    +C ++  +  RS FV  +  R + +  +     L +      Y+++                          +   +PA A+  +  P++ P + E +        FD  +    V +S  +F          +A++++                        R  + ++IW  M+++ + YF+TL +FPG+ ++I      E  P+ +M VFN+SDF+GKI  ++    +G  L  CS  R++ IPL I+C+ P   P +    W      ++G+SNGYFG  PM+ A   V   Q+E++GN MT +Y  GL++G
Sbjct:   63 PDDRYHAIYFAMLLAGVGFLLPYNSFITDVDYLHHKYPGTSIVFDMSLTYILVALAAVLLNNVLVERLTLHTRITAGYLLALGPLLFISICDVWLQLFSRDQAYAINLAAVGTVAFGCTVQQSSFYGYTGMLPKRYTQGVMTGESTAGVMISLSRILTKLLLPDERASTLIFFLVSVALELLCFLLHLLVRRSRFVLFYTTRPRDS--HRGRPGLGRG---YGYRVHHDVVAG-------------------DVHFEHPAPALAPNESPKDSPAH-EVTGSGGAYMRFD--VPRPRVQRSWPTF----------RALLLH------------------------RYVVARVIWADMLSIAVTYFITLCLFPGLESEIRHCILGEWLPILIMAVFNLSDFVGKILAALPVDWRGTHLLACSCLRVVFIPLFILCVYPSGMPALRHPAWPCIFSLLMGISNGYFGSVPMILAAGKVSPKQRELAGNTMTVSYMSGLTLG 498          
BLAST of slc29a-2 vs. Ensembl Human
Match: SLC29A4 (solute carrier family 29 member 4 [Source:HGNC Symbol;Acc:HGNC:23097])

HSP 1 Score: 171.4 bits (433), Expect = 1.523e-45
Identity = 141/497 (28.37%), Postives = 235/497 (47.28%), Query Frame = 1
Query:  388 PKDPKNLIFFSLILSGVGFLFPYNCLINAADYFQLKYCNNHLIYSISVAYVLAAVTTVSLNNLIVQSVHFIRRIIFGYXXXXXXXXXXXXXXXWFHVLSKEASYYWIVVATIITAVGCSIQQSSFYGYSSLLPRRYTQALMIGESLSGVLASAFRISTFMLL--DRTPT-VYFFLCVGQMFICLIIFHISVRSGFVQHHLHRHQHNVLNVNSNSLIKSTHSLSYQINTPXXXXXXXXXXXXXXXXXXWTKTVSMEINNPAYAIEEDHLPQNEPPYLESSDDDEIEEAFDNDLESSDVDQSENSFSHLRKSSHTSKAIMINSRSTNQSNSAVINFLSNVKDGLKFRLQICKLIWPHMIAMFLAYFVTLSVFPGVVTDIESRKWKETFPLFVMLVFNISDFIGKICTSIFRKTKGICLFXXXXXXXXXXXXXXXXXXXHNAPVIYGDFWVLFLISILGLSNGYFGCQPMLQAPQIVKDNQKEVSGNLMTTAYSLGLSMG 1869
            P D  + I+F+++L+GVGFL PYN  I   DY   KY    +++ +S+ Y+L A+  V LNN++V+ +    RI            L           ++     W + A   +A     QQSSFYGY+ +LP+RYTQ +M GES +GV+ S  RI T +LL  +R  T ++F + V    +C ++  +  RS FV  +  R + +  +     L +      Y+++                          +   +PA A+  +  P++ P + E +        FD  +    V +S  +F          +A++++                        R  + ++IW  M+++ + YF+TL +FPG+ ++I      E  P+ +M VFN+SDF+GKI  ++    +G  L  CS  R++ IPL I+C+ P   P +    W      ++G+SNGYFG  PM+ A   V   Q+E++GN MT +Y  GL++G
Sbjct:   63 PDDRYHAIYFAMLLAGVGFLLPYNSFITDVDYLHHKYPGTSIVFDMSLTYILVALAAVLLNNVLVERLTLHTRITAASATCGCSSSLG----------TRPTPSTWPLWAPWPSAA----QQSSFYGYTGMLPKRYTQGVMTGESTAGVMISLSRILTKLLLPDERASTLIFFLVSVALELLCFLLHLLVRRSRFVLFYTTRPRDS--HRGRPGLGRG---YGYRVHHDVVAG-------------------DVHFEHPAPALAPNESPKDSPAH-EVTGSGGAYMRFD--VPRPRVQRSWPTF----------RALLLH------------------------RYVVARVIWADMLSIAVTYFITLCLFPGLESEIRHCILGEWLPILIMAVFNLSDFVGKILAALPVDWRGTHLLACSCLRVVFIPLFILCVYPSGMPALRHPAWPCIFSLLMGISNGYFGSVPMILAAGKVSPKQRELAGNTMTVSYMSGLTLG 484          
BLAST of slc29a-2 vs. Ensembl Human
Match: SLC29A4 (solute carrier family 29 member 4 [Source:HGNC Symbol;Acc:HGNC:23097])

HSP 1 Score: 72.4034 bits (176), Expect = 3.192e-14
Identity = 37/101 (36.63%), Postives = 63/101 (62.38%), Query Frame = 1
Query:  388 PKDPKNLIFFSLILSGVGFLFPYNCLINAADYFQLKYCNNHLIYSISVAYVLAAVTTVSLNNLIVQSVHFIRRIIFGYXXXXXXXXXXXXXXXWFHVLSKE 690
            P D  + I+F+++L+GVGFL PYN  I   DY   KY    +++ +S+ Y+L A+  V LNN++V+ +    RI  GY+LA+  +L ++I  +W  + S++
Sbjct:   63 PDDRYHAIYFAMLLAGVGFLLPYNSFITDVDYLHHKYPGTSIVFDMSLTYILVALAAVLLNNVLVERLTLHTRITAGYLLALGPLLFISICDVWLQLFSRD 163          
BLAST of slc29a-2 vs. Ensembl Human
Match: SLC29A4 (solute carrier family 29 member 4 [Source:HGNC Symbol;Acc:HGNC:23097])

HSP 1 Score: 66.2402 bits (160), Expect = 3.689e-12
Identity = 29/74 (39.19%), Postives = 46/74 (62.16%), Query Frame = 1
Query:  388 PKDPKNLIFFSLILSGVGFLFPYNCLINAADYFQLKYCNNHLIYSISVAYVLAAVTTVSLNNLIVQSVHFIRRI 609
            P D  + I+F+++L+GVGFL PYN  I   DY   KY    +++ +S+ Y+L A+  V LNN++V+ +    RI
Sbjct:   63 PDDRYHAIYFAMLLAGVGFLLPYNSFITDVDYLHHKYPGTSIVFDMSLTYILVALAAVLLNNVLVERLTLHTRI 136          
BLAST of slc29a-2 vs. Ensembl Celegans
Match: ent-1 (Equilibrative Nucleoside Transporter; Equilibrative nucleoside transporter 1 [Source:UniProtKB/TrEMBL;Acc:G5EDJ3])

HSP 1 Score: 59.3066 bits (142), Expect = 5.250e-9
Identity = 63/230 (27.39%), Postives = 104/230 (45.22%), Query Frame = 1
Query:  388 PKDPKNLIFFSLILSGVGFLFPYNCLINAA-DYFQ-LKYCNNHLIYSISVAYVLAAVTTVSLNN--------------------LIVQSVHFIRRIIFGYXXXXXXXXXXXXXXXWFHVLSKEASYYWIVVATIITAVGC-SIQQSSFYGYSSLLPRRYTQALMIGESLSGVLASAFRISTFM----LLDRTPTVYFFLCVGQMFICLIIFHISVRSGFVQHHLHRHQHN 996
            P+D  NL+F+ ++L G+G L P+N LI  + DYF+  K   N  I  +    V    T  S N                      IV       RI  G +  + V ++ T++ I+    +    ++ + + TII   G   + Q+S +G +S LP +YT A++IG +L G   +   +ST      +LDR+   YF + +  +  C I FHI  +  F Q++  R +  
Sbjct:   23 PEDKGNLVFYIILLHGIGTLMPWNMLITISYDYFESYKMLANSTI-DMDTGVVTGYPTVYSSNFQSFQTIASQVPNLLLNLLNIFIVVKGGLASRITVG-LSIVAVCVITTMMFIYVETSTWLTGFFTLTIITIIVLNGANGVYQNSIFGLASELPFKYTNAVIIGNNLCGTFVTLLSMSTKAVTRNILDRS-FAYFSIALITLVFCFISFHILKKQRFYQYYSTRAERQ 249          
BLAST of slc29a-2 vs. Ensembl Celegans
Match: ent-7 (Equilibrative Nucleoside Transporter [Source:UniProtKB/TrEMBL;Acc:E1B6S0])

HSP 1 Score: 57.3806 bits (137), Expect = 2.196e-8
Identity = 52/213 (24.41%), Postives = 99/213 (46.48%), Query Frame = 1
Query:  382 NSPKDPKNLIFFSLILSGVGFLFPYNCLINAADYFQLKYCNNHLIYS------ISVAYVLAAVTTVSLNNLIVQSVHFIRRIIFGYXXXXXXXXXXXXXXXWFHVLSKEASYYWIVVATIITAVGCS--IQQSSFYGYSSLLPRRYTQALMIGESLSGVLASAFRISTFML----LDRTPTVYFFLCVGQMFICLIIFHISVRSGFVQHHLHR 984
            +SP D   L++    + G+G L  +N  I  A  +   Y  N+  Y       I V   +  V  + LN ++V     + R++   ++   ++ ++ I+ I+        ++++IV   II A+  +  I Q+S YG  +  P  Y  +L+IG +L GV  S   I T ++    ++    +YF + +  M +CL   +  VR  F Q+++ +
Sbjct:   43 SSPTDRWYLVYIIFTMHGMGMLMSWNMFITIAPQYYHDYWFNNTNYQDSFMSIIGVTSQIPNVGIMILNTIVVMVGFMMLRVVVPLIVNCILIGVIVILAIFVTPSPDSVTWFYIVTLIIIMAMNLANGIYQNSVYGIVADFPDNYINSLVIGNNLCGVFTSVLSILTILISPNDIELNALLYFSISLAFMIVCLFSLYFLVRLPFYQYYMAK 255          
BLAST of slc29a-2 vs. Ensembl Celegans
Match: ent-7 (Equilibrative Nucleoside Transporter [Source:UniProtKB/TrEMBL;Acc:E1B6S0])

HSP 1 Score: 56.9954 bits (136), Expect = 2.931e-8
Identity = 52/213 (24.41%), Postives = 99/213 (46.48%), Query Frame = 1
Query:  382 NSPKDPKNLIFFSLILSGVGFLFPYNCLINAADYFQLKYCNNHLIYS------ISVAYVLAAVTTVSLNNLIVQSVHFIRRIIFGYXXXXXXXXXXXXXXXWFHVLSKEASYYWIVVATIITAVGCS--IQQSSFYGYSSLLPRRYTQALMIGESLSGVLASAFRISTFML----LDRTPTVYFFLCVGQMFICLIIFHISVRSGFVQHHLHR 984
            +SP D   L++    + G+G L  +N  I  A  +   Y  N+  Y       I V   +  V  + LN ++V     + R++   ++   ++ ++ I+ I+        ++++IV   II A+  +  I Q+S YG  +  P  Y  +L+IG +L GV  S   I T ++    ++    +YF + +  M +CL   +  VR  F Q+++ +
Sbjct:   31 SSPTDRWYLVYIIFTMHGMGMLMSWNMFITIAPQYYHDYWFNNTNYQDSFMSIIGVTSQIPNVGIMILNTIVVMVGFMMLRVVVPLIVNCILIGVIVILAIFVTPSPDSVTWFYIVTLIIIMAMNLANGIYQNSVYGIVADFPDNYINSLVIGNNLCGVFTSVLSILTILISPNDIELNALLYFSISLAFMIVCLFSLYFLVRLPFYQYYMAK 243          
BLAST of slc29a-2 vs. Ensembl Celegans
Match: ent-7 (Equilibrative Nucleoside Transporter [Source:UniProtKB/TrEMBL;Acc:E1B6S0])

HSP 1 Score: 56.9954 bits (136), Expect = 2.931e-8
Identity = 52/213 (24.41%), Postives = 99/213 (46.48%), Query Frame = 1
Query:  382 NSPKDPKNLIFFSLILSGVGFLFPYNCLINAADYFQLKYCNNHLIYS------ISVAYVLAAVTTVSLNNLIVQSVHFIRRIIFGYXXXXXXXXXXXXXXXWFHVLSKEASYYWIVVATIITAVGCS--IQQSSFYGYSSLLPRRYTQALMIGESLSGVLASAFRISTFML----LDRTPTVYFFLCVGQMFICLIIFHISVRSGFVQHHLHR 984
            +SP D   L++    + G+G L  +N  I  A  +   Y  N+  Y       I V   +  V  + LN ++V     + R++   ++   ++ ++ I+ I+        ++++IV   II A+  +  I Q+S YG  +  P  Y  +L+IG +L GV  S   I T ++    ++    +YF + +  M +CL   +  VR  F Q+++ +
Sbjct:   31 SSPTDRWYLVYIIFTMHGMGMLMSWNMFITIAPQYYHDYWFNNTNYQDSFMSIIGVTSQIPNVGIMILNTIVVMVGFMMLRVVVPLIVNCILIGVIVILAIFVTPSPDSVTWFYIVTLIIIMAMNLANGIYQNSVYGIVADFPDNYINSLVIGNNLCGVFTSVLSILTILISPNDIELNALLYFSISLAFMIVCLFSLYFLVRLPFYQYYMAK 243          
BLAST of slc29a-2 vs. Ensembl Celegans
Match: ent-7 (Equilibrative Nucleoside Transporter [Source:UniProtKB/TrEMBL;Acc:E1B6S0])

HSP 1 Score: 56.9954 bits (136), Expect = 2.931e-8
Identity = 52/213 (24.41%), Postives = 99/213 (46.48%), Query Frame = 1
Query:  382 NSPKDPKNLIFFSLILSGVGFLFPYNCLINAADYFQLKYCNNHLIYS------ISVAYVLAAVTTVSLNNLIVQSVHFIRRIIFGYXXXXXXXXXXXXXXXWFHVLSKEASYYWIVVATIITAVGCS--IQQSSFYGYSSLLPRRYTQALMIGESLSGVLASAFRISTFML----LDRTPTVYFFLCVGQMFICLIIFHISVRSGFVQHHLHR 984
            +SP D   L++    + G+G L  +N  I  A  +   Y  N+  Y       I V   +  V  + LN ++V     + R++   ++   ++ ++ I+ I+        ++++IV   II A+  +  I Q+S YG  +  P  Y  +L+IG +L GV  S   I T ++    ++    +YF + +  M +CL   +  VR  F Q+++ +
Sbjct:   31 SSPTDRWYLVYIIFTMHGMGMLMSWNMFITIAPQYYHDYWFNNTNYQDSFMSIIGVTSQIPNVGIMILNTIVVMVGFMMLRVVVPLIVNCILIGVIVILAIFVTPSPDSVTWFYIVTLIIIMAMNLANGIYQNSVYGIVADFPDNYINSLVIGNNLCGVFTSVLSILTILISPNDIELNALLYFSISLAFMIVCLFSLYFLVRLPFYQYYMAK 243          
BLAST of slc29a-2 vs. Ensembl Fly
Match: Ent3 (gene:FBgn0036319 transcript:FBtr0075935)

HSP 1 Score: 222.246 bits (565), Expect = 4.731e-63
Identity = 153/507 (30.18%), Postives = 270/507 (53.25%), Query Frame = 1
Query:  382 NSPKDPKNLIFFSLILSGVGFLFPYNCLINAADYFQLKYCNNHLIYSISVAYVLAAVTTVSLNNLIVQSVHFIRRIIFGYXXXXXXXXXXXXXXXWFHVLSKEASYYWIVVATIITAVGCSIQQSSFYGYSSLLPRRYTQALMIGESLSGVLASAFRISTFMLL--DRTPTVYFFLCVGQMFICLIIFHI-SVRSGFVQHHLHRHQHNVLNVNSNSLIKSTHSLSYQINTPXXXXXXXXXXXXXXXXXXWTKTVSMEINNPAYAIEEDHLPQNEPPYLESSDDDEIEEAFD-----NDLESSDVDQSENSFSHLR-KSSHTSKAIMINSRSTNQSNSAVINFLSNVKDGLKFRLQICKLIWPHMIAMFLAYFVTLSVFPGVVTDIESRKWKETFPLFVMLVFNISDFIGKICTSIFRKTKGICLFXXXXXXXXXXXXXXXXXXXHNAPVIYGDFWVLFLISILGLSNGYFGCQPMLQAPQIVKDNQKEVSGNLMTTAYSLGLSMGVL 1875
             +PKD ++ ++ +L+ +G+GF+ PYN  I AADY+Q ++    +   +S+ Y+  A  TV +NN+++    F  R++FGY+++ T ++ + +  + +H+ +   +Y   + A  +TA+GC++QQSSFYG++S+LP++YTQA+M GES++G L S+ R+ T +L+  DR  TV FFL      +   + H+ ++ S FV+ H+      VL  +   +     S  Y +                 +  + T T +  +  P      + L  + P Y E S+    E + +      +L ++   Q   + + +  K  H     +I  R    S       L ++++G   R ++ ++I+PHM+ + LAY VTLS++PG+  +++S   +   P+ +M  FN SD +GKI  +         L + S  RI+L+PL+++C  P   PVI G+         LG++NG  G  PM+ AP  V    KEV+GN+MT +Y++GL++G L
Sbjct:   46 RAPKDQRHSVYLALLAAGIGFVLPYNSFIIAADYWQARFPGRPVALDMSMTYIFVAFGTVLMNNIVLSVAPFQSRVLFGYMISFTTLIFVAVCEVAWHMFATNTAYLVNMSAVALTAIGCTVQQSSFYGFASMLPKQYTQAVMAGESIAGFLVSSNRVVTKLLINNDRVSTVIFFLTSTLYILFSYLLHVATINSPFVRFHVEACSKIVLRPDEQEIDGVPSSTRYGV-----------------LSMDGTHTTTTSVGPPGTG---NTLSFSNPVY-ELSNPTAGESSIEALGQLPELPATPPAQEPTTPTTVAFKVEH-----VITPRRCRPSK------LGDIREGFVTRWRVAQVIYPHMVCIALAYCVTLSLYPGIEVEVQSCALRSWMPVLLMFCFNTSDVVGKILAASPYPWSRRQLILLSGLRIVLVPLLLLCCAPRQRPVISGETAPFVFTIALGITNGLAGSLPMMLAPAKVPGTLKEVTGNIMTLSYNVGLTVGSL 520          
BLAST of slc29a-2 vs. Ensembl Fly
Match: Ent3 (gene:FBgn0036319 transcript:FBtr0345343)

HSP 1 Score: 222.246 bits (565), Expect = 4.731e-63
Identity = 153/507 (30.18%), Postives = 270/507 (53.25%), Query Frame = 1
Query:  382 NSPKDPKNLIFFSLILSGVGFLFPYNCLINAADYFQLKYCNNHLIYSISVAYVLAAVTTVSLNNLIVQSVHFIRRIIFGYXXXXXXXXXXXXXXXWFHVLSKEASYYWIVVATIITAVGCSIQQSSFYGYSSLLPRRYTQALMIGESLSGVLASAFRISTFMLL--DRTPTVYFFLCVGQMFICLIIFHI-SVRSGFVQHHLHRHQHNVLNVNSNSLIKSTHSLSYQINTPXXXXXXXXXXXXXXXXXXWTKTVSMEINNPAYAIEEDHLPQNEPPYLESSDDDEIEEAFD-----NDLESSDVDQSENSFSHLR-KSSHTSKAIMINSRSTNQSNSAVINFLSNVKDGLKFRLQICKLIWPHMIAMFLAYFVTLSVFPGVVTDIESRKWKETFPLFVMLVFNISDFIGKICTSIFRKTKGICLFXXXXXXXXXXXXXXXXXXXHNAPVIYGDFWVLFLISILGLSNGYFGCQPMLQAPQIVKDNQKEVSGNLMTTAYSLGLSMGVL 1875
             +PKD ++ ++ +L+ +G+GF+ PYN  I AADY+Q ++    +   +S+ Y+  A  TV +NN+++    F  R++FGY+++ T ++ + +  + +H+ +   +Y   + A  +TA+GC++QQSSFYG++S+LP++YTQA+M GES++G L S+ R+ T +L+  DR  TV FFL      +   + H+ ++ S FV+ H+      VL  +   +     S  Y +                 +  + T T +  +  P      + L  + P Y E S+    E + +      +L ++   Q   + + +  K  H     +I  R    S       L ++++G   R ++ ++I+PHM+ + LAY VTLS++PG+  +++S   +   P+ +M  FN SD +GKI  +         L + S  RI+L+PL+++C  P   PVI G+         LG++NG  G  PM+ AP  V    KEV+GN+MT +Y++GL++G L
Sbjct:   46 RAPKDQRHSVYLALLAAGIGFVLPYNSFIIAADYWQARFPGRPVALDMSMTYIFVAFGTVLMNNIVLSVAPFQSRVLFGYMISFTTLIFVAVCEVAWHMFATNTAYLVNMSAVALTAIGCTVQQSSFYGFASMLPKQYTQAVMAGESIAGFLVSSNRVVTKLLINNDRVSTVIFFLTSTLYILFSYLLHVATINSPFVRFHVEACSKIVLRPDEQEIDGVPSSTRYGV-----------------LSMDGTHTTTTSVGPPGTG---NTLSFSNPVY-ELSNPTAGESSIEALGQLPELPATPPAQEPTTPTTVAFKVEH-----VITPRRCRPSK------LGDIREGFVTRWRVAQVIYPHMVCIALAYCVTLSLYPGIEVEVQSCALRSWMPVLLMFCFNTSDVVGKILAASPYPWSRRQLILLSGLRIVLVPLLLLCCAPRQRPVISGETAPFVFTIALGITNGLAGSLPMMLAPAKVPGTLKEVTGNIMTLSYNVGLTVGSL 520          
BLAST of slc29a-2 vs. Ensembl Fly
Match: Ent3 (gene:FBgn0036319 transcript:FBtr0332049)

HSP 1 Score: 221.861 bits (564), Expect = 6.622e-63
Identity = 151/515 (29.32%), Postives = 272/515 (52.82%), Query Frame = 1
Query:  382 NSPKDPKNLIFFSLILSGVGFLFPYNCLINAADYFQLKYCNNHLIYSISVAYVLAAVTTVSLNNLIVQSVHFIRRIIFGYXXXXXXXXXXXXXXXWFHVLSKEASYYWIVVATIITAVGCSIQQSSFYGYSSLLPRRYTQALMIGESLSGVLASAFRISTFMLL--DRTPTVYFFLCVGQMFICLIIFHI-SVRSGFVQHHLH-------RHQHNVLNVNSNSL-----IKSTHSLSYQINTPXXXXXXXXXXXXXXXXXXWTKTVSMEINNPAYAIEEDHLPQNEPPYLESSDDDEIEEAFD-NDLESSDVDQSENSFSHLR-KSSHTSKAIMINSRSTNQSNSAVINFLSNVKDGLKFRLQICKLIWPHMIAMFLAYFVTLSVFPGVVTDIESRKWKETFPLFVMLVFNISDFIGKICTSIFRKTKGICLFXXXXXXXXXXXXXXXXXXXHNAPVIYGDFWVLFLISILGLSNGYFGCQPMLQAPQIVKDNQKEVSGNLMTTAYSLGLSMGVL 1875
             +PKD ++ ++ +L+ +G+GF+ PYN  I AADY+Q ++    +   +S+ Y+  A  TV +NN+++    F  R++FGY+++ T ++ + +  + +H+ +   +Y   + A  +TA+GC++QQSSFYG++S+LP++YTQA+M GES++G L S+ R+ T +L+  DR  TV FFL      +   + H+ ++ S FV+ H+        R    +  V S++      +  TH+ +  +  P + +                   ++  +NP Y +              ++ +  IE      +L ++   Q   + + +  K  H     +I  R    S       L ++++G   R ++ ++I+PHM+ + LAY VTLS++PG+  +++S   +   P+ +M  FN SD +GKI  +         L + S  RI+L+PL+++C  P   PVI G+         LG++NG  G  PM+ AP  V    KEV+GN+MT +Y++GL++G L
Sbjct:   46 RAPKDQRHSVYLALLAAGIGFVLPYNSFIIAADYWQARFPGRPVALDMSMTYIFVAFGTVLMNNIVLSVAPFQSRVLFGYMISFTTLIFVAVCEVAWHMFATNTAYLVNMSAVALTAIGCTVQQSSFYGFASMLPKQYTQAVMAGESIAGFLVSSNRVVTKLLINNDRVSTVIFFLTSTLYILFSYLLHVATINSPFVRFHVEACSKIVLRPDEEIDGVPSSTRYGVLSMDGTHTTTTSVGPPGTGN-------------------TLSFSNPVYELSN-----------PTAGESSIEALGQLPELPATPPAQEPTTPTTVAFKVEH-----VITPRRCRPSK------LGDIREGFVTRWRVAQVIYPHMVCIALAYCVTLSLYPGIEVEVQSCALRSWMPVLLMFCFNTSDVVGKILAASPYPWSRRQLILLSGLRIVLVPLLLLCCAPRQRPVISGETAPFVFTIALGITNGLAGSLPMMLAPAKVPGTLKEVTGNIMTLSYNVGLTVGSL 519          
BLAST of slc29a-2 vs. Ensembl Fly
Match: Ent1 (gene:FBgn0031250 transcript:FBtr0078094)

HSP 1 Score: 59.3066 bits (142), Expect = 6.707e-9
Identity = 44/166 (26.51%), Postives = 83/166 (50.00%), Query Frame = 1
Query: 1417 QICKLIWPHMIAMFLAYFVTLSVFPGVVTDIESRK----WKETF--PLFVMLVFNISDFIGKICTSIFRK--TKGICLFXXXXXXXXXXXXXXXXXXXHN-APVIYG-DFWVLFLISILGLSNGYFGCQPMLQAPQIVKDNQKEVSGNLMTTAYSLGLSMGVLSAL 1884
            Q+   I+ H I++ L Y  TLSV+P V   ++S      W + +  P+   L+FN  D+ G++      +   +   L    +    +   +      H+  PV+   D+  + ++ +  LSNGYF    ++ AP+ VK ++KE++ ++M  A S G+++G L +L
Sbjct:  305 QVMSKIYLHAISLALLYTTTLSVYPAVTVLMQSEYGHSVWTDVYFLPVVNYLIFNCGDYFGRLFAGWMERPLNQNTSLLFIVVRMAFVPLFLCSNSSEHSFLPVLVKHDYTFIAMMVMFALSNGYFTNILLIMAPKRVKQHEKELASSIMAAALSCGMAVGSLLSL 470          
BLAST of slc29a-2 vs. Ensembl Fly
Match: Ent1 (gene:FBgn0031250 transcript:FBtr0078095)

HSP 1 Score: 59.3066 bits (142), Expect = 6.707e-9
Identity = 44/166 (26.51%), Postives = 83/166 (50.00%), Query Frame = 1
Query: 1417 QICKLIWPHMIAMFLAYFVTLSVFPGVVTDIESRK----WKETF--PLFVMLVFNISDFIGKICTSIFRK--TKGICLFXXXXXXXXXXXXXXXXXXXHN-APVIYG-DFWVLFLISILGLSNGYFGCQPMLQAPQIVKDNQKEVSGNLMTTAYSLGLSMGVLSAL 1884
            Q+   I+ H I++ L Y  TLSV+P V   ++S      W + +  P+   L+FN  D+ G++      +   +   L    +    +   +      H+  PV+   D+  + ++ +  LSNGYF    ++ AP+ VK ++KE++ ++M  A S G+++G L +L
Sbjct:  305 QVMSKIYLHAISLALLYTTTLSVYPAVTVLMQSEYGHSVWTDVYFLPVVNYLIFNCGDYFGRLFAGWMERPLNQNTSLLFIVVRMAFVPLFLCSNSSEHSFLPVLVKHDYTFIAMMVMFALSNGYFTNILLIMAPKRVKQHEKELASSIMAAALSCGMAVGSLLSL 470          
BLAST of slc29a-2 vs. Ensembl Zebrafish
Match: si:ch211-160d14.6 (si:ch211-160d14.6 [Source:ZFIN;Acc:ZDB-GENE-121214-93])

HSP 1 Score: 224.942 bits (572), Expect = 3.827e-65
Identity = 159/499 (31.86%), Postives = 264/499 (52.91%), Query Frame = 1
Query:  388 PKDPKNLIFFSLILSGVGFLFPYNCLINAADYFQLKYCNNHLIYSISVAYVLAAVTTVSLNNLIVQSVHFIRRIIFGYXXXXXXXXXXXXXXXWFHVLSKEASYYWIVVATIITAVGCSIQQSSFYGYSSLLPRRYTQALMIGESLSGVLASAFRISTFMLL--DRTPTVYFFL-CVGQMFICLIIFHISVRSGFVQHHLHRHQHNVLNVNSNSLIKSTHSLSYQINTPXXXXXXXXXXXXXXXXXXWTKTVSMEINNPAYAIEEDHLPQNEPPYLESSDDDEIEEAFD--NDLESSDVDQSENSFSHLRKSSHTSKAIMINSRSTNQSNSAVINFLSNVKDGLKFRLQICKLIWPHMIAMFLAYFVTLSVFPGVVTDIESRKWKETFPLFVMLVFNISDFIGKICTSIFRKTKGICLFXXXXXXXXXXXXXXXXXXXHNAPVIYGDFWVLFLISILGLSNGYFGCQPMLQAPQIVKDNQKEVSGNLMTTAYSLGLSMG 1869
            P D  + I+F+++L+GVGFL PYN  I   DY   K+    +++ +S+ Y+L A++ V +NN +V+ +    RI  GY+ A+  ++ +++  +W  + + + SY   + A  I A GC++QQSSFYGY+ +LP+RYTQ +M GES +GV+ S  RI T +L+  ++  T+ FFL  V    +C ++  +  R+ FV++H  R +       S+S +K       QIN                             N+  Y I  D           SS ++E+       + + SS VD ++    +L   SH      I  R       A  +++S VK+ L  R  + ++IWP+M+++ + YF+TL +FPG+ +++ +    E  P+  M +FN++DF+GKI  +   +  G+ L +CS  R+L +PL ++C+ P   P++    W   L  +LG+SNGY G  PM+QA   V   Q+EV+GN MT +Y  GL +G
Sbjct:   48 PDDRYHSIYFAMLLAGVGFLLPYNSFITDVDYLHRKFKGTSIVFDMSLTYILVALSAVIVNNALVERLSLHTRICVGYLFALGPLVCVSVFDVWLELFNTQQSYAVTLAAVAIVAFGCTVQQSSFYGYTGMLPKRYTQGVMTGESTAGVIVSLSRIFTKLLVEDEKNNTIIFFLFSVSMETLCFLLHVVVRRTHFVRYHTSRAR------QSHSWLKG------QIN-----------------------------NHSGYQIHYD-----------SSAEEEVHSHTGTLDGMASSMVDDADA--VNLGNGSHGDG---IYVRFDVPKPEAKRSWIS-VKELLGRRCAVARVIWPYMLSILVTYFITLCLFPGLESELHNDTLGEWLPILTMALFNMADFVGKILAACPYEWGGVQLLVCSCLRVLFLPLFVMCVSPVQRPLLAHPAWPCGLSVMLGISNGYLGSVPMIQAAGKVPLQQREVAGNTMTVSYMAGLMLG 488          
BLAST of slc29a-2 vs. Ensembl Zebrafish
Match: si:ch211-160d14.6 (si:ch211-160d14.6 [Source:ZFIN;Acc:ZDB-GENE-121214-93])

HSP 1 Score: 224.942 bits (572), Expect = 4.232e-65
Identity = 159/499 (31.86%), Postives = 264/499 (52.91%), Query Frame = 1
Query:  388 PKDPKNLIFFSLILSGVGFLFPYNCLINAADYFQLKYCNNHLIYSISVAYVLAAVTTVSLNNLIVQSVHFIRRIIFGYXXXXXXXXXXXXXXXWFHVLSKEASYYWIVVATIITAVGCSIQQSSFYGYSSLLPRRYTQALMIGESLSGVLASAFRISTFMLL--DRTPTVYFFL-CVGQMFICLIIFHISVRSGFVQHHLHRHQHNVLNVNSNSLIKSTHSLSYQINTPXXXXXXXXXXXXXXXXXXWTKTVSMEINNPAYAIEEDHLPQNEPPYLESSDDDEIEEAFD--NDLESSDVDQSENSFSHLRKSSHTSKAIMINSRSTNQSNSAVINFLSNVKDGLKFRLQICKLIWPHMIAMFLAYFVTLSVFPGVVTDIESRKWKETFPLFVMLVFNISDFIGKICTSIFRKTKGICLFXXXXXXXXXXXXXXXXXXXHNAPVIYGDFWVLFLISILGLSNGYFGCQPMLQAPQIVKDNQKEVSGNLMTTAYSLGLSMG 1869
            P D  + I+F+++L+GVGFL PYN  I   DY   K+    +++ +S+ Y+L A++ V +NN +V+ +    RI  GY+ A+  ++ +++  +W  + + + SY   + A  I A GC++QQSSFYGY+ +LP+RYTQ +M GES +GV+ S  RI T +L+  ++  T+ FFL  V    +C ++  +  R+ FV++H  R +       S+S +K       QIN                             N+  Y I  D           SS ++E+       + + SS VD ++    +L   SH      I  R       A  +++S VK+ L  R  + ++IWP+M+++ + YF+TL +FPG+ +++ +    E  P+  M +FN++DF+GKI  +   +  G+ L +CS  R+L +PL ++C+ P   P++    W   L  +LG+SNGY G  PM+QA   V   Q+EV+GN MT +Y  GL +G
Sbjct:   59 PDDRYHSIYFAMLLAGVGFLLPYNSFITDVDYLHRKFKGTSIVFDMSLTYILVALSAVIVNNALVERLSLHTRICVGYLFALGPLVCVSVFDVWLELFNTQQSYAVTLAAVAIVAFGCTVQQSSFYGYTGMLPKRYTQGVMTGESTAGVIVSLSRIFTKLLVEDEKNNTIIFFLFSVSMETLCFLLHVVVRRTHFVRYHTSRARQ------SHSWLKG------QIN-----------------------------NHSGYQIHYD-----------SSAEEEVHSHTGTLDGMASSMVDDADA--VNLGNGSHGDG---IYVRFDVPKPEAKRSWIS-VKELLGRRCAVARVIWPYMLSILVTYFITLCLFPGLESELHNDTLGEWLPILTMALFNMADFVGKILAACPYEWGGVQLLVCSCLRVLFLPLFVMCVSPVQRPLLAHPAWPCGLSVMLGISNGYLGSVPMIQAAGKVPLQQREVAGNTMTVSYMAGLMLG 499          
BLAST of slc29a-2 vs. Ensembl Zebrafish
Match: SLC29A4 (si:ch211-160d14.6 [Source:ZFIN;Acc:ZDB-GENE-121214-93])

HSP 1 Score: 224.172 bits (570), Expect = 5.449e-65
Identity = 157/499 (31.46%), Postives = 262/499 (52.51%), Query Frame = 1
Query:  388 PKDPKNLIFFSLILSGVGFLFPYNCLINAADYFQLKYCNNHLIYSISVAYVLAAVTTVSLNNLIVQSVHFIRRIIFGYXXXXXXXXXXXXXXXWFHVLSKEASYYWIVVATIITAVGCSIQQSSFYGYSSLLPRRYTQALMIGESLSGVLASAFRISTFMLL--DRTPTVYFFL-CVGQMFICLIIFHISVRSGFVQHHLH--RHQHNVLNVNSNSLIKSTHSLSYQINTPXXXXXXXXXXXXXXXXXXWTKTVSMEINNPAYAIEEDHLPQNEPPYLESSDDDEIEEAFDNDLESSDVDQSENSFSHLRKSSHTSKAIMINSRSTNQSNSAVINFLSNVKDGLKFRLQICKLIWPHMIAMFLAYFVTLSVFPGVVTDIESRKWKETFPLFVMLVFNISDFIGKICTSIFRKTKGICLFXXXXXXXXXXXXXXXXXXXHNAPVIYGDFWVLFLISILGLSNGYFGCQPMLQAPQIVKDNQKEVSGNLMTTAYSLGLSMG 1869
            P D  + I+F+++L+GVGFL PYN  I   DY   K+    +++ +S+ Y+L A++ V +NN +V+ +    RI  GY+ A+  ++ +++  +W  + + + SY   + A  I A GC++QQSSFYGY+ +LP+RYTQ +M GES +GV+ S  RI T +L+  ++  T+ FFL  V    +C ++  +  R+ FV++H    R  H+ L    N++    HS  YQI                                                + +SS ++E      + + SS VD ++    +L   SH      I  R       A  +++S VK+ L  R  + ++IWP+M+++ + YF+TL +FPG+ +++ +    E  P+  M +FN++DF+GKI  +   +  G+ L +CS  R+L +PL ++C+ P   P++    W   L  +LG+SNGY G  PM+QA   V   Q+EV+GN MT +Y  GL +G
Sbjct:   48 PDDRYHSIYFAMLLAGVGFLLPYNSFITDVDYLHRKFKGTSIVFDMSLTYILVALSAVIVNNALVERLSLHTRICVGYLFALGPLVCVSVFDVWLELFNTQQSYAVTLAAVAIVAFGCTVQQSSFYGYTGMLPKRYTQGVMTGESTAGVIVSLSRIFTKLLVEDEKNNTIIFFLFSVSMETLCFLLHVVVRRTHFVRYHTSRARQSHSWLKGQINNVTTQKHS-GYQI------------------------------------------------HYDSSAEEE------DGMASSMVDDADA--VNLGNGSHGDG---IYVRFDVPKPEAKRSWIS-VKELLGRRCAVARVIWPYMLSILVTYFITLCLFPGLESELHNDTLGEWLPILTMALFNMADFVGKILAACPYEWGGVQLLVCSCLRVLFLPLFVMCVSPVQRPLLAHPAWPCGLSVMLGISNGYLGSVPMIQAAGKVPLQQREVAGNTMTVSYMAGLMLG 485          
BLAST of slc29a-2 vs. Ensembl Zebrafish
Match: si:ch211-160d14.6 (si:ch211-160d14.6 [Source:ZFIN;Acc:ZDB-GENE-121214-93])

HSP 1 Score: 142.895 bits (359), Expect = 3.300e-36
Identity = 74/206 (35.92%), Postives = 127/206 (61.65%), Query Frame = 1
Query:  388 PKDPKNLIFFSLILSGVGFLFPYNCLINAADYFQLKYCNNHLIYSISVAYVLAAVTTVSLNNLIVQSVHFIRRIIFGYXXXXXXXXXXXXXXXWFHVLSKEASYYWIVVATIITAVGCSIQQSSFYGYSSLLPRRYTQALMIGESLSGVLASAFRISTFMLL--DRTPTVYFFL-CVGQMFICLIIFHISVRSGFVQHHLHRHQHN 996
            P D  + I+F+++L+GVGFL PYN  I   DY   K+    +++ +S+ Y+L A++ V +NN +V+ +    RI  GY+ A+  ++ +++  +W  + + + SY   + A  I A GC++QQSSFYGY+ +LP+RYTQ +M GES +GV+ S  RI T +L+  ++  T+ FFL  V    +C ++  +  R+ FV++H  R + +
Sbjct:   39 PDDRYHSIYFAMLLAGVGFLLPYNSFITDVDYLHRKFKGTSIVFDMSLTYILVALSAVIVNNALVERLSLHTRICVGYLFALGPLVCVSVFDVWLELFNTQQSYAVTLAAVAIVAFGCTVQQSSFYGYTGMLPKRYTQGVMTGESTAGVIVSLSRIFTKLLVEDEKNNTIIFFLFSVSMETLCFLLHVVVRRTHFVRYHTSRARQS 244          

HSP 2 Score: 106.686 bits (265), Expect = 5.546e-24
Identity = 61/161 (37.89%), Postives = 101/161 (62.73%), Query Frame = 1
Query: 1387 NVKDGLKFRLQICKLIWPHMIAMFLAYFVTLSVFPGVVTDIESRKWKETFPLFVMLVFNISDFIGKICTSIFRKTKGICLFXXXXXXXXXXXXXXXXXXXHNAPVIYGDFWVLFLISILGLSNGYFGCQPMLQAPQIVKDNQKEVSGNLMTTAYSLGLSMG 1869
            +VK+ L  R  + ++IWP+M+++ + YF+TL +FPG+ +++ +    E  P+  M +FN++DF+GKI  +   +  G+ L +CS  R+L +PL ++C+ P   P++    W   L  +LG+SNGY G  PM+QA   V   Q+EV+GN MT +Y  GL +G
Sbjct:  267 SVKELLGRRCAVARVIWPYMLSILVTYFITLCLFPGLESELHNDTLGEWLPILTMALFNMADFVGKILAACPYEWGGVQLLVCSCLRVLFLPLFVMCVSPVQRPLLAHPAWPCGLSVMLGISNGYLGSVPMIQAAGKVPLQQREVAGNTMTVSYMAGLMLG 427          
BLAST of slc29a-2 vs. Ensembl Zebrafish
Match: slc29a4 (Danio rerio solute carrier family 29 member 4 (slc29a4), transcript variant 1, mRNA. [Source:RefSeq mRNA;Acc:NM_001362610])

HSP 1 Score: 134.035 bits (336), Expect = 7.735e-33
Identity = 78/227 (34.36%), Postives = 134/227 (59.03%), Query Frame = 1
Query:  388 PKDPKNLIFFSLILSGVGFLFPYNCLINAADYFQLKYCNNHLIYSISVAYVLAAVTTVSLNNLIVQSVHFIRRIIFGYXXXXXXXXXXXXXXXWFHVLSKEASYYWIVVATIITAVGCSIQQSSFYGYSSLLPRRYTQALMIGESLSGVLASAFRISTFMLL--DRTPTVYFF-LCVGQMFICLIIFHISVRSGFVQHHLHRHQHNVLNVNSNSLIKSTHSLSYQIN 1059
            P D  + I+F+++L+GVGFL PYN  I   DY   K+    +++ + + Y+L A+  V LNN++V+ +    RI  GY+ A+  +L +TI  +W    + + +Y   +++    A GC++QQSSFYGY  +LP+RYTQ +M GES +GV+ S  RI T +L+  +R  T+ FF + +  + +C I+  +  R+ FVQ++    +  +    S++   S H+  YQ++
Sbjct:   61 PDDRYHGIYFAMLLAGVGFLLPYNSFITDVDYLHHKFEGTSIVFDMGLTYILVALVAVILNNVLVEMLSLHTRITVGYLFALGPLLFVTIFDVWLERFTIKQAYVINLMSMGTVAFGCTVQQSSFYGYMGMLPKRYTQGVMTGESTAGVIISLSRIFTKLLIKDERKNTIIFFVISICMVLVCFILHLLVRRTRFVQYYTSLARRGL----SHAKDHSQHASQYQVH 283          

HSP 2 Score: 102.834 bits (255), Expect = 1.604e-22
Identity = 60/165 (36.36%), Postives = 99/165 (60.00%), Query Frame = 1
Query: 1387 NVKDGLKFRLQICKLIWPHMIAMFLAYFVTLSVFPGVVTDIESRKWKETFPLFVMLVFNISDFIGKICTSIFRKTKGICLFXXXXXXXXXXXXXXXXXXXHNAPVIYGDFWVLFLISILGLSNGYFGCQPMLQAPQIVKDNQKEVSGNLMTTAYSLGLSMGVLSA 1881
             VKD +  R  + ++IW +M+++ + YF+TL +FPG+ ++I++    E  P+ +M +FNISDF+GKI  ++  +  G  L   S  R++ IPL I+C+ P   P+     W       +G++NGYFG  PM+ A   V   Q+E++GN+MT +Y  GL +G + A
Sbjct:  329 GVKDMILHRYVVARVIWTYMLSIAVTYFITLCLFPGLESEIKNATLGEWLPILIMAIFNISDFVGKILAAVPYEWNGTRLLFFSCVRVVFIPLFIMCVYPAQMPMFSHPAWPCIFSLFMGITNGYFGSVPMIHAAGKVAPEQRELAGNIMTVSYMSGLMLGSVVA 493          
BLAST of slc29a-2 vs. Ensembl Xenopus
Match: slc29a2 (solute carrier family 29 (equilibrative nucleoside transporter), member 2 [Source:NCBI gene;Acc:548864])

HSP 1 Score: 64.6994 bits (156), Expect = 2.692e-10
Identity = 47/167 (28.14%), Postives = 80/167 (47.90%), Query Frame = 1
Query: 1411 RLQICKL---IWPHMIAMFLAYFVTLSVFPGVVTDIES----RKWKETF-PLFVMLVFNISDFIGKICTSIFRKTKGICLFXXXXXXXXX----XXXXXXXXXXHNAPVIYG-DFWVLFLISILGLSNGYFGCQPMLQAPQIVKDNQKEVSGNLMTTAYSLGLSMGV 1872
            ++ IC +   IW   + + L + VTLSVFP +   ++S     KW + F P+   L+FN+ D+ G+  TS        C F+  +           ++         P+++G D W +  + +   +NGYF    M  AP+ V  ++ E +G +MT   +LGLS+G 
Sbjct:  328 KVSICAVLRKIWVMALTIVLTFGVTLSVFPAITAAVKSGTTDEKWGKFFNPVCCFLIFNVMDWAGRSLTSYTLWPGPDCKFLPLIVSCRFVFIPAFMLCNISDKSYLPIVFGNDAWFIIFMILFSFTNGYFVSLSMCLAPKKVLAHESETTGAIMTFFLALGLSVGA 494          
BLAST of slc29a-2 vs. Ensembl Xenopus
Match: slc29a2 (solute carrier family 29 (equilibrative nucleoside transporter), member 2 [Source:NCBI gene;Acc:548864])

HSP 1 Score: 64.6994 bits (156), Expect = 2.730e-10
Identity = 47/166 (28.31%), Postives = 81/166 (48.80%), Query Frame = 1
Query: 1411 RLQICKL---IWPHMIAMFLAYFVTLSVFPGVVTDIES----RKWKETF-PLFVMLVFNISDFIGKICTSIFRKTKGICLFXXXXXXXXXXXXXXXXXX----XHNAPVIYG-DFWVLFLISILGLSNGYFGCQPMLQAPQIVKDNQKEVSGNLMTTAYSLGLSMG 1869
            ++ IC +   IW   + + L + VTLSVFP +   ++S     KW + F P+   L+FN+ D+ G+  TS        C F+  +     + +    +         P+++G D W +  + +   +NGYF    M  AP+ V  ++ E +G +MT   +LGLS+G
Sbjct:  282 KVSICAVLRKIWVMALTIVLTFGVTLSVFPAITAAVKSGTTDEKWGKFFNPVCCFLIFNVMDWAGRSLTSYTLWPGPDCKFLPLIVSCRFVFIPAFMLCNISDKSYLPIVFGNDAWFIIFMILFSFTNGYFVSLSMCLAPKKVLAHESETTGAIMTFFLALGLSVG 447          
BLAST of slc29a-2 vs. Ensembl Xenopus
Match: slc29a2 (solute carrier family 29 (equilibrative nucleoside transporter), member 2 [Source:NCBI gene;Acc:548864])

HSP 1 Score: 64.3142 bits (155), Expect = 2.887e-10
Identity = 47/166 (28.31%), Postives = 81/166 (48.80%), Query Frame = 1
Query: 1411 RLQICKL---IWPHMIAMFLAYFVTLSVFPGVVTDIES----RKWKETF-PLFVMLVFNISDFIGKICTSIFRKTKGICLFXXXXXXXXXXXXXXXXXX----XHNAPVIYG-DFWVLFLISILGLSNGYFGCQPMLQAPQIVKDNQKEVSGNLMTTAYSLGLSMG 1869
            ++ IC +   IW   + + L + VTLSVFP +   ++S     KW + F P+   L+FN+ D+ G+  TS        C F+  +     + +    +         P+++G D W +  + +   +NGYF    M  AP+ V  ++ E +G +MT   +LGLS+G
Sbjct:  280 KVSICAVLRKIWVMALTIVLTFGVTLSVFPAITAAVKSGTTDEKWGKFFNPVCCFLIFNVMDWAGRSLTSYTLWPGPDCKFLPLIVSCRFVFIPAFMLCNISDKSYLPIVFGNDAWFIIFMILFSFTNGYFVSLSMCLAPKKVLAHESETTGAIMTFFLALGLSVG 445          
BLAST of slc29a-2 vs. Ensembl Mouse
Match: Slc29a4 (solute carrier family 29 (nucleoside transporters), member 4 [Source:MGI Symbol;Acc:MGI:2385330])

HSP 1 Score: 138.272 bits (347), Expect = 3.927e-34
Identity = 74/174 (42.53%), Postives = 112/174 (64.37%), Query Frame = 1
Query:  388 PKDPKNLIFFSLILSGVGFLFPYNCLINAADYFQLKYCNNHLIYSISVAYVLAAVTTVSLNNLIVQSVHFIRRIIFGYXXXXXXXXXXXXXXXWFHVLSKEASYYWIVVATIITAVGCSIQQSSFYGYSSLLPRRYTQALMIGESLSGVLASAFRISTFMLL--DRTPTVYFFL 903
            P D  + I+F+++L+GVGFL PYN  I   DY   KY    +++ +S+ Y+L A+  V LNN++V+ ++   RI  GY+LA+  +L ++I  +W  + S + +Y   + A    A GC++QQSSFYGY+ LLP+RYTQ +M GES +GV+ S  RI T +LL  +R  T+ FFL
Sbjct:   63 PDDRYHAIYFAMLLAGVGFLLPYNSFITDVDYLHHKYPGTSIVFDMSLTYILVALAAVLLNNVVVERLNLHTRITTGYLLALGPLLFISICDVWLQLFSHDQAYAINLAAVGTVAFGCTVQQSSFYGYTGLLPKRYTQGVMTGESTAGVMISLSRILTKLLLPDERASTIIFFL 236          

HSP 2 Score: 98.9821 bits (245), Expect = 2.792e-21
Identity = 60/156 (38.46%), Postives = 94/156 (60.26%), Query Frame = 1
Query: 1402 LKFRLQICKLIWPHMIAMFLAYFVTLSVFPGVVTDIESRKWKETFPLFVMLVFNISDFIGKICTSIFRKTKGICLFXXXXXXXXXXXXXXXXXXXHNAPVIYGDFWVLFLISILGLSNGYFGCQPMLQAPQIVKDNQKEVSGNLMTTAYSLGLSMG 1869
            L  R  + ++IW  M+++ + YF+TL +FPG+ ++I      E  P+ VM VFN+SDF+GKI  ++  + +G  L  CS  R++ IPL I+C+ P   P +    W      ++G+SNGYFG  PM+ A   V   Q+E++GN MT +Y  GL++G
Sbjct:  338 LLHRYVVARVIWADMLSIAVTYFITLCLFPGLESEIRHCVLGEWLPILVMAVFNLSDFVGKILAALPVEWRGTHLLACSCLRVVFIPLFILCVYPSGMPALRHPAWPCVFSLLMGISNGYFGSVPMILAAGKVSPKQRELAGNTMTVSYMSGLTLG 493          
BLAST of slc29a-2 vs. Ensembl Mouse
Match: Slc29a2 (solute carrier family 29 (nucleoside transporters), member 2 [Source:MGI Symbol;Acc:MGI:1345278])

HSP 1 Score: 56.6102 bits (135), Expect = 5.337e-8
Identity = 46/158 (29.11%), Postives = 78/158 (49.37%), Query Frame = 1
Query: 1432 IWPHMIAMFLAYFVTLSVFPGVVTDIESR-----KWKETF-PLFVMLVFNISDFIGKICTSIF-----RKTKGICLFXXXXXXXXXXXXXXXXXXXHNAPVIY-GDFWVLFLISILGLSNGYFGCQPMLQAPQIVKDNQKEVSGNLMTTAYSLGLSMG 1869
            IW   + + L + VTLSVFP +   + +      KW   F P+   L+FN+ D++G+  TS F        + + L +C     + + ++         P+I+  D + +  + +  +SNGY     M  AP+ V  +++EV+G LMT   +LGLS G
Sbjct:  236 IWLTALCLVLVFTVTLSVFPAITAMVTTSSNSPGKWGLFFNPICCFLLFNVMDWLGRSLTSYFLWPDEDSQQLLPLLVCLRFLFVPLFMLCHVPQHARLPIIFRQDAYFITFMLLFAVSNGYLVSLTMCLAPRQVLPHEREVAGALMTFFLALGLSCG 393          
BLAST of slc29a-2 vs. Ensembl Mouse
Match: Slc29a2 (solute carrier family 29 (nucleoside transporters), member 2 [Source:MGI Symbol;Acc:MGI:1345278])

HSP 1 Score: 56.225 bits (134), Expect = 8.808e-8
Identity = 46/158 (29.11%), Postives = 78/158 (49.37%), Query Frame = 1
Query: 1432 IWPHMIAMFLAYFVTLSVFPGVVTDIESR-----KWKETF-PLFVMLVFNISDFIGKICTSIF-----RKTKGICLFXXXXXXXXXXXXXXXXXXXHNAPVIY-GDFWVLFLISILGLSNGYFGCQPMLQAPQIVKDNQKEVSGNLMTTAYSLGLSMG 1869
            IW   + + L + VTLSVFP +   + +      KW   F P+   L+FN+ D++G+  TS F        + + L +C     + + ++         P+I+  D + +  + +  +SNGY     M  AP+ V  +++EV+G LMT   +LGLS G
Sbjct:  288 IWLTALCLVLVFTVTLSVFPAITAMVTTSSNSPGKWGLFFNPICCFLLFNVMDWLGRSLTSYFLWPDEDSQQLLPLLVCLRFLFVPLFMLCHVPQHARLPIIFRQDAYFITFMLLFAVSNGYLVSLTMCLAPRQVLPHEREVAGALMTFFLALGLSCG 445          
BLAST of slc29a-2 vs. Ensembl Mouse
Match: Slc29a4 (solute carrier family 29 (nucleoside transporters), member 4 [Source:MGI Symbol;Acc:MGI:2385330])

HSP 1 Score: 46.595 bits (109), Expect = 6.068e-6
Identity = 18/44 (40.91%), Postives = 27/44 (61.36%), Query Frame = 1
Query:  388 PKDPKNLIFFSLILSGVGFLFPYNCLINAADYFQLKYCNNHLIY 519
            P D  + I+F+++L+GVGFL PYN  I   DY   KY    +++
Sbjct:   63 PDDRYHAIYFAMLLAGVGFLLPYNSFITDVDYLHHKYPGTSIVF 106          
BLAST of slc29a-2 vs. UniProt/SwissProt
Match: sp|Q7RTT9|S29A4_HUMAN (Equilibrative nucleoside transporter 4 OS=Homo sapiens OX=9606 GN=SLC29A4 PE=1 SV=1)

HSP 1 Score: 200.29 bits (508), Expect = 3.126e-55
Identity = 150/497 (30.18%), Postives = 253/497 (50.91%), Query Frame = 1
Query:  388 PKDPKNLIFFSLILSGVGFLFPYNCLINAADYFQLKYCNNHLIYSISVAYVLAAVTTVSLNNLIVQSVHFIRRIIFGYXXXXXXXXXXXXXXXWFHVLSKEASYYWIVVATIITAVGCSIQQSSFYGYSSLLPRRYTQALMIGESLSGVLASAFRISTFMLL--DRTPT-VYFFLCVGQMFICLIIFHISVRSGFVQHHLHRHQHNVLNVNSNSLIKSTHSLSYQINTPXXXXXXXXXXXXXXXXXXWTKTVSMEINNPAYAIEEDHLPQNEPPYLESSDDDEIEEAFDNDLESSDVDQSENSFSHLRKSSHTSKAIMINSRSTNQSNSAVINFLSNVKDGLKFRLQICKLIWPHMIAMFLAYFVTLSVFPGVVTDIESRKWKETFPLFVMLVFNISDFIGKICTSIFRKTKGICLFXXXXXXXXXXXXXXXXXXXHNAPVIYGDFWVLFLISILGLSNGYFGCQPMLQAPQIVKDNQKEVSGNLMTTAYSLGLSMG 1869
            P D  + I+F+++L+GVGFL PYN  I   DY   KY    +++ +S+ Y+L A+  V LNN++V+ +    RI  GY+LA+  +L ++I  +W  + S++ +Y   + A    A GC++QQSSFYGY+ +LP+RYTQ +M GES +GV+ S  RI T +LL  +R  T ++F + V    +C ++  +  RS FV  +  R + +  +     L +      Y+++                          +   +PA A+  +  P++ P + E +        FD  +    V +S  +F          +A++++                        R  + ++IW  M+++ + YF+TL +FPG+ ++I      E  P+ +M VFN+SDF+GKI  ++    +G  L  CS  R++ IPL I+C+ P   P +    W      ++G+SNGYFG  PM+ A   V   Q+E++GN MT +Y  GL++G
Sbjct:   63 PDDRYHAIYFAMLLAGVGFLLPYNSFITDVDYLHHKYPGTSIVFDMSLTYILVALAAVLLNNVLVERLTLHTRITAGYLLALGPLLFISICDVWLQLFSRDQAYAINLAAVGTVAFGCTVQQSSFYGYTGMLPKRYTQGVMTGESTAGVMISLSRILTKLLLPDERASTLIFFLVSVALELLCFLLHLLVRRSRFVLFYTTRPRDS--HRGRPGLGRG---YGYRVHHDVVAG-------------------DVHFEHPAPALAPNESPKDSPAH-EVTGSGGAYMRFD--VPRPRVQRSWPTF----------RALLLH------------------------RYVVARVIWADMLSIAVTYFITLCLFPGLESEIRHCILGEWLPILIMAVFNLSDFVGKILAALPVDWRGTHLLACSCLRVVFIPLFILCVYPSGMPALRHPAWPCIFSLLMGISNGYFGSVPMILAAGKVSPKQRELAGNTMTVSYMSGLTLG 498          
BLAST of slc29a-2 vs. UniProt/SwissProt
Match: sp|Q8R139|S29A4_MOUSE (Equilibrative nucleoside transporter 4 OS=Mus musculus OX=10090 GN=Slc29a4 PE=1 SV=1)

HSP 1 Score: 138.272 bits (347), Expect = 2.747e-33
Identity = 74/174 (42.53%), Postives = 112/174 (64.37%), Query Frame = 1
Query:  388 PKDPKNLIFFSLILSGVGFLFPYNCLINAADYFQLKYCNNHLIYSISVAYVLAAVTTVSLNNLIVQSVHFIRRIIFGYXXXXXXXXXXXXXXXWFHVLSKEASYYWIVVATIITAVGCSIQQSSFYGYSSLLPRRYTQALMIGESLSGVLASAFRISTFMLL--DRTPTVYFFL 903
            P D  + I+F+++L+GVGFL PYN  I   DY   KY    +++ +S+ Y+L A+  V LNN++V+ ++   RI  GY+LA+  +L ++I  +W  + S + +Y   + A    A GC++QQSSFYGY+ LLP+RYTQ +M GES +GV+ S  RI T +LL  +R  T+ FFL
Sbjct:   63 PDDRYHAIYFAMLLAGVGFLLPYNSFITDVDYLHHKYPGTSIVFDMSLTYILVALAAVLLNNVVVERLNLHTRITTGYLLALGPLLFISICDVWLQLFSHDQAYAINLAAVGTVAFGCTVQQSSFYGYTGLLPKRYTQGVMTGESTAGVMISLSRILTKLLLPDERASTIIFFL 236          

HSP 2 Score: 98.9821 bits (245), Expect = 1.953e-20
Identity = 60/156 (38.46%), Postives = 94/156 (60.26%), Query Frame = 1
Query: 1402 LKFRLQICKLIWPHMIAMFLAYFVTLSVFPGVVTDIESRKWKETFPLFVMLVFNISDFIGKICTSIFRKTKGICLFXXXXXXXXXXXXXXXXXXXHNAPVIYGDFWVLFLISILGLSNGYFGCQPMLQAPQIVKDNQKEVSGNLMTTAYSLGLSMG 1869
            L  R  + ++IW  M+++ + YF+TL +FPG+ ++I      E  P+ VM VFN+SDF+GKI  ++  + +G  L  CS  R++ IPL I+C+ P   P +    W      ++G+SNGYFG  PM+ A   V   Q+E++GN MT +Y  GL++G
Sbjct:  338 LLHRYVVARVIWADMLSIAVTYFITLCLFPGLESEIRHCVLGEWLPILVMAVFNLSDFVGKILAALPVEWRGTHLLACSCLRVVFIPLFILCVYPSGMPALRHPAWPCVFSLLMGISNGYFGSVPMILAAGKVSPKQRELAGNTMTVSYMSGLTLG 493          
BLAST of slc29a-2 vs. UniProt/SwissProt
Match: sp|A1L272|S29A4_DANRE (Equilibrative nucleoside transporter 4 OS=Danio rerio OX=7955 GN=slc29a4 PE=2 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 6.716e-32
Identity = 78/227 (34.36%), Postives = 134/227 (59.03%), Query Frame = 1
Query:  388 PKDPKNLIFFSLILSGVGFLFPYNCLINAADYFQLKYCNNHLIYSISVAYVLAAVTTVSLNNLIVQSVHFIRRIIFGYXXXXXXXXXXXXXXXWFHVLSKEASYYWIVVATIITAVGCSIQQSSFYGYSSLLPRRYTQALMIGESLSGVLASAFRISTFMLL--DRTPTVYFF-LCVGQMFICLIIFHISVRSGFVQHHLHRHQHNVLNVNSNSLIKSTHSLSYQIN 1059
            P D  + I+F+++L+GVGFL PYN  I   DY   K+    +++ + + Y+L A+  V LNN++V+ +    RI  GY+ A+  +L +TI  +W    + + +Y   +++    A GC++QQSSFYGY  +LP+RYTQ +M GES +GV+ S  RI T +L+  +R  T+ FF + +  + +C I+  +  R+ FVQ++    +  +    S++   S H+  YQ++
Sbjct:   61 PDDRYHGIYFAMLLAGVGFLLPYNSFITDVDYLHHKFEGTSIVFDMGLTYILVALVAVILNNVLVEMLSLHTRITVGYLFALGPLLFVTIFDVWLERFTIKQAYVINLMSMGTVAFGCTVQQSSFYGYMGMLPKRYTQGVMTGESTAGVIISLSRIFTKLLIKDERKNTIIFFVISICMVLVCFILHLLVRRTRFVQYYTSLARRGL----SHAKDHSQHASQYQVH 283          

HSP 2 Score: 102.449 bits (254), Expect = 1.349e-21
Identity = 60/165 (36.36%), Postives = 99/165 (60.00%), Query Frame = 1
Query: 1387 NVKDGLKFRLQICKLIWPHMIAMFLAYFVTLSVFPGVVTDIESRKWKETFPLFVMLVFNISDFIGKICTSIFRKTKGICLFXXXXXXXXXXXXXXXXXXXHNAPVIYGDFWVLFLISILGLSNGYFGCQPMLQAPQIVKDNQKEVSGNLMTTAYSLGLSMGVLSA 1881
             VKD +  R  + ++IW +M+++ + YF+TL +FPG+ ++I++    E  P+ +M +FNISDF+GKI  ++  +  G  L   S  R++ IPL I+C+ P   P+     W       +G++NGYFG  PM+ A   V   Q+E++GN+MT +Y  GL +G + A
Sbjct:  329 GVKDMILHRYVVARVIWTYMLSIAVTYFITLCLFPGLESEIKNATLGEWLPILIMAIFNISDFVGKILAAVPYEWNGTRLLFFSCVRVVFIPLFIMCVYPAQMPMFSHPAWPCIFSLFMGITNGYFGSVPMIHAAGKVAPEQRELAGNIMTVSYMSGLMLGSVVA 493          
BLAST of slc29a-2 vs. UniProt/SwissProt
Match: sp|Q84XI3|ENT8_ARATH (Equilibrative nucleotide transporter 8 OS=Arabidopsis thaliana OX=3702 GN=ETN8 PE=2 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 1.028e-10
Identity = 58/216 (26.85%), Postives = 100/216 (46.30%), Query Frame = 1
Query:  391 KDPKNLIFFSLILSGVGFLFPYNCLINAADYFQLKYCNNHLIYSISVAYVLAAVTTVSLNNLIVQSVHFIRRIIFGYXXXXXXXXXX-XXXXXWFHVLSKEASYYWIVVATIITAVGCSIQQSSFYGYSSLLPRRYTQALMIGESLSGVLASAFRISTFMLLDRTPT-------VYFFLCVGQMFICLIIFHISVRSGFVQHHLHRHQ--HNVLNV 1008
            +D   + +    L G G L P+N LI A DYF   Y + H+  + +VAY+  +V  + L       + +  R+  G+ + I  M++   I  +W     +  SY  +V + ++  +   +   S  G +  LPR+Y QA+  G + SG++ S  RI+T   L +TP         YF +    +  C I  ++  +   +Q HL  HQ  H+ L +
Sbjct:   14 RDAYRVAYVIHFLLGAGSLIPWNALITAVDYFGYLYPDKHVEKTFTVAYMSCSVLVLVLMMTWNTRMSYRVRMNLGFSMFIIAMMISPLIDWVWKGEKGENVSYMLMVGSVVLCGLADGVVGGSLIGSAGKLPRQYMQAIFAGTASSGIIISLLRIATKASLPQTPQGMRTSAHSYFIVSSTILLCCFISCNVLHKLPVMQQHLKFHQPLHSTLTI 229          

HSP 2 Score: 63.929 bits (154), Expect = 1.830e-9
Identity = 44/154 (28.57%), Postives = 75/154 (48.70%), Query Frame = 1
Query: 1426 KLIWPHMIAMFLAYFVTLSVFPGVVTD-IESRKWKETFPLFVMLVFNISDFIGKICTSIF-----RKTKGICLFXXXXXXXXXXXXXXXXXXXHNAPVIYGDFWVLFLISILGLSNGYFGCQPMLQAPQIVKDNQKEVSGNLMTTAYSLGLSMG 1869
            K+ WP    M + Y VTLS+FPG + + ++S+  +  +P+ ++ V+NISDF+GK  T+++     +     C+       +    L     +    PV+   F       +LGL+NGY     M+ AP+ V  ++ E++   M     LGL  G
Sbjct:  235 KIKWPAS-GMLIIYSVTLSIFPGFIAENLKSQLLQSWYPILLITVYNISDFVGKSLTALYLWQSIKSATWACIVRLLFYPLFSACLRGPKWLRTEVPVVVLTF-------MLGLTNGYLTSVLMIMAPKTVHASEAELAAIFMVVFLGLGLVCG 380          
BLAST of slc29a-2 vs. UniProt/SwissProt
Match: sp|P31381|FUN26_YEAST (Nucleoside transporter FUN26 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FUN26 PE=1 SV=1)

HSP 1 Score: 64.3142 bits (155), Expect = 2.221e-9
Identity = 54/221 (24.43%), Postives = 115/221 (52.04%), Query Frame = 1
Query:  391 KDPKNLIFFSLILSGVGFLFPYNCLINAADYFQLKYCNNHLIYSISVAYVLAAVTTVS--LNNLIV--QSVHFIRRIIFGYXXXXXXXXXXXXXXXWFHVLSKEASYYWIVVATIITAVGCSIQQSSFYGYSSLLPRRYTQALMIGESLSGVLAS------AFRISTFMLLDRTPTVYFFLCVGQMFICLIIFHISVRSGFVQHHLHRHQHNVLNVNSNSL 1023
            K  KNL + +    G+G L+P+NC+++A+ YF+     +  I++      + + +T+S  L N+ +  +   + RR+I G V  I V  ++    I   +L K  ++ +I++  +I+++G ++ Q+     +++    Y+Q +M+G++++GVL S      AF  ++ +       +YFF     + IC+++F +S  S  V  + +    ++ +V   SL
Sbjct:   71 KKLKNLSYITFFAIGIGLLWPWNCILSASQYFKHDIFKDTSIWAKIFTSSMMSFSTISSMLFNIYLAKRQYKYSRRVINGLVWEIIVFTVMCFFTILHFLLPKWFNFMFIMMLVVISSMGTAMTQNGIMAIANVFGSEYSQGVMVGQAVAGVLPSLVLFALAFIENSSVSTTGGILLYFFTTTLVVTICVVMFSVSKISRKVNENWNVEDGHITDVLLGSL 291          
BLAST of slc29a-2 vs. TrEMBL
Match: A0A0H3YF77 (Slc29a-2 OS=Schmidtea mediterranea OX=79327 GN=slc29a-2 PE=2 SV=1)

HSP 1 Score: 1061.6 bits (2744), Expect = 0.000e+0
Identity = 612/612 (100.00%), Postives = 612/612 (100.00%), Query Frame = 1
Query:  133 MEYVSLDQTDINDQXXXXXXXXXXXXMPEKSTVISNLNFEXXXXXXXXXXXXXXXXXXXFRRELYKKQVNCQNRASLIVHMVTNSPKDPKNLIFFSLILSGVGFLFPYNCLINAADYFQLKYCNNHLIYSISVAYVLAAVTTVSLNNLIVQSVHFIRRIIFGYXXXXXXXXXXXXXXXWFHVLSKEASYYWIVVATIITAVGCSIQQSSFYGYSSLLPRRYTQALMIGESLSGVLASAFRISTFMLLDRTPTVYFFLCVGQMFICLIIFHISVRSGFVQHHLHRHQHNVLNVNSNSLIKSTHSLSYQINTPXXXXXXXXXXXXXXXXXXWTKTVSMEINNPAYAIEEDHLPQNEPPYLESSDDDEIEEAFDNDLESSDVDQSENSFSHLRKSSHTSKAIMINSRSTNQSNSAVINFLSNVKDGLKFRLQICKLIWPHMIAMFLAYFVTLSVFPGVVTDIESRKWKETFPLFVMLVFNISDFIGKICTSIFRKTKGICLFXXXXXXXXXXXXXXXXXXXHNAPVIYGDFWVLFLISILGLSNGYFGCQPMLQAPQIVKDNQKEVSGNLMTTAYSLGLSMGVLSALQIKYTLIIPNNKPNLTVHSIVNLTFDRC 1968
            MEYVSLDQTDINDQNSNNCSSSNISNMPEKSTVISNLNFENIKSHIKNKAKKGKKKISKFRRELYKKQVNCQNRASLIVHMVTNSPKDPKNLIFFSLILSGVGFLFPYNCLINAADYFQLKYCNNHLIYSISVAYVLAAVTTVSLNNLIVQSVHFIRRIIFGYVLAITVMLLLTIVIIWFHVLSKEASYYWIVVATIITAVGCSIQQSSFYGYSSLLPRRYTQALMIGESLSGVLASAFRISTFMLLDRTPTVYFFLCVGQMFICLIIFHISVRSGFVQHHLHRHQHNVLNVNSNSLIKSTHSLSYQINTPNSNSFNNNIHSNVSIHNNWTKTVSMEINNPAYAIEEDHLPQNEPPYLESSDDDEIEEAFDNDLESSDVDQSENSFSHLRKSSHTSKAIMINSRSTNQSNSAVINFLSNVKDGLKFRLQICKLIWPHMIAMFLAYFVTLSVFPGVVTDIESRKWKETFPLFVMLVFNISDFIGKICTSIFRKTKGICLFICSLSRILLIPLIIICIIPHNAPVIYGDFWVLFLISILGLSNGYFGCQPMLQAPQIVKDNQKEVSGNLMTTAYSLGLSMGVLSALQIKYTLIIPNNKPNLTVHSIVNLTFDRC
Sbjct:    1 MEYVSLDQTDINDQNSNNCSSSNISNMPEKSTVISNLNFENIKSHIKNKAKKGKKKISKFRRELYKKQVNCQNRASLIVHMVTNSPKDPKNLIFFSLILSGVGFLFPYNCLINAADYFQLKYCNNHLIYSISVAYVLAAVTTVSLNNLIVQSVHFIRRIIFGYVLAITVMLLLTIVIIWFHVLSKEASYYWIVVATIITAVGCSIQQSSFYGYSSLLPRRYTQALMIGESLSGVLASAFRISTFMLLDRTPTVYFFLCVGQMFICLIIFHISVRSGFVQHHLHRHQHNVLNVNSNSLIKSTHSLSYQINTPNSNSFNNNIHSNVSIHNNWTKTVSMEINNPAYAIEEDHLPQNEPPYLESSDDDEIEEAFDNDLESSDVDQSENSFSHLRKSSHTSKAIMINSRSTNQSNSAVINFLSNVKDGLKFRLQICKLIWPHMIAMFLAYFVTLSVFPGVVTDIESRKWKETFPLFVMLVFNISDFIGKICTSIFRKTKGICLFICSLSRILLIPLIIICIIPHNAPVIYGDFWVLFLISILGLSNGYFGCQPMLQAPQIVKDNQKEVSGNLMTTAYSLGLSMGVLSALQIKYTLIIPNNKPNLTVHSIVNLTFDRC 612          
BLAST of slc29a-2 vs. TrEMBL
Match: A0A2T7PD42 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_06755 PE=4 SV=1)

HSP 1 Score: 269.626 bits (688), Expect = 4.679e-78
Identity = 176/518 (33.98%), Postives = 283/518 (54.63%), Query Frame = 1
Query:  388 PKDPKNLIFFSLILSGVGFLFPYNCLINAADYFQLKYCNNHLIYSISVAYVLAAVTTVSLNNLIVQSVHFIRRIIFGYXXXXXXXXXXXXXXXWFHVLSKEASYYWIVVATIITAVGCSIQQSSFYGYSSLLPRRYTQALMIGESLSGVLASAFRISTFMLL--DRTPTVYFF-LCVGQMFICLIIFHISVRSGFVQHHLHRHQHNVLNVNSNSLIKSTHSLSYQINTPXXXXXXXXXXXXXXXXXXWTKTVSM-----EINNPAYAIEEDHLPQN-----EPPYLESSDDDEIEEAFDNDLESSDVDQSENSFSHLRKSSHTSKAIMINSRSTNQSNSAVINFLSNVKDGLKFRLQICKLIWPHMIAMFLAYFVTLSVFPGVVTDIESRKWKETFPLFVMLVFNISDFIGKICTSIFRKTKGICLFXXXXXXXXXXXXXXXXXXXHNAPVIYGDFWVLFLISILGLSNGYFGCQPMLQAPQIVKDNQKEVSGNLMTTAYSLGLSMGVLSALQIKYTL 1902
            P+DP + ++ +L+L+G GFL PYN  I A DY+Q +Y  + +++ +S+ Y++ A  +V +NN +++ +    RI FGY+L+   ++ + +  +WF +   + +Y   + A  + AVG ++QQSSFYGY+S+LP RYTQA+M GESL+GVL SA RI T  LL  +R  T+ FF + +G +  C ++FH++ RS FV+ ++        N++     K T  LSY                        T+ VS+     + +N  Y +   H P       +PP +  S D             +  D+ E   S + + + T           +QS    +  +S +K GL  R ++ + +WP+M+++ LAYFVTL +FPG+ +++ S       P+ +M  FN+SD IGKI  SI        L +C+  R+L +PL+++C  P   PVI G+ W +    +LGLSNGYFG  P++ AP+ V D Q+E+ GN+MT +YSLGL+ G  +A  + Y L
Sbjct:   61 PRDPCSCVYLALVLAGAGFLLPYNSFITAVDYYQKRYPGSTIVFDMSLTYIVVAFVSVIINNALIEVLRMPVRITFGYILSFITLMCIALCDLWFELFPADIAYRVTLTAVGVVAVGSTVQQSSFYGYTSMLPSRYTQAVMTGESLAGVLVSANRILTKALLNDERINTIIFFCVSIGILLACFVVFHVARRSNFVKFYVMLCAATADNLDHKEK-KLTSQLSY------------------------TEDVSLVDFQDQESNQRYGVLVIHSPSEVNRAFQPPEIAGSGDRTGHRP-SQATSMAGCDE-ETCLSQVSEVTFTQ----------SQSYKIHVPKVSAIKRGLLTRYEVSRSVWPYMLSICLAYFVTLCLFPGIESEVVSCTLGTWMPVIMMAAFNLSDVIGKILASIPCDWPPGRLLLCTFCRVLCVPLLMLCASPRLHPVIAGEAWPIVFSLVLGLSNGYFGSVPIILAPEHVPDEQREICGNIMTLSYSLGLTTGSAAAYLLDYWL 541          
BLAST of slc29a-2 vs. TrEMBL
Match: A0A4Y2HGQ4 (Equilibrative nucleoside transporter 4 OS=Araneus ventricosus OX=182803 GN=slc29a4 PE=4 SV=1)

HSP 1 Score: 256.529 bits (654), Expect = 3.586e-73
Identity = 183/544 (33.64%), Postives = 289/544 (53.12%), Query Frame = 1
Query:  376 VTNSPKDPKNLIFFSLILSGVGFLFPYNCLINAADYFQLKYCNNHLIYSISVAYVLAAVTTVSLNNLIVQSVHFIRRIIFGYXXXXXXXXXXXXXXXWFHVLSKEASYYWIVVATIITAVGCSIQQSSFYGYSSLLPRRYTQALMIGESLSGVLASAFRISTFMLLDRTP--TVYFFLCVGQMFI--CLIIFHISVRSGFVQHHLHRHQH--NVLNVNSNSLIKSTHSLSYQINTPXXXXXXXXXXXXXXXXXXWTKTVSMEINNPAYAIEEDHLPQNEPPYLESSDDDEIEEAFDNDLESSDVDQSENSFSHLRKSSHTS-----------KAIMINSRSTNQSNSAVINFLSNVKDGLKFRLQICKLIWPHMIAMFLAYFVTLSVFPGVVTDIESRKWKETFPLFVMLVFNISDFIGKICTSIFRKTKGICLFXXXXXXXXXXXXXXXXXXXHNAPVIYGDFWVLFLISILGLSNGYFGCQPMLQAPQIVKDNQKEVSGNLMTTAYSLGLSMGVLSALQIKYTLIIPNNKPNLTVHSIVNLT 1956
            +   P D  + I+ +L+L+GVGFL PYN  I A DYFQ +Y    +++ +S+ Y+L A+  V +NNL+V+++    RI FGYV+A   +L +    IWF +      YY  ++A  + + GC++QQSSFYGY+S+LP RYTQA+M GES +G+L S  RI T  LL+     T+ FF C+   FI  C +IF +  RS F+ ++++R +   +  ++  + +++ T  +                             V M   + A   +   L    PP   +S   + E   D  ++    D SE+++    +S H S           + +++  R T  S    I +   +K G+K R ++ +LIWP+M+++ LAYFVTL +FPG+ ++I S       P+ +M +FN  DFIGKI  S+        L + S SR+ L+PL+ +C  P  +P + G+ W +    +LGLSNG  G  PM+ AP +V D +KE++GN+MT +Y LGL+ G   A  I Y L  P   P   + SI++ T
Sbjct:   29 INRPPNDRCHCIYIALLLAGVGFLLPYNSFIIAVDYFQSRYPATTIVFDMSLIYILVALVAVIINNLLVETLSLKTRITFGYVVAFLTLLFVAFFEIWFEIFDLRLGYYVNLLAVAVVSFGCTVQQSSFYGYTSMLPARYTQAVMTGESAAGLLVSTNRILTKALLENEKFNTIIFF-CISIAFIVLCFVIFVLLRRSEFIYYYVNRCRDYSDSDDLQKHIVLEPTEDVG---------------------------LVDMLDPSEAKCGKYGVLSLRSPP---ASPVVQSEAEVDPSMQ----DGSEDNWIGSTESVHASIVFGGGTRYRVQDVVVCMRGTTYSKH--IQWWRGIKRGIKNRWEVSQLIWPYMLSIGLAYFVTLCLFPGIESEIVSCCLGSWMPVILMAIFNFFDFIGKILASVSHDWTRRQLLLLSASRVFLVPLLALCAAPRGSPYLSGEGWSMIFSLLLGLSNGIAGSVPMIVAPSVVPDERKELTGNIMTLSYMLGLTTGSGVAYLIDYFLGPPLLHPCPELISIISTT 535          
BLAST of slc29a-2 vs. TrEMBL
Match: A0A553NTC2 (Uncharacterized protein OS=Tigriopus californicus OX=6832 GN=TCAL_07239 PE=4 SV=1)

HSP 1 Score: 253.062 bits (645), Expect = 1.623e-72
Identity = 183/505 (36.24%), Postives = 272/505 (53.86%), Query Frame = 1
Query:  376 VTNSPKDPKNLIFFSLILSGVGFLFPYNCLINAADYFQLKYCNNHLIYSISVAYVLAAVTTVSLNNLIVQSVHFIRRIIFGYXXXXXXXXXXXXXXXWFHVLSKEASYYWIVVATIITAVGCSIQQSSFYGYSSLLPRRYTQALMIGESLSGVLASAFRISTFMLLD--RTPTVYFFLCVGQMFICLIIF---HISVRSGFVQHHLHRHQHNVLNVNSNSLIKSTHSLSYQINTPXXXXXXXXXXXXXXXXXXWTKTVSMEINNPAYAIEEDHLPQNEPPYLESSDDDEIEEAFDNDLESSDVDQSENSF--SHLRKSSHTSKAIMINSRSTNQSNSAVINFLSNVKDGLKFRLQICKLIWPHMIAMFLAYFVTLSVFPGVVTDIESRKWKETFPLFVMLVFNISDFIGKICTSIFRKTKGICLFXXXXXXXXXXXXXXXXXXXHNAPVIYGDFWVLFLISILGLSNGYFGCQPMLQAPQIVKDNQKEVSGNLMTTAYSLGLSMG 1869
            V   P D  N ++  ++L+GVGFL PYN  I A DYFQ KY  + +I+ +S+ Y+L+A  +V LNN++V+ +    RI  GY ++ +V++ +T+  +W  VL KE +Y  I+++  + AVGC++QQSSFYGY+S+LP RYTQA+M GES +G + S  RI T  L++   T T+YFF  +  M +   IF   HIS  S FV +++   Q       S  ++      +  I TP                                         NE    E+S+    E     D    D+D S   F  S          AI I   S N+         S++K GL+ R  I ++IWP+M+A+ LAYFVTL +FPG+ ++I S   +   P+ VM VFN+SD IGKI  ++  K     L + S+SR+LLIPL++ C  P   P+I  + + L + + LG+SNG FG  PM+ AP  V + QKE++GN+MT +YS+GL++G
Sbjct:   30 VAPPPLDRHNAVYLGMVLAGVGFLLPYNSFIIAVDYFQDKYPGSTIIFDMSLVYILSAFGSVLLNNMLVEVLSMNIRICIGYAISFSVLMFITVFEVWLDVLPKEDAYRIILLSISLLAVGCTVQQSSFYGYTSMLPTRYTQAVMAGESAAGFIISVSRILTKTLIEDIHTNTMYFF-GLSLMIVVACIFSYSHIS-ESDFVSYYIQICQP------SKGILTMRPGDTPMITTPTRI--------------------------------------NENSERENSNTSNGEGPSITDYVEVDLDDSRPIFGPSCQLGDDGGMPAIQIFKESPNRLK----KLYSDIKGGLQDRWTIVRIIWPYMLAIALAYFVTLCLFPGIESEITSCSLQSWMPILVMAVFNLSDLIGKILAALPYKWSRPELVLVSISRVLLIPLMLFCATPRAQPLISNEGYSLVISAALGMSNGIFGSVPMMLAPTKVDETQKELAGNIMTLSYSMGLTVG 484          
BLAST of slc29a-2 vs. TrEMBL
Match: R7V9M4 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_221558 PE=4 SV=1)

HSP 1 Score: 251.521 bits (641), Expect = 9.339e-72
Identity = 165/513 (32.16%), Postives = 273/513 (53.22%), Query Frame = 1
Query:  343 CQNRASLIVHMVTNSPKDPKNLIFFSLILSGVGFLFPYNCLINAADYFQLKYCNNHLIYSISVAYVLAAVTTVSLNNLIVQSVHFIRRIIFGYXXXXXXXXXXXXXXXWFHVLSKEASYYWIVVATIITAVGCSIQQSSFYGYSSLLPRRYTQALMIGESLSGVLASAFRISTFMLLD---RTPTVYFFLCVGQMFICLIIFHISVRSGFVQHHLHRHQHNVLNVNSNSLIKSTHSLSYQINTPXXXXXXXXXXXXXXXXXXWTKTVSMEINNPAYAIEEDHLPQNEPPYLESSDDDEIEEAFDNDLESSDVDQSENSFSHLRKSSHTSKAIMINSRSTNQSNSAVINFLSNVKDGLKFRLQICKLIWPHMIAMFLAYFVTLSVFPGVVTDIESRKWKETFPLFVMLVFNISDFIGKICTSI-FRKTKGICLFXXXXXXXXXXXXXXXXXXXHNAPVIYGDFWVLFLISILGLSNGYFGCQPMLQAPQIVKDNQKEVSGNLMTTAYSLGLSMG 1869
            C    S I    +    D  + ++  ++L G GFL PYN  I A DY+Q KY  + +I+ +S  Y+  A   + +NN++V++     RI FGYV A+ ++ L+TI  +   + S + SY+  + A  + A+GC++QQSSFYGY+S+LP+RYTQA+M GES +GV+ S  RI T   L    R   ++F + +  + +C IIFH +  + FV++H+   +   L+       +   ++++Q+  P                    + +   +    Y +     P +  P     D   I    D           E   + L+   H+ K      R  ++ +S        +K+G++ R  + K +WP M+++ LAYFVTL +FPG+ ++I S  W    P+ ++ +FN SDF GK+  SI +   +G  +F  S  RI+L+PL+++C  P ++P++ G+ W + L  +LGL+NGYFG  PM+ AP  V D QKE++GN+MT +Y LGL++G
Sbjct:   10 CHGGRSAIRTTSSPPAADRCSAVYLGMLLCGAGFLLPYNSFITAVDYYQGKYPGSTIIFDMSFTYICTAFVALLVNNILVETFSLNVRISFGYVTALVMLCLVTIFDVSLEMFSSDVSYFVTLAAVSLIALGCTVQQSSFYGYTSMLPKRYTQAVMTGESAAGVIVSVNRILTKSFLSDPRRNTVIFFGVSIASVVLCCIIFHATRHTTFVRYHVGVCRTAALD-------EDARAITHQVCNPEEVGL--------------VEILDGTVTRDHYGVLVLQSPSSPGP-----DTPAIPGGRDRSGPEQIARAHE---TQLKFKGHSYK------RHISRWDS--------LKNGVRRRWAVAKGVWPFMLSIGLAYFVTLCLFPGIESEIVSCHWASWMPILLISIFNFSDFCGKVLASIPYEWPRGRLVF-FSCLRIVLVPLMMLCAAPRSSPILKGETWAMLLSMLLGLTNGYFGSIPMILAPSTVPDEQKELTGNIMTLSYGLGLTLG 478          
BLAST of slc29a-2 vs. Ensembl Cavefish
Match: si:ch211-160d14.6 (pep primary_assembly:Astyanax_mexicanus-2.0:12:22677910:22690616:1 gene:ENSAMXG00000004281.2 transcript:ENSAMXT00000004377.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:si:ch211-160d14.6)

HSP 1 Score: 167.933 bits (424), Expect = 1.019e-44
Identity = 121/405 (29.88%), Postives = 200/405 (49.38%), Query Frame = 1
Query:  667 WFHVLSKEASYYWIVVATIITAVGCSIQQSSFYGYSSLLPRRYTQALMIGESLSGVLASAFRISTFMLLD--RTPTVYFFL-CVGQMFICLIIFHISVRSGFVQHHLHRHQHNVLNVNSNSLIKSTHSLS-YQINTPXXXXXXXXXXXXXXXXXXWTKTVSMEINNPAYAIEEDHLPQNEPPYLESSDDDEIEEAFDNDLESSDVDQSENSFSHLRKSSHTSKAIMINSRSTNQSNSAVINFLSNVKDGLKFRLQICKLIWPHMIAMFLAYFVTLSVFPGVVTDIESRKWKETFPLFVMLVFNISDFIGKICTSIFRKTKGICLFXXXXXXXXXXXXXXXXXXXHNAPVIYGDFWVLFLISILGLSNGYFGCQPMLQAPQIVKDNQKEVSGNLMTTAYSLGLSMG 1869
            W  + + + SY   + A  I A GC++QQSSFYGY+ +LP+RYTQ +M GES +GV+ S  RI T +L++  +  T+ FFL  V    +C ++  +  R+ FV+HH  R +     VN      S    S YQI+                                                 ++S +DE     D  + S+ V   E   ++L     T     ++   T ++        S++KD +  R  + ++IWP+M+++ + YF+TL +FPG+ +++++    E  P+  M +FN++DF+GKI  +   +  G+ L +CS  R+L +PL ++C+ P   P++    W      +LG+SNGY G  PM+QA   V   Q+E++GN MT +Y  GL +G
Sbjct:  127 WLELFNSQQSYAITLAAVAIVAFGCTVQQSSFYGYTGMLPKRYTQGVMTGESTAGVIVSLSRIFTKLLVENEKNNTIIFFLFSVSMETLCFLLHMLVRRTRFVRHHTERARLGDAWVNGQISAASVQQRSRYQIHR------------------------------------------------DASTEDE-----DGPISSTPV---EADAANLNNGDGTYVRFDVSKPKTKRT-------WSSIKDVMVRRCAVARVIWPYMLSISVTYFITLCLFPGLESELQNDTLGEWLPILTMALFNMADFVGKILAACPYEWGGVQLLVCSCVRVLFLPLFVMCVSPAQHPLLSHPAWPCAFSLLLGISNGYLGSVPMIQAAGNVPPQQRELAGNTMTVSYMAGLMLG 468          
BLAST of slc29a-2 vs. Ensembl Cavefish
Match: slc29a4 (solute carrier family 29 member 4 [Source:NCBI gene;Acc:103031706])

HSP 1 Score: 119.783 bits (299), Expect = 3.620e-28
Identity = 70/199 (35.18%), Postives = 121/199 (60.80%), Query Frame = 1
Query:  388 PKDPKNLIFFSLILSGVGFLFPYNCLINAADYFQLKYCNNHLIYSISVAYVLAAVTTVSLNNLIVQSVHFIRRIIFGYXXXXXXXXXXXXXXXWFHVLSKEASYYWIVVATIITAVGCSIQQSSFYGYSSLLPRRYTQALMIGESLSGVLASAFRISTFMLL---DRTPTVYFFLCVGQMFICLIIFHISVRSGFVQHH 975
            P D  + I+F+++L+GVGFL PYN  I   DY   K+    +++ +S+ Y+L A+  V LNN++V+ +    RI  GY+ A+  +L ++I  +W    +   +Y   +++  + A GC++QQSSFYGY  +LP+RYTQ +M GES +GV+ S  RI T +L+    +   ++F + +G   +C I+  +  R+ FV+++
Sbjct:   61 PDDRYHGIYFAMLLAGVGFLLPYNSFITDVDYLHHKFEGTSIVFDMSLTYILVALVAVVLNNVLVEMLSLHTRITVGYLFALGPLLFVSIFDVWLEKFTTNQAYALNLISVGVVAFGCTVQQSSFYGYMGMLPKRYTQGVMTGESTAGVIISLSRIFTKLLIKDEKKNTIIFFLISIGMEMMCFILHLLVRRTRFVRYY 259          

HSP 2 Score: 102.064 bits (253), Expect = 2.058e-22
Identity = 64/194 (32.99%), Postives = 111/194 (57.22%), Query Frame = 1
Query: 1387 NVKDGLKFRLQICKLIWPHMIAMFLAYFVTLSVFPGVVTDIESRKWKETFPLFVMLVFNISDFIGKICTSIFRKTKGICLFXXXXXXXXXXXXXXXXXXXHNAPVIYGDFWVLFLISILGLSNGYFGCQPMLQAPQIVKDNQKEVSGNLMTTAYSLGLSMG-VLSALQIKYTLIIPNNKPNLTVHSIVNLTFDR 1965
             +KD +  R  + ++IW +M+++ + YF+TL +FPG+ ++I +    E  P+ +M +FN+SDF+GKI  ++  +  G+ L   S  R++ IPL I+C+ P   P +    W      ++G++NGYFG  PM+QA   +   Q+E++GN MT +Y  GL +G V++    ++T       P   +HS   L F +
Sbjct:  334 GIKDMILHRYVVSRVIWTYMLSIAVTYFITLCLFPGLESEIRNATLGEWLPILIMAIFNMSDFVGKILAALPYEWNGMRLLFFSCVRVVFIPLFIMCVFPVPKPTLSHPAWPCIFSLLMGVTNGYFGSVPMIQAAGKLPPEQRELAGNTMTVSYMAGLMLGSVVAYAAYRFT------APGSGLHSETGLNFTQ 521          
BLAST of slc29a-2 vs. Ensembl Cavefish
Match: slc29a4 (solute carrier family 29 member 4 [Source:NCBI gene;Acc:103031706])

HSP 1 Score: 110.153 bits (274), Expect = 5.205e-25
Identity = 70/202 (34.65%), Postives = 121/202 (59.90%), Query Frame = 1
Query:  388 PKDPKNLIFFSLILSGVGFLFPYNCLINAADYFQLKYCNNHLIYSISVAYVLAAVTTVSLNNLIVQSVHFIRRIIFGYXXXXXXXXXXXXXXXWFHVLSKEASYYWIVVATIITAVGCS--IQ-QSSFYGYSSLLPRRYTQALMIGESLSGVLASAFRISTFMLL---DRTPTVYFFLCVGQMFICLIIFHISVRSGFVQHH 975
            P D  + I+F+++L+GVGFL PYN  I   DY   K+    +++ +S+ Y+L A+  V LNN++V+ +    RI  GY+ A+  +L ++I  +W    +   +Y   +++  + A GC+  +Q QSSFYGY  +LP+RYTQ +M GES +GV+ S  RI T +L+    +   ++F + +G   +C I+  +  R+ FV+++
Sbjct:   61 PDDRYHGIYFAMLLAGVGFLLPYNSFITDVDYLHHKFEGTSIVFDMSLTYILVALVAVVLNNVLVEMLSLHTRITVGYLFALGPLLFVSIFDVWLEKFTTNQAYALNLISVGVVAFGCTDGVQHQSSFYGYMGMLPKRYTQGVMTGESTAGVIISLSRIFTKLLIKDEKKNTIIFFLISIGMEMMCFILHLLVRRTRFVRYY 262          

HSP 2 Score: 102.064 bits (253), Expect = 2.093e-22
Identity = 64/194 (32.99%), Postives = 111/194 (57.22%), Query Frame = 1
Query: 1387 NVKDGLKFRLQICKLIWPHMIAMFLAYFVTLSVFPGVVTDIESRKWKETFPLFVMLVFNISDFIGKICTSIFRKTKGICLFXXXXXXXXXXXXXXXXXXXHNAPVIYGDFWVLFLISILGLSNGYFGCQPMLQAPQIVKDNQKEVSGNLMTTAYSLGLSMG-VLSALQIKYTLIIPNNKPNLTVHSIVNLTFDR 1965
             +KD +  R  + ++IW +M+++ + YF+TL +FPG+ ++I +    E  P+ +M +FN+SDF+GKI  ++  +  G+ L   S  R++ IPL I+C+ P   P +    W      ++G++NGYFG  PM+QA   +   Q+E++GN MT +Y  GL +G V++    ++T       P   +HS   L F +
Sbjct:  337 GIKDMILHRYVVSRVIWTYMLSIAVTYFITLCLFPGLESEIRNATLGEWLPILIMAIFNMSDFVGKILAALPYEWNGMRLLFFSCVRVVFIPLFIMCVFPVPKPTLSHPAWPCIFSLLMGVTNGYFGSVPMIQAAGKLPPEQRELAGNTMTVSYMAGLMLGSVVAYAAYRFT------APGSGLHSETGLNFTQ 524          
BLAST of slc29a-2 vs. Ensembl Cavefish
Match: slc29a2 (equilibrative nucleoside transporter 2 [Source:NCBI gene;Acc:103040210])

HSP 1 Score: 75.0998 bits (183), Expect = 6.406e-14
Identity = 52/174 (29.89%), Postives = 88/174 (50.57%), Query Frame = 1
Query: 1414 LQICKLIWPHMIAMFLAYFVTLSVFPGVVTDIE-----SRKWKETF-PLFVMLVFNISDFIGKICTSIFR-KTKGICLFXXXXXXXXXXXXXXXXX---XXHNAPVIYG-DFWVLFLISILGLSNGYFGCQPMLQAPQIVKDNQKEVSGNLMTTAYSLGLSMGVLSALQIKYTL 1902
            L + K IW   + +   + VTLSVFP +   ++     +  W + F  L   LVFN+ D++G+  TS+ +  +K  CLF   +   ++    ++          PV++  +F  + L+S+  ++NGY  C  M  APQ+V+    E +G LMT   +LGLS+G   +  +K  L
Sbjct:  276 LSVLKKIWVMALCVTCVFMVTLSVFPAITVLVQPAALFTGTWADIFTALCCFLVFNVMDWVGRSVTSVVQFPSKESCLFPIFVVARVIFIPALMLCNIPARTYLPVVFQHEFAYILLMSLFAMTNGYLACLCMSYAPQLVRSKDAETAGALMTFFLALGLSLGAALSFVLKMLL 449          
BLAST of slc29a-2 vs. Ensembl Cavefish
Match: ENSAMXT00000021720.2 (equilibrative nucleoside transporter 2-like [Source:NCBI gene;Acc:103041365])

HSP 1 Score: 66.2402 bits (160), Expect = 4.677e-11
Identity = 65/262 (24.81%), Postives = 115/262 (43.89%), Query Frame = 1
Query: 1159 YAIEEDH--LPQNEPPYLESSD-----DDEIEEAFDNDLESSDVDQSENSFSHLRKSSHTSKAIMINSRSTNQSNSAVINFLSNVKDGLKFRLQICKLIWPHMIAMFLAYFVTLSVFPGVVTDIESR---KWKETF-PLFVMLVFNISDFIGKICTSIF----RKTKGICLFXXXXXXXXXXXXXXXXXXXHNAPVIYGDFWVLFLISIL-GLSNGYFGCQPMLQAPQIVKDNQKEVSGNLMTTAYSLGLSMGVLSALQIKY 1896
            Y I+  H  LP+  P  LE+++     +  + +   +   S DVD    +F            I + +    ++ S+V              L++ K IW     +   + VTLSVFP V  D+++     W+  F P+   LVFN+ D+ G+  TS+     ++++     + S    + + ++         PV +    V  +I IL  +++GY  C  M  APQ+V     E +G LMT   +LGLS+G   +  +++
Sbjct:  229 YEIDTSHQLLPKETP--LETTELNGHANGSVPKGNPSGSASEDVDGGRQAF------------ISLENADAKETKSSV--------------LEVFKKIWVMAFCVTFVFTVTLSVFPAVTVDVKTAYPGNWEPYFIPVCCFLVFNVMDWTGRTVTSLVQWPPKESRLFPALVISRVVFVPLLMLCNVQERRFLPVFFSHDVVFVIIMILFSVTSGYCVCLSMSYAPQLVAPKDGETAGALMTFFLALGLSLGAAISFLLRF 462          
BLAST of slc29a-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004562.1 (pep scaffold:Pmarinus_7.0:GL479516:8724:18051:1 gene:ENSPMAG00000004148.1 transcript:ENSPMAT00000004562.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 81.6481 bits (200), Expect = 1.551e-17
Identity = 45/107 (42.06%), Postives = 66/107 (61.68%), Query Frame = 1
Query:  667 WFHVLSKEASYYWIVVATIITAVGCSIQQSSFYGYSSLLPRRYTQALMIGESLSGVLASAFRISTFMLLD--RTPTVYFFLCVGQMFICLIIFHISV-RSGFVQHHL 978
            WF ++   ASY   +++  + A   ++QQ+S+YG S +LP R+TQA+M GESL+GV+AS  R+ T   +   RT T  FF  V  M +  ++ H+ V RS FV HHL
Sbjct:   18 WFGLIPHHASYQLHLLSVAVVAFASTVQQASYYGLSGMLPPRHTQAVMTGESLAGVVASTTRVVTRATVGDVRTNTGIFFAAVAAMEVVCLLCHLLVRRSRFVHHHL 124          

HSP 2 Score: 60.077 bits (144), Expect = 2.446e-10
Identity = 21/59 (35.59%), Postives = 43/59 (72.88%), Query Frame = 1
Query: 1411 RLQICKLIWPHMIAMFLAYFVTLSVFPGVVTDIESRKWKETFPLFVMLVFNISDFIGKI 1587
            RL + +L+WP+M A+ + Y ++L+V+PG+++++ S +  E  P+ +M +FN +D +GK+
Sbjct:  198 RLAVSRLLWPYMSAIAITYLISLTVYPGLLSEVRSCELGEWMPIMLMALFNYADLLGKV 256          
BLAST of slc29a-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004558.1 (pep scaffold:Pmarinus_7.0:GL479516:8724:18051:1 gene:ENSPMAG00000004148.1 transcript:ENSPMAT00000004558.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 80.8777 bits (198), Expect = 3.397e-17
Identity = 44/106 (41.51%), Postives = 65/106 (61.32%), Query Frame = 1
Query:  667 WFHVLSKEASYYWIVVATIITAVGCSIQQSSFYGYSSLLPRRYTQALMIGESLSGVLASAFRISTFMLLD--RTPTVYFFLCVGQMFICLIIFHISV-RSGFVQHH 975
            WF ++   ASY   +++  + A   ++QQ+S+YG S +LP R+TQA+M GESL+GV+AS  R+ T   +   RT T  FF  V  M +  ++ H+ V RS FV HH
Sbjct:   18 WFGLIPHHASYQLHLLSVAVVAFASTVQQASYYGLSGMLPPRHTQAVMTGESLAGVVASTTRVVTRATVGDVRTNTGIFFAAVAAMEVVCLLCHLLVRRSRFVHHH 123          

HSP 2 Score: 64.3142 bits (155), Expect = 1.280e-11
Identity = 35/136 (25.74%), Postives = 74/136 (54.41%), Query Frame = 1
Query: 1210 SSDDDEIEEAFDNDLESSDV-------DQSENSFSHLRKSSHTSKAIMINSRSTNQS--NSAVINFLSNVKDG-LKFRLQICKLIWPHMIAMFLAYFVTLSVFPGVVTDIESRKWKETFPLFVMLVFNISDFIGKI 1587
            S DD  + +  ++  E   V        QS+ +   +  ++H  +A + +S    +S  + A  +    ++ G L  RL + +L+WP+M A+ + Y ++L+V+PG+++++ S +  E  P+ +M +FN +D +GK+
Sbjct:  127 SKDDSPVWDGLNHVGEEGGVYVRMDPPMQSDGTLKKMFGNAH--RAALTSSADAQRSAHSLARADRAPLLRGGALGSRLAVSRLLWPYMSAIAITYLISLTVYPGLLSEVRSCELGEWMPIMLMALFNYADLLGKV 260          
BLAST of slc29a-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008545.1 (pep scaffold:Pmarinus_7.0:GL490961:3015:6049:1 gene:ENSPMAG00000007738.1 transcript:ENSPMAT00000008545.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 46.9802 bits (110), Expect = 1.220e-6
Identity = 25/62 (40.32%), Postives = 36/62 (58.06%), Query Frame = 1
Query: 1432 IWPHMIAMFLAYFVTLSVFPGVVTDIESRK----WKETF-PLFVMLVFNISDFIGKICTSIF 1602
            IWP  I + L Y VTL+VFP V   ++S      W+  F P++  L FNI D+ G+  T++F
Sbjct:   11 IWPMAICVCLVYTVTLAVFPAVTAGVQSSSQDPTWRRFFVPVWCFLFFNILDWAGRSATAVF 72          
BLAST of slc29a-2 vs. Ensembl Yeast
Match: FUN26 (High affinity, broad selectivity, nucleoside/nucleobase transporter; vacuolar membrane localized transporter which may regulate the balance of nicotinamide riboside (NmR) levels between the cytosol and vacuole, contributing to salvage of NmR for use in cytosolic NAD+ synthesis; equilibrative nucleoside transporter (ENT) family member [Source:SGD;Acc:S000000020])

HSP 1 Score: 64.3142 bits (155), Expect = 3.198e-11
Identity = 54/221 (24.43%), Postives = 115/221 (52.04%), Query Frame = 1
Query:  391 KDPKNLIFFSLILSGVGFLFPYNCLINAADYFQLKYCNNHLIYSISVAYVLAAVTTVS--LNNLIV--QSVHFIRRIIFGYXXXXXXXXXXXXXXXWFHVLSKEASYYWIVVATIITAVGCSIQQSSFYGYSSLLPRRYTQALMIGESLSGVLAS------AFRISTFMLLDRTPTVYFFLCVGQMFICLIIFHISVRSGFVQHHLHRHQHNVLNVNSNSL 1023
            K  KNL + +    G+G L+P+NC+++A+ YF+     +  I++      + + +T+S  L N+ +  +   + RR+I G V  I V  ++    I   +L K  ++ +I++  +I+++G ++ Q+     +++    Y+Q +M+G++++GVL S      AF  ++ +       +YFF     + IC+++F +S  S  V  + +    ++ +V   SL
Sbjct:   71 KKLKNLSYITFFAIGIGLLWPWNCILSASQYFKHDIFKDTSIWAKIFTSSMMSFSTISSMLFNIYLAKRQYKYSRRVINGLVWEIIVFTVMCFFTILHFLLPKWFNFMFIMMLVVISSMGTAMTQNGIMAIANVFGSEYSQGVMVGQAVAGVLPSLVLFALAFIENSSVSTTGGILLYFFTTTLVVTICVVMFSVSKISRKVNENWNVEDGHITDVLLGSL 291          
BLAST of slc29a-2 vs. Ensembl Nematostella
Match: EDO37568 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFF0])

HSP 1 Score: 68.5514 bits (166), Expect = 3.705e-12
Identity = 65/238 (27.31%), Postives = 115/238 (48.32%), Query Frame = 1
Query:  346 QNRASLIVHMVTNSPKDPKNLIFFSLILSGVGFLFPYNCLINAADYFQLKYCN-NHLIYS----ISVAYVLAAVTTVSLNNLIVQSVHFIRRIIFGYXXXXXXXXXXXXXXXWFHVLSKEASYYWIVVAT-IITAVGCSIQQSSFYGYSSLLPRRYTQALMIGESLSGVLASAFRI--STFMLLDRTPTV---YFFLCVGQMFICLIIFHISVRSGFVQH---HLHRHQHNVLNVNSN 1017
            +++A+L+V +    PKD   L+++ ++L G+G L P+N  I A  YF  K  N    ++S     SVA ++  V    LN L    V    R++   VL   + +L T+++      S    ++++ +AT II  +  ++ Q   +G S ++P +YT A+M G+ + G  A+   I  +     D   TV   YF   V  +F+C+I + +     F +H   H  R Q +  ++  N
Sbjct:   22 KSKATLLVSL---EPKDRFKLVYWIMLLQGIGTLLPWNMFITAHMYFTSKLKNEKEFVHSFENYFSVAAMVPNVIMFFLNTLFKHKVKLQTRMVTSLVLMTLLFVLTTVLVK-IKTTSWTREFFYLTIATVIIVNMATAVYQGGLFGLSGMMPAKYTGAVMTGQGIGGTFAALASIIFTAIWGQDDPITVGFGYFLSAVVMLFLCIITYILLPSLNFARHFMGHSSRDQVDFPHMQHN 255          

HSP 2 Score: 58.5362 bits (140), Expect = 5.244e-9
Identity = 46/163 (28.22%), Postives = 80/163 (49.08%), Query Frame = 1
Query: 1420 ICKLIWPHMIAMFLAYFVTLSVFPGVVTDIESR------KWKETF--PLFVMLVFNISDFIGKICTSI--FRKTKGICL-FXXXXXXXXXXXXXXXXXXXHNAPVIYGD--FWVLFLISILGLSNGYFGCQPMLQAPQIVKDNQKEVSGNLMTTAYSLGLSMG 1869
            I K I P  +++   +FVTL+ FP +   ++S       +W   +  P+   L+FN+ DF G++  S+  F +   I L   C +  I L         P   PV + D  +++ F+ ++ GL+NGY G   M+  P +V+    E +G +M     +GL++G
Sbjct:  313 IFKKIAPVGLSVAFVFFVTLAAFPSLTAKVKSNYTGDNTQWTSVYFTPVTCFLLFNVGDFSGRLLASLAQFPRRGSILLPIFCFVRVIFLPLFFFCNAQPRTTPVFFADDGYYIAFM-ALFGLTNGYLGSLCMMYGPGLVEPKHAETAGTMMAFLLIIGLALG 474          
BLAST of slc29a-2 vs. Ensembl Nematostella
Match: EDO44871 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUK9])

HSP 1 Score: 48.521 bits (114), Expect = 8.498e-6
Identity = 34/113 (30.09%), Postives = 53/113 (46.90%), Query Frame = 1
Query:  694 SYYWIVVATIITAVGCSIQQSSFYGYSSLLPRRYTQALMIGESLSGVLASAFRI--STFMLLDRTPTV---YFFLCVGQMFICLIIFHISVRSGFVQH---HLHRHQHNVLNV 1008
            S Y + + T+ TAV     Q   +G S ++P +YT A+M G+ + G  A+   I  +     D   TV   YF   V  +F+C+I + +     F +H   H  R Q +  NV
Sbjct:  141 STYLLAMRTVATAV----YQGGLFGLSGMMPAKYTGAVMTGQGIGGTFAALASIIFTAIWGQDDPITVGFGYFLSAVVMLFLCIITYILLPSLNFARHFMGHSSRDQVDCQNV 249          
BLAST of slc29a-2 vs. Ensembl Medaka
Match: slc29a4 (solute carrier family 29 member 4 [Source:NCBI gene;Acc:101167872])

HSP 1 Score: 196.052 bits (497), Expect = 4.878e-54
Identity = 141/497 (28.37%), Postives = 241/497 (48.49%), Query Frame = 1
Query:  388 PKDPKNLIFFSLILSGVGFLFPYNCLINAADYFQLKYCNNHLIYSISVAYVLAAVTTVSLNNLIVQSVHFIRRIIFGYXXXXXXXXXXXXXXXWFHVLSKEASYYWIVVATIITAVGCSIQQSSFYGYSSLLPRRYTQALMIGESLSGVLASAFRISTFMLL--DRTPTVYFFLC-VGQMFICLIIFHISVRSGFVQHHLHRHQHNVLNVNSNSLIKSTHSLSYQINTPXXXXXXXXXXXXXXXXXXWTKTVSMEINNPAYAIEEDHLPQNEPPYLESSDDDEIEEAFDNDLESSDVDQSENSFSHLRKSSHTSKAIMINSRSTNQSNSAVINFLSNVKDGLKFRLQICKLIWPHMIAMFLAYFVTLSVFPGVVTDIESRKWKETFPLFVMLVFNISDFIGKICTSIFRKTKGICLFXXXXXXXXXXXXXXXXXXXHNAPVIYGDFWVLFLISILGLSNGYFGCQPMLQAPQIVKDNQKEVSGNLMTTAYSLGLSMG 1869
            P D  + I+F+++L+GVGFL PYN  I   DY   K+    +++ +S+ Y++ A+  V LNN++V+ +    RI  GY+LA+  ++ +++  +W    + + +Y   +++  + A GC++QQSSFYGY  +LP+RYTQ +M GES +GV+ S  RI T +L+  D+  T+ FFL  +    +C           F+ H + R    V    S+S  K                                K      N   Y +  D               DE+   F N +  +    +E         ++    +  ++       S        V+D +  R  + ++IW +M+++ + Y +TL +FPG+ ++I++    E  P+ +M  FN+SDF+GKI  ++     G  L   S  R++ IPL ++C+ P +AP +    W      ++G++NGYFG  PM+QA   V   Q+E++GN MT +Y  GL +G
Sbjct:  137 PDDRYHGIYFAMLLAGVGFLLPYNSFITDVDYLHQKFKGTSIVFDMSLTYIVVALLAVILNNVLVERLSMHTRITVGYLLALGPLIFVSVFDVWLERFTIKQAYVMNLLSVGVVAFGCTVQQSSFYGYMGMLPKRYTQGVMTGESTAGVIISLSRIFTKLLISDDKKNTLIFFLVSISMELLC-----------FLLHLVVRRSRFVRYYTSHSQGKGLE-----------------------------KCPDPRDNGTGYRVHHD------------VTADEVR--FGNGVTGTGPSSTEEGLEDFVGGTY----VRFDAPKAKMRRS-----WPGVRDMILHRYVVSRVIWAYMLSIAVTYSITLCLFPGLESEIKNPTLGEWLPILIMATFNMSDFVGKILAALPYDWSGGRLLFFSCLRVVFIPLFVMCVYPASAPTLSHPAWPCLFSLLMGVTNGYFGSVPMIQAAGKVPPEQRELAGNTMTVSYMTGLMVG 570          
BLAST of slc29a-2 vs. Ensembl Medaka
Match: SLC29A2 (solute carrier family 29 member 2 [Source:NCBI gene;Acc:101158235])

HSP 1 Score: 67.781 bits (164), Expect = 1.452e-11
Identity = 51/162 (31.48%), Postives = 78/162 (48.15%), Query Frame = 1
Query: 1414 LQICKLIWPHMIAMFLAYFVTLSVFPGVVTDIESR---KWKETFP-LFVMLVFNISDFIGKICTSIFR----KTKGICLFXXXXXXXXXXXXXXXXXXXHNAPVIYGDFWVLFLISIL-GLSNGYFGCQPMLQAPQIVKDNQKEVSGNLMTTAYSLGLSMGV 1872
            L++ K IW     +   + VTLSVFP V  D+ +    KW+  F  +   L FNI D++G+  TS+FR    +++     + S    + + ++      H  P  +       +I IL  LS+GY  C  M   PQ+V     E +G LMT   +LGLS+G 
Sbjct:  303 LEVFKKIWVMAFCVTFVFSVTLSVFPAVTVDVRTTFPGKWELYFASVCCFLTFNIGDWLGRTATSMFRWPRKESRLFPALVVSRVAFVPLLMLCNVQPRHYLPAFFTHDAAFIIIMILFSLSSGYLVCLSMSYGPQMVDPKDAETAGALMTFFLALGLSIGA 464          
BLAST of slc29a-2 vs. Ensembl Medaka
Match: SLC29A2 (solute carrier family 29 member 2 [Source:NCBI gene;Acc:101158235])

HSP 1 Score: 67.781 bits (164), Expect = 1.579e-11
Identity = 65/230 (28.26%), Postives = 104/230 (45.22%), Query Frame = 1
Query: 1210 SSDDDEIEEAFDNDLESSDVDQSENSFSHLRKSSHTSKAIMINSRSTNQSNSAVINFLSNVKDGLKFRLQICKLIWPHMIAMFLAYFVTLSVFPGVVTDIESR---KWKETFP-LFVMLVFNISDFIGKICTSIFR----KTKGICLFXXXXXXXXXXXXXXXXXXXHNAPVIYGDFWVLFLISIL-GLSNGYFGCQPMLQAPQIVKDNQKEVSGNLMTTAYSLGLSMGV 1872
            SS++ E  +    D  +S ++   N    L  +S T   +   S +T Q+  A+       K  +   L++ K IW     +   + VTLSVFP V  D+ +    KW+  F  +   L FNI D++G+  TS+FR    +++     + S    + + ++      H  P  +       +I IL  LS+GY  C  M   PQ+V     E +G LMT   +LGLS+G 
Sbjct:  222 SSEETETRDELLQD--NSKMNGHANG--SLTAASKTEAELDCRSDATTQA--ALPQQAVQAKASV---LEVFKKIWVMAFCVTFVFSVTLSVFPAVTVDVRTTFPGKWELYFASVCCFLTFNIGDWLGRTATSMFRWPRKESRLFPALVVSRVAFVPLLMLCNVQPRHYLPAFFTHDAAFIIIMILFSLSSGYLVCLSMSYGPQMVDPKDAETAGALMTFFLALGLSIGA 442          
BLAST of slc29a-2 vs. Ensembl Medaka
Match: slc29a1a (solute carrier family 29 member 1 (Augustine blood group) [Source:NCBI gene;Acc:101163194])

HSP 1 Score: 59.3066 bits (142), Expect = 7.570e-9
Identity = 56/235 (23.83%), Postives = 98/235 (41.70%), Query Frame = 1
Query: 1234 EAFDNDLESSDVDQS---ENSFSHLRKSSHTSKAIMIN-SRSTNQSNSAVINFLSNVKDGLKFRLQICKLIWPHMIAMFLAYFVTLSVFPGVVTDIESR-----KWKETF-PLFVMLVFNISDFIGK----ICTSIFRKTKGICLFXXXXXXXXXXXXXXXXXXXHNAPVIYG-DFWVLFLISILGLSNGYFGCQPMLQAPQIVKDNQKEVSGNLMTTAYSLGLSMGVLSALQIK 1893
            E F   +ES+    S   EN    L+K +   K  ++N       S S+V N              I K IW   +++   + VT+ +FP V  D++S      +W   F P+   L+FN+ D+ G+    +C    + +  +   +        + ++      H  PV +  D W +  + +   SNGY     M   P+ V  +Q E +G +M    SLGL++G   +  ++
Sbjct:  225 EFFQYHMESNGSSPSADEENKMDLLKKQNSPEKRPVVNLDEDETPSGSSVFN--------------IFKQIWVTALSVCFIFTVTIGMFPAVTADVKSAIAGKGEWNTYFIPVACFLLFNLMDWAGRSLTALCMWPGKDSMWLPALVGLRIIFFPLFMLCNVQPRHYLPVPFEHDAWYIIFMILFSFSNGYLASLCMCYGPKKVPSHQAETAGAIMAFFLSLGLALGAAISFALR 445          
BLAST of slc29a-2 vs. Ensembl Medaka
Match: slc29a3 (solute carrier family 29 member 3 [Source:NCBI gene;Acc:101163435])

HSP 1 Score: 50.0618 bits (118), Expect = 5.609e-6
Identity = 53/213 (24.88%), Postives = 96/213 (45.07%), Query Frame = 1
Query:  352 RASLIVHMVTNSPKDPKNLIFFSLILSGVGFLFPYNCLINAADYFQLKYCN---------------NHLIYSISVAYVLAAVTTVSLNNLIVQSVHFIRRIIFGYXXXXXXXXXXXXXXXWFHVLSKEASYYWIVVATIITAVGCS-IQQSSFYGYSSLLPRRYTQALMIGESLSGVLASAFRISTFMLL-DRTPTVYFFLCVGQMFICLIIF 939
            + SL   +V  +P+D  NL++    L G+G L P+N  I A  Y+  K  N               ++    +S+A  + +V  + LN ++V  +    R++    + + V ++ T ++    V +    ++   + ++    G S I   S +G S   P R TQAL+ G+++ G L+S   I     + D T +  F+     +FI L IF
Sbjct:   51 KPSLSPLVVRFTPEDSYNLVYVLFFLMGIGSLLPWNFFITAKHYWIYKLSNSSDLGKEGERRSDISDYFESYLSIASTVPSVLCLILNYMLVNRLSPRLRVLSSLWVILLVFVVTTALVK-VDVSNGRTDFFIGTLVSVAVVSGASNIFSGSMFGISGYFPMRITQALVSGQAMGGTLSSLASIVNLAAVEDVTDSALFYFLTADVFILLCIF 262          
BLAST of slc29a-2 vs. Planmine SMEST
Match: SMESG000078543.1 (SMESG000078543.1)

HSP 1 Score: 1051.58 bits (2718), Expect = 0.000e+0
Identity = 610/612 (99.67%), Postives = 610/612 (99.67%), Query Frame = 1
Query:  133 MEYVSLDQTDINDQXXXXXXXXXXXXMPEKSTVISNLNFEXXXXXXXXXXXXXXXXXXXFRRELYKKQVNCQNRASLIVHMVTNSPKDPKNLIFFSLILSGVGFLFPYNCLINAADYFQLKYCNNHLIYSISVAYVLAAVTTVSLNNLIVQSVHFIRRIIFGYXXXXXXXXXXXXXXXWFHVLSKEASYYWIVVATIITAVGCSIQQSSFYGYSSLLPRRYTQALMIGESLSGVLASAFRISTFMLLDRTPTVYFFLCVGQMFICLIIFHISVRSGFVQHHLHRHQHNVLNVNSNSLIKSTHSLSYQINTPXXXXXXXXXXXXXXXXXXWTKTVSMEINNPAYAIEEDHLPQNEPPYLESSDDDEIEEAFDNDLESSDVDQSENSFSHLRKSSHTSKAIMINSRSTNQSNSAVINFLSNVKDGLKFRLQICKLIWPHMIAMFLAYFVTLSVFPGVVTDIESRKWKETFPLFVMLVFNISDFIGKICTSIFRKTKGICLFXXXXXXXXXXXXXXXXXXXHNAPVIYGDFWVLFLISILGLSNGYFGCQPMLQAPQIVKDNQKEVSGNLMTTAYSLGLSMGVLSALQIKYTLIIPNNKPNLTVHSIVNLTFDRC 1968
            MEYVSLDQTDINDQNSNNCSSSNISNMPEKSTVISNLNFENIKSHIKNKAKKGKKKISKFRRELYKKQVNCQNRASLIVHMVTNSPKDPKNLIFFSLILSGVGFLFPYNCLINAADYFQLKYCNNHLIYSISVAYVLAAVTTVSLNNLIVQSVHFIRRIIFGYVLAITVMLLLTIVIIWFHVLSKEASYYWIVVATIITAVGCSIQQSSFYGYSSLLPRRYTQALMIGESLSGVLASAFRISTFMLLDRTPTVYFFLCVGQMFICLIIFHISVRSGFVQHHLHRHQHNVLNVNSNSLIKSTHSLSYQINTPNSNS NNNIHSNVSIHNNWTKTVSMEINNPAYAIEEDHLPQNEPPYLESSDDDEIEEAFDNDLESSDVDQSENSFSHLRKSS TSKAIMINSRSTNQSNSAVINFLSNVKDGLKFRLQICKLIWPHMIAMFLAYFVTLSVFPGVVTDIESRKWKETFPLFVMLVFNISDFIGKICTSIFRKTKGICLFICSLSRILLIPLIIICIIPHNAPVIYGDFWVLFLISILGLSNGYFGCQPMLQAPQIVKDNQKEVSGNLMTTAYSLGLSMGVLSALQIKYTLIIPNNKPNLTVHSIVNLTFDRC
Sbjct:    1 MEYVSLDQTDINDQNSNNCSSSNISNMPEKSTVISNLNFENIKSHIKNKAKKGKKKISKFRRELYKKQVNCQNRASLIVHMVTNSPKDPKNLIFFSLILSGVGFLFPYNCLINAADYFQLKYCNNHLIYSISVAYVLAAVTTVSLNNLIVQSVHFIRRIIFGYVLAITVMLLLTIVIIWFHVLSKEASYYWIVVATIITAVGCSIQQSSFYGYSSLLPRRYTQALMIGESLSGVLASAFRISTFMLLDRTPTVYFFLCVGQMFICLIIFHISVRSGFVQHHLHRHQHNVLNVNSNSLIKSTHSLSYQINTPNSNSSNNNIHSNVSIHNNWTKTVSMEINNPAYAIEEDHLPQNEPPYLESSDDDEIEEAFDNDLESSDVDQSENSFSHLRKSSQTSKAIMINSRSTNQSNSAVINFLSNVKDGLKFRLQICKLIWPHMIAMFLAYFVTLSVFPGVVTDIESRKWKETFPLFVMLVFNISDFIGKICTSIFRKTKGICLFICSLSRILLIPLIIICIIPHNAPVIYGDFWVLFLISILGLSNGYFGCQPMLQAPQIVKDNQKEVSGNLMTTAYSLGLSMGVLSALQIKYTLIIPNNKPNLTVHSIVNLTFDRC 612          
BLAST of slc29a-2 vs. Planmine SMEST
Match: SMESG000056169.1 (SMESG000056169.1)

HSP 1 Score: 65.855 bits (159), Expect = 4.013e-11
Identity = 54/174 (31.03%), Postives = 81/174 (46.55%), Query Frame = 1
Query: 1420 ICKLIWPHMIAMFLAYFVTLSVFPG----VVTDIESRKWKETF-PLFVMLVFNISDFIGKICTSIFR-----KTKGICLFXXXXXXXXXXXXXXXXXXXHNAPVI-YGDFWVLFLISILGLSNGYFGCQPMLQAPQIVKDNQKEVSGNLMTTAYSLGLSMGVLSALQIKYTLII 1908
            + K I+   + + L + VTLS+FP     +VT   +  WK+ F P+   L FNI+D+IG+    I +       K +          + +  +       N P+I Y D + +    +LGL+NGYF    ++ AP  V D +KE  G LM      GL+ GV  AL   Y  II
Sbjct:  269 LVKQIYWFGLTVTLEFVVTLSLFPAFSSQIVTQSNNENWKKFFTPVTCFLFFNIADYIGRYFCGILKFPSQNYPKTLFFIALIRFIFVPLIFMCNIPTRTNFPIIFYNDAYPIVFTILLGLTNGYFITLSLIYAPSQVSDKEKEAVGTLMNLFLCFGLAFGV--ALSFVYLYII 440          

HSP 2 Score: 49.2914 bits (116), Expect = 7.200e-6
Identity = 49/187 (26.20%), Postives = 90/187 (48.13%), Query Frame = 1
Query:  391 KDPKNLIFFSLILSGVGFLFPYNCLINAADYFQLKYCN------NHLIYS----ISVAYVLAAVTTVSLNNLIVQSVHFIRRIIFGYXXXXXXXXXXXXXXXWFHVLSKEASYYWIVVATIITAVGCS-IQQSSFYGYSSLLPRRYTQALMIGESLSGVLASAFRISTFMLL---DRTPTVYFFLCV 909
            KD  +L++F +  +G+G L P+N  I A  YF  K  +      + L Y     +S+A ++ A     LN ++ + +  +RR   G  L   V L+  I+    +      S++ I + +++    CS I Q S  G  S++P RY +  M G+++ G++AS   I   + +   D +  +YF + +
Sbjct:   19 KDKYHLVYFIVFFTGIGVLIPWNFFITAKQYFVFKLTDTGNSTASDLPYKFENYLSIASMVPAAIINILNLVLRRYITPMRRFSVGISLMFLVFLVTLILTK-VNTQKDIMSFFIITMISVVILNTCSGIMQGSSLGVISMMPGRYIKGYMEGQAIGGLIASVANILAIVAVSSPDSSAFIYFLVAL 204          
The following BLAST results are available for this feature:
BLAST of slc29a-2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC29A46.510e-5630.18solute carrier family 29 member 4 [Source:HGNC Sym... [more]
SLC29A46.510e-5630.18solute carrier family 29 member 4 [Source:HGNC Sym... [more]
SLC29A41.523e-4528.37solute carrier family 29 member 4 [Source:HGNC Sym... [more]
SLC29A43.192e-1436.63solute carrier family 29 member 4 [Source:HGNC Sym... [more]
SLC29A43.689e-1239.19solute carrier family 29 member 4 [Source:HGNC Sym... [more]
back to top
BLAST of slc29a-2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ent-15.250e-927.39Equilibrative Nucleoside Transporter; Equilibrativ... [more]
ent-72.196e-824.41Equilibrative Nucleoside Transporter [Source:UniP... [more]
ent-72.931e-824.41Equilibrative Nucleoside Transporter [Source:UniP... [more]
ent-72.931e-824.41Equilibrative Nucleoside Transporter [Source:UniP... [more]
ent-72.931e-824.41Equilibrative Nucleoside Transporter [Source:UniP... [more]
back to top
BLAST of slc29a-2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ent34.731e-6330.18gene:FBgn0036319 transcript:FBtr0075935[more]
Ent34.731e-6330.18gene:FBgn0036319 transcript:FBtr0345343[more]
Ent36.622e-6329.32gene:FBgn0036319 transcript:FBtr0332049[more]
Ent16.707e-926.51gene:FBgn0031250 transcript:FBtr0078094[more]
Ent16.707e-926.51gene:FBgn0031250 transcript:FBtr0078095[more]
back to top
BLAST of slc29a-2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-160d14.63.827e-6531.86si:ch211-160d14.6 [Source:ZFIN;Acc:ZDB-GENE-121214... [more]
si:ch211-160d14.64.232e-6531.86si:ch211-160d14.6 [Source:ZFIN;Acc:ZDB-GENE-121214... [more]
SLC29A45.449e-6531.46si:ch211-160d14.6 [Source:ZFIN;Acc:ZDB-GENE-121214... [more]
si:ch211-160d14.63.300e-3635.92si:ch211-160d14.6 [Source:ZFIN;Acc:ZDB-GENE-121214... [more]
slc29a47.735e-3334.36Danio rerio solute carrier family 29 member 4 (slc... [more]
back to top
BLAST of slc29a-2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
slc29a22.692e-1028.14solute carrier family 29 (equilibrative nucleoside... [more]
slc29a22.730e-1028.31solute carrier family 29 (equilibrative nucleoside... [more]
slc29a22.887e-1028.31solute carrier family 29 (equilibrative nucleoside... [more]
back to top
BLAST of slc29a-2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Slc29a43.927e-3442.53solute carrier family 29 (nucleoside transporters)... [more]
Slc29a25.337e-829.11solute carrier family 29 (nucleoside transporters)... [more]
Slc29a28.808e-829.11solute carrier family 29 (nucleoside transporters)... [more]
Slc29a46.068e-640.91solute carrier family 29 (nucleoside transporters)... [more]
back to top
BLAST of slc29a-2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q7RTT9|S29A4_HUMAN3.126e-5530.18Equilibrative nucleoside transporter 4 OS=Homo sap... [more]
sp|Q8R139|S29A4_MOUSE2.747e-3342.53Equilibrative nucleoside transporter 4 OS=Mus musc... [more]
sp|A1L272|S29A4_DANRE6.716e-3234.36Equilibrative nucleoside transporter 4 OS=Danio re... [more]
sp|Q84XI3|ENT8_ARATH1.028e-1026.85Equilibrative nucleotide transporter 8 OS=Arabidop... [more]
sp|P31381|FUN26_YEAST2.221e-924.43Nucleoside transporter FUN26 OS=Saccharomyces cere... [more]
back to top
BLAST of slc29a-2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YF770.000e+0100.00Slc29a-2 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A2T7PD424.679e-7833.98Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A4Y2HGQ43.586e-7333.64Equilibrative nucleoside transporter 4 OS=Araneus ... [more]
A0A553NTC21.623e-7236.24Uncharacterized protein OS=Tigriopus californicus ... [more]
R7V9M49.339e-7232.16Uncharacterized protein OS=Capitella teleta OX=283... [more]
back to top
BLAST of slc29a-2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-160d14.61.019e-4429.88pep primary_assembly:Astyanax_mexicanus-2.0:12:226... [more]
slc29a43.620e-2835.18solute carrier family 29 member 4 [Source:NCBI gen... [more]
slc29a45.205e-2534.65solute carrier family 29 member 4 [Source:NCBI gen... [more]
slc29a26.406e-1429.89equilibrative nucleoside transporter 2 [Source:NCB... [more]
ENSAMXT00000021720.24.677e-1124.81equilibrative nucleoside transporter 2-like [Sourc... [more]
back to top
BLAST of slc29a-2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000004562.11.551e-1742.06pep scaffold:Pmarinus_7.0:GL479516:8724:18051:1 ge... [more]
ENSPMAT00000004558.13.397e-1741.51pep scaffold:Pmarinus_7.0:GL479516:8724:18051:1 ge... [more]
ENSPMAT00000008545.11.220e-640.32pep scaffold:Pmarinus_7.0:GL490961:3015:6049:1 gen... [more]
back to top
BLAST of slc29a-2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
FUN263.198e-1124.43High affinity, broad selectivity, nucleoside/nucle... [more]
back to top
BLAST of slc29a-2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO375683.705e-1227.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO448718.498e-630.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc29a-2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc29a44.878e-5428.37solute carrier family 29 member 4 [Source:NCBI gen... [more]
SLC29A21.452e-1131.48solute carrier family 29 member 2 [Source:NCBI gen... [more]
SLC29A21.579e-1128.26solute carrier family 29 member 2 [Source:NCBI gen... [more]
slc29a1a7.570e-923.83solute carrier family 29 member 1 (Augustine blood... [more]
slc29a35.609e-624.88solute carrier family 29 member 3 [Source:NCBI gen... [more]
back to top
BLAST of slc29a-2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000078543.10.000e+099.67SMESG000078543.1[more]
SMESG000056169.14.013e-1131.03SMESG000056169.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30011936
GenBankAKN21620.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011936 ID=SMED30011936|Name=slc29a-2|organism=Schmidtea mediterranea sexual|type=transcript|length=2006bp
AATTGAGTATGTAATGAAATAAGCAGAAGCAAAATGAGAGAAAATGAAAT
AATTTTAGATTAACGATTCTATTGTTGACAAACTAATCATTTGAAGAAAC
TGATGTAACTTATCTATTAAATTGCTAAAAATATGGAATATGTCTCTCTT
GATCAAACGGATATTAATGATCAGAATTCTAATAATTGTTCTTCGTCCAA
TATATCAAATATGCCTGAAAAGAGTACTGTAATATCAAATTTGAATTTTG
AAAACATCAAATCTCACATAAAAAATAAAGCGAAGAAAGGCAAGAAAAAG
ATTTCTAAATTTCGAAGGGAACTATACAAAAAACAGGTCAATTGTCAAAA
CAGAGCTTCCCTTATTGTACACATGGTCACTAACAGTCCAAAAGATCCTA
AAAATTTAATATTTTTCAGTTTAATATTGTCTGGAGTTGGATTTCTTTTT
CCGTATAATTGTTTGATAAACGCTGCTGATTATTTCCAACTGAAATACTG
TAACAACCATCTCATTTATTCAATAAGTGTTGCATACGTCTTAGCCGCAG
TTACGACAGTGTCGCTAAACAATTTAATCGTGCAATCTGTACACTTTATT
CGACGCATAATTTTCGGATATGTCTTGGCCATAACTGTTATGCTCCTTCT
CACAATTGTTATCATCTGGTTTCATGTTCTGTCAAAGGAAGCTTCATATT
ACTGGATTGTAGTAGCCACCATAATCACAGCCGTTGGCTGTTCAATTCAA
CAATCCAGTTTCTATGGCTACAGCAGTCTTCTTCCTCGCAGATATACTCA
GGCTCTGATGATCGGTGAAAGCTTATCTGGAGTATTGGCATCAGCTTTCC
GAATCAGTACTTTTATGTTGTTGGATCGCACTCCAACGGTTTATTTTTTC
CTATGTGTTGGCCAAATGTTTATCTGCCTCATCATTTTCCACATTTCTGT
ACGCAGTGGGTTTGTTCAGCATCATTTACATCGTCATCAACACAATGTTC
TGAACGTCAACTCGAATTCACTGATCAAATCAACTCATTCTCTGTCCTAT
CAGATCAACACTCCGAATTCCAACTCATTCAATAACAATATTCACAGCAA
CGTATCTATTCATAATAATTGGACAAAAACGGTTTCCATGGAAATCAATA
ATCCAGCCTATGCCATAGAAGAAGATCATTTGCCACAAAACGAACCTCCA
TATTTAGAGTCGTCAGATGATGATGAAATTGAAGAAGCTTTCGACAATGA
TTTAGAATCCTCTGATGTTGACCAATCAGAAAATAGTTTCTCCCATTTGA
GAAAATCCTCACACACCTCTAAGGCTATCATGATCAACAGTCGATCAACA
AATCAATCAAATAGTGCTGTGATCAATTTTCTATCAAATGTGAAAGATGG
ATTGAAATTCAGGTTGCAAATATGCAAATTAATATGGCCTCACATGATAG
CCATGTTCCTTGCCTATTTTGTAACATTATCAGTATTTCCAGGAGTTGTT
ACAGATATTGAAAGCAGAAAATGGAAAGAGACATTTCCACTTTTCGTGAT
GCTTGTATTCAACATTTCTGATTTTATCGGAAAGATCTGTACCTCAATTT
TCAGAAAGACGAAAGGAATTTGCTTGTTTATTTGTTCTCTTTCAAGAATT
CTTTTGATTCCACTGATCATTATTTGCATTATTCCCCACAATGCTCCTGT
CATTTATGGAGACTTCTGGGTTTTATTTTTAATATCAATTCTTGGACTGT
CAAATGGATATTTTGGCTGTCAACCAATGCTACAGGCTCCTCAGATAGTG
AAAGACAATCAGAAAGAGGTTTCGGGGAATCTAATGACGACAGCTTATAG
TCTTGGTCTGAGCATGGGGGTGCTGTCAGCATTACAAATAAAATACACAT
TAATCATTCCTAATAACAAACCTAATCTTACTGTACATTCGATTGTCAAT
CTTACATTTGATCGTTGTTGACAAAATTGTTTATTTTATACATGTTTTTG
TTTTTG
back to top

protein sequence of SMED30011936-orf-1

>SMED30011936-orf-1 ID=SMED30011936-orf-1|Name=SMED30011936-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=613bp
MEYVSLDQTDINDQNSNNCSSSNISNMPEKSTVISNLNFENIKSHIKNKA
KKGKKKISKFRRELYKKQVNCQNRASLIVHMVTNSPKDPKNLIFFSLILS
GVGFLFPYNCLINAADYFQLKYCNNHLIYSISVAYVLAAVTTVSLNNLIV
QSVHFIRRIIFGYVLAITVMLLLTIVIIWFHVLSKEASYYWIVVATIITA
VGCSIQQSSFYGYSSLLPRRYTQALMIGESLSGVLASAFRISTFMLLDRT
PTVYFFLCVGQMFICLIIFHISVRSGFVQHHLHRHQHNVLNVNSNSLIKS
THSLSYQINTPNSNSFNNNIHSNVSIHNNWTKTVSMEINNPAYAIEEDHL
PQNEPPYLESSDDDEIEEAFDNDLESSDVDQSENSFSHLRKSSHTSKAIM
INSRSTNQSNSAVINFLSNVKDGLKFRLQICKLIWPHMIAMFLAYFVTLS
VFPGVVTDIESRKWKETFPLFVMLVFNISDFIGKICTSIFRKTKGICLFI
CSLSRILLIPLIIICIIPHNAPVIYGDFWVLFLISILGLSNGYFGCQPML
QAPQIVKDNQKEVSGNLMTTAYSLGLSMGVLSALQIKYTLIIPNNKPNLT
VHSIVNLTFDRC*
back to top
Aliases
The feature 'slc29a-2' has the following synonyms
Synonym
slc29a-2
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000017photoreceptor neuron
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR030198ENT4
IPR036259MFS_trans_sf
IPR002259Eqnu_transpt
IPR020846MFS_dom
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0006810transport
GO:0015844monoamine transport
GO:0055085transmembrane transport
GO:1901642nucleoside transmembrane transport
Vocabulary: molecular function
TermDefinition
GO:0005337nucleoside transmembrane transporter activity
GO:0008504monoamine transmembrane transporter activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002259Equilibrative nucleoside transporterPFAMPF01733Nucleoside_trancoord: 196..319
e-value: 8.7E-14
score: 51.6
coord: 399..587
e-value: 7.0E-28
score: 97.9
IPR002259Equilibrative nucleoside transporterPANTHERPTHR10332EQUILIBRATIVE NUCLEOSIDE TRANSPORTERcoord: 75..590
IPR030198Equilibrative nucleoside transporter 4PANTHERPTHR10332:SF4EQUILIBRATIVE NUCLEOSIDE TRANSPORTER 4coord: 75..590
IPR036259MFS transporter superfamilySUPERFAMILYSSF103473MFS general substrate transportercoord: 88..584
NoneNo IPR availableTMHMMTMhelixcoord: 496..518
NoneNo IPR availableTMHMMTMhelixcoord: 251..273
NoneNo IPR availableTMHMMTMhelixcoord: 191..213
NoneNo IPR availableTMHMMTMhelixcoord: 159..181
NoneNo IPR availableTMHMMTMhelixcoord: 91..113
NoneNo IPR availableTMHMMTMhelixcoord: 433..455
NoneNo IPR availableTMHMMTMhelixcoord: 128..150
NoneNo IPR availableTMHMMTMhelixcoord: 225..247
NoneNo IPR availableTMHMMTMhelixcoord: 523..545
NoneNo IPR availableTMHMMTMhelixcoord: 470..489