Sorting nexin

Overview
NameSorting nexin
Smed IDSMED30011933
Length (bp)1942
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Sorting nexin (SMED30011933) t-SNE clustered cells

Violin plots show distribution of expression levels for Sorting nexin (SMED30011933) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Sorting nexin (SMED30011933) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Sorting nexin (SMED30011933) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011933

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30011933h1SMcG0014306 Contig2071GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30011933h1SMcG0014306 dd_Smed_v4_2732_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30011933h1SMcG0014306 dd_Smed_v4_2732_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30011933h1SMcG0014306 dd_Smed_v4_2732_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Sorting nexin vs. Ensembl Human
Match: SNX18 (sorting nexin 18 [Source:HGNC Symbol;Acc:HGNC:19245])

HSP 1 Score: 234.572 bits (597), Expect = 8.050e-68
Identity = 137/396 (34.60%), Postives = 203/396 (51.26%), Query Frame = 3
Query:  417 SFLKNGGEEFLLGLAKLSTTIEAKVEVLVDNSKETCVWKPLGDS------QF-CTIIAHDKSSKFKGMKTFITYQLQSSYTKDGISRRYKQFDWLHSQLSEKYPCIVIPPLPNKQVVGRYEDNFIEGRRKHLQKWLTHVTSHPVLAYSQTMKHFL---SVKDKDKWTNGKREIEKDYHKSGRFYCAVE-APVDEINWNDYSRRIEKVSTFIDNFEKHSRILQEVYNNFHKRQSGPICKEFQKIGSSIFNLSRSMSLCPDNNSKDISLLHGLQRTGDVYDRIGKLFRKQAQDDGDLVEDNLEAINGVMKEVPALIELAKCAVNTVETSSRKSTECKITLETVEGIDRNVRVITRTVDAELNWLQTEREKQLRSTMVQYLQNQIQLYTNITTILNEAL 1571
            +F+K+GGE F+LG A            + D  K   V  P G         F CTI    K +KFKGMK++I+Y+L  ++T+  + RRYK FDWL+++L+EK+P I +P LP KQ  GR+E++FI  RRK L  W+ H+ SHPVLA     +HFL   S  D+  W  GKR+ EKD      F+  +   P   ++  +   +I+    F    +  +  L    N F ++Q     KE+QK+G S   LS++  L  D  +  + L   +  TGD YD IG+LF +Q + D D V D L    G +   P +I + K A+  V+ S R   E K+ ++  +GI      I+    AE++     R +  +S M  +LQ QI  +  +T  L EAL
Sbjct:  234 TFVKSGGEAFVLGEAS---------GFVKDGDKLCVVLGPYGPEWQENPYPFQCTIDDPTKQTKFKGMKSYISYKLVPTHTQVPVHRRYKHFDWLYARLAEKFPVISVPHLPEKQATGRFEEDFISKRRKGLIWWMNHMASHPVLAQCDVFQHFLTCPSSTDEKAWKQGKRKAEKDEMVGANFFLTLSTPPAAALDLQEVESKIDGFKCFTKKMDDSALQLNHTANEFARKQVTGFKKEYQKVGQSFRGLSQAFEL--DQQAFSVGLNQAIAFTGDAYDAIGELFAEQPRQDLDPVMDLLALYQGHLANFPDIIHVQKGALTKVKESRRHVEEGKMEVQKADGIQDRCNTISFATLAEIHHFHQIRVRDFKSQMQHFLQQQIIFFQKVTQKLEEAL 618          
BLAST of Sorting nexin vs. Ensembl Human
Match: SNX33 (sorting nexin 33 [Source:HGNC Symbol;Acc:HGNC:28468])

HSP 1 Score: 222.631 bits (566), Expect = 8.442e-64
Identity = 124/391 (31.71%), Postives = 199/391 (50.90%), Query Frame = 3
Query:  420 FLKNGGEEFLLG----LAKLSTTIEAKVEVLVDNSKETCVWKPLGDSQFCTIIAHDKSSKFKGMKTFITYQLQSSYTKDGISRRYKQFDWLHSQLSEKYPCIVIPPLPNKQVVGRYEDNFIEGRRKHLQKWLTHVTSHPVLAYSQTMKHFLSVKDKDKWTNGKREIEKDYHKSGRFYCAVEAPVDEINWNDYSRRIEKVSTFIDNFEKHSRILQEVYNNFHKRQSGPICKEFQKIGSSIFNLSRSMSLCPDNNSKDISLLHGLQRTGDVYDRIGKLFRKQAQDDGDLVEDNLEAINGVMKEVPALIELAKCAVNTVETSSRKSTECKITLETVEGIDRNVRVITRTVDAELNWLQTEREKQLRSTMVQYLQNQIQLYTNITTILNEALSYF 1580
            F+++G E F+LG    +AK++ T        ++       WK       C++    K +KFKG+K++I+Y+L  ++    + RRYK FDWL+++L  K+  I +P LP KQ  GR+E++FIE R++ L  W+ H+TSHPVL+  +  +HFLS  D  +W  GKR  EKD      F    + P +  +  D   R++    F    +     L  V +   ++  G   KEFQK+GS+   +S S  + P   S+  +L   +  TG  Y+ IG++F +Q ++D   + D L    G++   P +I L K A   V+ S R S E ++  +  +GI R  RV+   + AE+N     RE   +  M  YL+ QI  Y  +   L + L  +
Sbjct:  189 FVRSGVEAFILGDVPMMAKIAETYS------IEMGPRGPQWKANPHPFACSVEDPTKQTKFKGIKSYISYKLTPTHAASPVYRRYKHFDWLYNRLLHKFTVISVPHLPEKQATGRFEEDFIEKRKRRLILWMDHMTSHPVLSQYEGFQHFLSCLDDKQWKMGKRRAEKDEMVGASFLLTFQIPTEHQDLQDVEDRVDTFKAFSKKMDDSVLQLSTVASELVRKHVGGFRKEFQKLGSAFQAISHSFQMDPPFCSE--ALNSAISHTGRTYEAIGEMFAEQPKNDLFQMLDTLSLYQGLLSNFPDIIHLQKGAFAKVKESQRMSDEGRMVQDEADGIRRRCRVVGFALQAEMNHFHQRRELDFKHMMQNYLRQQILFYQRVGQQLEKTLRMY 571          

HSP 2 Score: 53.9138 bits (128), Expect = 7.666e-7
Identity = 22/57 (38.60%), Postives = 36/57 (63.16%), Query Frame = 3
Query:   45 IEAKVIYDFTPEQPSDLHIESGEIIVIIDQDVGNGWWKARNRRGEEGLIPANYVEII 215
            ++ + +YDF  E   ++ I+  E +VI  +   +GW + +N RGE GL PA+YVEI+
Sbjct:    3 LKGRALYDFHSENKEEISIQQDEDLVIFSETSLDGWLQGQNSRGETGLFPASYVEIV 59          
BLAST of Sorting nexin vs. Ensembl Human
Match: SNX18 (sorting nexin 18 [Source:HGNC Symbol;Acc:HGNC:19245])

HSP 1 Score: 198.749 bits (504), Expect = 1.205e-54
Identity = 127/385 (32.99%), Postives = 192/385 (49.87%), Query Frame = 3
Query:  417 SFLKNGGEEFLLGLAKLSTTIEAKVEVLVDNSKETCVWKPLGDS------QF-CTIIAHDKSSKFKGMKTFITYQLQSSYTKDGISRRYKQFDWLHSQLSEKYPCIVIPPLPNKQVVGRYEDNFIEGRRKHLQKWLTHVTSHPVLAYSQTMKHFL---SVKDKDKWTNGKREIEKDYHKSGRFYCAVE-APVDEINWNDYSRRIEKVSTFIDNFEKHSRILQEVYNNFHKRQSGPICKEFQKIGSSIFNLSRSMSLCPDNNSKDISLLHGLQRTGDVYDRIGKLFRKQAQDDGDLVEDNLEAINGVMKEVPALIELAKCAVNTVETSSRKSTECKITLETVEGIDRNV-------RVITRTVDAELNWLQTEREKQLRSTMVQYL 1517
            +F+K+GGE F+LG A            + D  K   V  P G         F CTI    K +KFKGMK++I+Y+L  ++T+  + RRYK FDWL+++L+EK+P I +P LP KQ  GR+E++FI  RRK L  W+ H+ SHPVLA     +HFL   S  D+  W  GKR+ EKD      F+  +   P   ++  +   +I+    F    +  +  L    N F ++Q     KE+QK+G S   LS++  L  D  +  + L   +  TGD YD IG+LF +Q + D D V D L    G +   P +I + K     +E     S  C++   T+  +   V          +R VDA +  L+ + +    S +++YL
Sbjct:  234 TFVKSGGEAFVLGEAS---------GFVKDGDKLCVVLGPYGPEWQENPYPFQCTIDDPTKQTKFKGMKSYISYKLVPTHTQVPVHRRYKHFDWLYARLAEKFPVISVPHLPEKQATGRFEEDFISKRRKGLIWWMNHMASHPVLAQCDVFQHFLTCPSSTDEKAWKQGKRKAEKDEMVGANFFLTLSTPPAAALDLQEVESKIDGFKCFTKKMDDSALQLNHTANEFARKQVTGFKKEYQKVGQSFRGLSQAFEL--DQQAFSVGLNQAIAFTGDAYDAIGELFAEQPRQDLDPVMDLLALYQGHLANFPDIIHVQKGKAWPLEQVIW-SVLCRLKGATLTAVPLWVSESYSTGEEASRDVDAWVFSLECKLDCSTGSFLLEYL 606          
BLAST of Sorting nexin vs. Ensembl Human
Match: SNX18 (sorting nexin 18 [Source:HGNC Symbol;Acc:HGNC:19245])

HSP 1 Score: 197.208 bits (500), Expect = 2.086e-54
Identity = 115/325 (35.38%), Postives = 168/325 (51.69%), Query Frame = 3
Query:  417 SFLKNGGEEFLLGLAKLSTTIEAKVEVLVDNSKETCVWKPLGDS------QF-CTIIAHDKSSKFKGMKTFITYQLQSSYTKDGISRRYKQFDWLHSQLSEKYPCIVIPPLPNKQVVGRYEDNFIEGRRKHLQKWLTHVTSHPVLAYSQTMKHFL---SVKDKDKWTNGKREIEKDYHKSGRFYCAVE-APVDEINWNDYSRRIEKVSTFIDNFEKHSRILQEVYNNFHKRQSGPICKEFQKIGSSIFNLSRSMSLCPDNNSKDISLLHGLQRTGDVYDRIGKLFRKQAQDDGDLVEDNLEAINGVMKEVPALIELAKCAVNTVE 1358
            +F+K+GGE F+LG A            + D  K   V  P G         F CTI    K +KFKGMK++I+Y+L  ++T+  + RRYK FDWL+++L+EK+P I +P LP KQ  GR+E++FI  RRK L  W+ H+ SHPVLA     +HFL   S  D+  W  GKR+ EKD      F+  +   P   ++  +   +I+    F    +  +  L    N F ++Q     KE+QK+G S   LS++  L  D  +  + L   +  TGD YD IG+LF +Q + D D V D L    G +   P +I + K     +E
Sbjct:  234 TFVKSGGEAFVLGEAS---------GFVKDGDKLCVVLGPYGPEWQENPYPFQCTIDDPTKQTKFKGMKSYISYKLVPTHTQVPVHRRYKHFDWLYARLAEKFPVISVPHLPEKQATGRFEEDFISKRRKGLIWWMNHMASHPVLAQCDVFQHFLTCPSSTDEKAWKQGKRKAEKDEMVGANFFLTLSTPPAAALDLQEVESKIDGFKCFTKKMDDSALQLNHTANEFARKQVTGFKKEYQKVGQSFRGLSQAFEL--DQQAFSVGLNQAIAFTGDAYDAIGELFAEQPRQDLDPVMDLLALYQGHLANFPDIIHVQKGKAWPLE 547          
BLAST of Sorting nexin vs. Ensembl Human
Match: SNX9 (sorting nexin 9 [Source:HGNC Symbol;Acc:HGNC:14973])

HSP 1 Score: 192.971 bits (489), Expect = 7.933e-53
Identity = 124/418 (29.67%), Postives = 208/418 (49.76%), Query Frame = 3
Query:  333 ASNKERFSQRTSQIVTESSKVNTIRMPKSFLKNGGEEFLLGLAKLSTTIEAKVEVLVDNSKETCVWKPLGDSQF-CTIIAHDKSSKFKGMKTFITYQLQSSYTKDGISRRYKQFDWLHSQLSEKY-PCIVIPPLPNKQVVGRYEDNFIEGRRKHLQKWLTHVTSHPVLAYSQTMKHFLSVKDKDKWTNGKREIEKDYHKSGRFYCAVEAPVDEINWNDYSRRIEKVSTFIDNFEKHSRILQEVYNNFHKRQSGPICKEFQKIGSSIFNLSRSMSLCPDNNSKDISLLHGLQRTGDVYDRIGKLFRKQAQDDGDLVEDNLEAINGVMKEVPALIELAKCAVNTVETSSRKSTECKITLETVEGIDRNVRVITRTVDAELNWLQTEREKQLRSTMVQYLQNQIQLYTNITTILNEALSYF 1580
            A   +R + R S   + S K+   + P  F K G E++LL  AK     + K+ ++V +     V+     S F C +    K SK  G+K++I YQL  + T   ++ RYK FDWL+ +L  K+   I IP LP+KQV GR+E+ FI+ R + LQ W+T +  HPV++ S+  + FL+ +D+ +W  GKR+ E+D       +  +E    +++  +  ++ E V  F    +   + L  V     KR +GP+ KE+QKIG ++ +L+   S        D++    +   G  Y+ I  L  +Q + D   + +      G +   P +I   K A+  V+ S +     KITL+  + + + V +++  + AE+N   + R     S +  YL+ Q+Q Y  I   L +ALS F
Sbjct:  186 AGGAQRGNSRAS---SSSMKIPLNKFP-GFAKPGTEQYLL--AKQLAKPKEKIPIIVGDYGPMWVYP---TSTFDCVVADPRKGSKMYGLKSYIEYQLTPTNTNRSVNHRYKHFDWLYERLLVKFGSAIPIPSLPDKQVTGRFEEEFIKMRMERLQAWMTRMCRHPVISESEVFQQFLNFRDEKEWKTGKRKAERDELAGVMIFSTMEPEAPDLDLVEIEQKCEAVGKFTKAMDDGVKELLTVGQEHWKRCTGPLPKEYQKIGKALQSLATVFSSSGYQGETDLN--DAITEAGKTYEEIASLVAEQPKKDLHFLMECNHEYKGFLGCFPDIIGTHKGAIEKVKESDKLVATSKITLQDKQNMVKRVSIMSYALQAEMNHFHSNRIYDYNSVIRLYLEQQVQFYETIAEKLRQALSRF 592          

HSP 2 Score: 62.7734 bits (151), Expect = 1.505e-9
Identity = 28/57 (49.12%), Postives = 40/57 (70.18%), Query Frame = 3
Query:   48 EAKVIYDFTPEQPS-DLHIESGEIIVIIDQDVGNGWWKARNRRGEEGLIPANYVEII 215
            +A+V+YDF  E  + +L +  GEII I + DVG GW + RN +GE GL+P +YVEI+
Sbjct:    4 KARVMYDFAAEPGNNELTVNEGEIITITNPDVGGGWLEGRNIKGERGLVPTDYVEIL 60          
BLAST of Sorting nexin vs. Ensembl Celegans
Match: lst-4 (Sorting nexin lst-4 [Source:UniProtKB/Swiss-Prot;Acc:Q8I4E2])

HSP 1 Score: 242.662 bits (618), Expect = 9.194e-72
Identity = 136/393 (34.61%), Postives = 215/393 (54.71%), Query Frame = 3
Query:  384 SSKVN-TIRMPKSFLKNGGEEFLLGLAKLSTTIEAKVEVLVDNSKETCVWKPLGDSQFCTIIAHDKSSKFKGMKTFITYQLQSSYTKDGISRRYKQFDWLHSQLSEKYPCIVIPPLPNKQVVGRYEDNFIEGRRKHLQKWLTHVTSHPVLAYSQTMKHFLSVKDKDKWTNGKREIEKDYHKSGRFYCAVEAPVDEINWNDYSRRIEKVSTFIDNFEKHSRILQEVYNNFHKRQSGPICKEFQKIGSSIFNLSRSMSLCPDNNSKDISLLHGLQRTGDVYDRIGKLFRKQAQDDGDLVEDNLEAINGVMKEVPALIELAKCAVNTVETSSRKSTECKITLETVEGIDRNVRVITRTVDAELNWLQTEREKQLRSTMVQYLQNQIQLYTNITTIL 1559
            S+KVN  I    +F+K+G E +++G +K ++ I  + EV+++N      WKP+     C +    K SK KG+K+FI Y + SS T   +SRRYK FDWLH QLS KY  I IPPLP KQV GRYE++ I+ R+  LQ W+  +  HPVL+ S+   HF+S  D+  W NGKR  EKD +  G F   +  P   ++ N+   ++E+    +   E+  R++QE  N F K  +GP+ + +QK+GS+   L +S  +  D       L   L  T   Y  IG++F    ++D + V +NL +  G ++ VP +I++ K AV        + +E +++    E + + +  ++ TV AE+     E+ + ++STM  YL+ Q   Y  + T L
Sbjct:  173 SNKVNKNINRFSNFVKSGVEAYVIGESKTTSQISERHEVVMNNG--IIQWKPIQQYYTCIVDKPKKESKLKGLKSFIAYSITSSLTNIQVSRRYKHFDWLHEQLSAKYVLIPIPPLPEKQVAGRYEEDLIDHRKHILQLWVNKICRHPVLSQSEVWLHFISCTDEKDWKNGKRRAEKDEYIGGAFLNCITVPHQPLDPNNVDMQVERFQRSVKTSEEAMRVMQERMNMFQKVFAGPVKQNWQKMGSAFKTLQQSFEI--DETVASRRLTEALAYTASEYHEIGQVFDAHTKNDMEPVLENLYSYKGTVQNVPDIIQVHKQAVQKF-----RDSEGRLSSAEAEKMKQRIDAMSYTVIAEVQHQTAEKVEDMKSTMGTYLKKQAMFYQEVATKL 556          
BLAST of Sorting nexin vs. Ensembl Celegans
Match: lst-4 (Sorting nexin lst-4 [Source:UniProtKB/Swiss-Prot;Acc:Q8I4E2])

HSP 1 Score: 238.81 bits (608), Expect = 6.337e-71
Identity = 136/395 (34.43%), Postives = 216/395 (54.68%), Query Frame = 3
Query:  384 SSKVN-TIRMPKSFLKNGGEEFLLGLAKLSTTIEAKVEVLVDNSKETCVWKPLGDSQFCTIIAHDKSSKFKGMKTFITYQLQSSYT--KDGISRRYKQFDWLHSQLSEKYPCIVIPPLPNKQVVGRYEDNFIEGRRKHLQKWLTHVTSHPVLAYSQTMKHFLSVKDKDKWTNGKREIEKDYHKSGRFYCAVEAPVDEINWNDYSRRIEKVSTFIDNFEKHSRILQEVYNNFHKRQSGPICKEFQKIGSSIFNLSRSMSLCPDNNSKDISLLHGLQRTGDVYDRIGKLFRKQAQDDGDLVEDNLEAINGVMKEVPALIELAKCAVNTVETSSRKSTECKITLETVEGIDRNVRVITRTVDAELNWLQTEREKQLRSTMVQYLQNQIQLYTNITTIL 1559
            S+KVN  I    +F+K+G E +++G +K ++ I  + EV+++N      WKP+     C +    K SK KG+K+FI Y + SS T  +  +SRRYK FDWLH QLS KY  I IPPLP KQV GRYE++ I+ R+  LQ W+  +  HPVL+ S+   HF+S  D+  W NGKR  EKD +  G F   +  P   ++ N+   ++E+    +   E+  R++QE  N F K  +GP+ + +QK+GS+   L +S  +  D       L   L  T   Y  IG++F    ++D + V +NL +  G ++ VP +I++ K AV        + +E +++    E + + +  ++ TV AE+     E+ + ++STM  YL+ Q   Y  + T L
Sbjct:  112 SNKVNKNINRFSNFVKSGVEAYVIGESKTTSQISERHEVVMNNG--IIQWKPIQQYYTCIVDKPKKESKLKGLKSFIAYSITSSLTNIQRQVSRRYKHFDWLHEQLSAKYVLIPIPPLPEKQVAGRYEEDLIDHRKHILQLWVNKICRHPVLSQSEVWLHFISCTDEKDWKNGKRRAEKDEYIGGAFLNCITVPHQPLDPNNVDMQVERFQRSVKTSEEAMRVMQERMNMFQKVFAGPVKQNWQKMGSAFKTLQQSFEI--DETVASRRLTEALAYTASEYHEIGQVFDAHTKNDMEPVLENLYSYKGTVQNVPDIIQVHKQAVQKF-----RDSEGRLSSAEAEKMKQRIDAMSYTVIAEVQHQTAEKVEDMKSTMGTYLKKQAMFYQEVATKL 497          
BLAST of Sorting nexin vs. Ensembl Celegans
Match: lst-4 (Sorting nexin lst-4 [Source:UniProtKB/Swiss-Prot;Acc:Q8I4E2])

HSP 1 Score: 239.195 bits (609), Expect = 1.714e-70
Identity = 136/395 (34.43%), Postives = 216/395 (54.68%), Query Frame = 3
Query:  384 SSKVN-TIRMPKSFLKNGGEEFLLGLAKLSTTIEAKVEVLVDNSKETCVWKPLGDSQFCTIIAHDKSSKFKGMKTFITYQLQSSYT--KDGISRRYKQFDWLHSQLSEKYPCIVIPPLPNKQVVGRYEDNFIEGRRKHLQKWLTHVTSHPVLAYSQTMKHFLSVKDKDKWTNGKREIEKDYHKSGRFYCAVEAPVDEINWNDYSRRIEKVSTFIDNFEKHSRILQEVYNNFHKRQSGPICKEFQKIGSSIFNLSRSMSLCPDNNSKDISLLHGLQRTGDVYDRIGKLFRKQAQDDGDLVEDNLEAINGVMKEVPALIELAKCAVNTVETSSRKSTECKITLETVEGIDRNVRVITRTVDAELNWLQTEREKQLRSTMVQYLQNQIQLYTNITTIL 1559
            S+KVN  I    +F+K+G E +++G +K ++ I  + EV+++N      WKP+     C +    K SK KG+K+FI Y + SS T  +  +SRRYK FDWLH QLS KY  I IPPLP KQV GRYE++ I+ R+  LQ W+  +  HPVL+ S+   HF+S  D+  W NGKR  EKD +  G F   +  P   ++ N+   ++E+    +   E+  R++QE  N F K  +GP+ + +QK+GS+   L +S  +  D       L   L  T   Y  IG++F    ++D + V +NL +  G ++ VP +I++ K AV        + +E +++    E + + +  ++ TV AE+     E+ + ++STM  YL+ Q   Y  + T L
Sbjct:  173 SNKVNKNINRFSNFVKSGVEAYVIGESKTTSQISERHEVVMNNG--IIQWKPIQQYYTCIVDKPKKESKLKGLKSFIAYSITSSLTNIQRQVSRRYKHFDWLHEQLSAKYVLIPIPPLPEKQVAGRYEEDLIDHRKHILQLWVNKICRHPVLSQSEVWLHFISCTDEKDWKNGKRRAEKDEYIGGAFLNCITVPHQPLDPNNVDMQVERFQRSVKTSEEAMRVMQERMNMFQKVFAGPVKQNWQKMGSAFKTLQQSFEI--DETVASRRLTEALAYTASEYHEIGQVFDAHTKNDMEPVLENLYSYKGTVQNVPDIIQVHKQAVQKF-----RDSEGRLSSAEAEKMKQRIDAMSYTVIAEVQHQTAEKVEDMKSTMGTYLKKQAMFYQEVATKL 558          
BLAST of Sorting nexin vs. Ensembl Celegans
Match: lst-4 (Sorting nexin lst-4 [Source:UniProtKB/Swiss-Prot;Acc:Q8I4E2])

HSP 1 Score: 238.424 bits (607), Expect = 4.929e-70
Identity = 136/395 (34.43%), Postives = 216/395 (54.68%), Query Frame = 3
Query:  384 SSKVN-TIRMPKSFLKNGGEEFLLGLAKLSTTIEAKVEVLVDNSKETCVWKPLGDSQFCTIIAHDKSSKFKGMKTFITYQLQSSYT--KDGISRRYKQFDWLHSQLSEKYPCIVIPPLPNKQVVGRYEDNFIEGRRKHLQKWLTHVTSHPVLAYSQTMKHFLSVKDKDKWTNGKREIEKDYHKSGRFYCAVEAPVDEINWNDYSRRIEKVSTFIDNFEKHSRILQEVYNNFHKRQSGPICKEFQKIGSSIFNLSRSMSLCPDNNSKDISLLHGLQRTGDVYDRIGKLFRKQAQDDGDLVEDNLEAINGVMKEVPALIELAKCAVNTVETSSRKSTECKITLETVEGIDRNVRVITRTVDAELNWLQTEREKQLRSTMVQYLQNQIQLYTNITTIL 1559
            S+KVN  I    +F+K+G E +++G +K ++ I  + EV+++N      WKP+     C +    K SK KG+K+FI Y + SS T  +  +SRRYK FDWLH QLS KY  I IPPLP KQV GRYE++ I+ R+  LQ W+  +  HPVL+ S+   HF+S  D+  W NGKR  EKD +  G F   +  P   ++ N+   ++E+    +   E+  R++QE  N F K  +GP+ + +QK+GS+   L +S  +  D       L   L  T   Y  IG++F    ++D + V +NL +  G ++ VP +I++ K AV        + +E +++    E + + +  ++ TV AE+     E+ + ++STM  YL+ Q   Y  + T L
Sbjct:  199 SNKVNKNINRFSNFVKSGVEAYVIGESKTTSQISERHEVVMNNG--IIQWKPIQQYYTCIVDKPKKESKLKGLKSFIAYSITSSLTNIQRQVSRRYKHFDWLHEQLSAKYVLIPIPPLPEKQVAGRYEEDLIDHRKHILQLWVNKICRHPVLSQSEVWLHFISCTDEKDWKNGKRRAEKDEYIGGAFLNCITVPHQPLDPNNVDMQVERFQRSVKTSEEAMRVMQERMNMFQKVFAGPVKQNWQKMGSAFKTLQQSFEI--DETVASRRLTEALAYTASEYHEIGQVFDAHTKNDMEPVLENLYSYKGTVQNVPDIIQVHKQAVQKF-----RDSEGRLSSAEAEKMKQRIDAMSYTVIAEVQHQTAEKVEDMKSTMGTYLKKQAMFYQEVATKL 584          
BLAST of Sorting nexin vs. Ensembl Celegans
Match: lst-4 (Sorting nexin lst-4 [Source:UniProtKB/Swiss-Prot;Acc:Q8I4E2])

HSP 1 Score: 225.713 bits (574), Expect = 8.176e-68
Identity = 121/344 (35.17%), Postives = 186/344 (54.07%), Query Frame = 3
Query:  528 WKPLGDSQFCTIIAHDKSSKFKGMKTFITYQLQSSYTKDGISRRYKQFDWLHSQLSEKYPCIVIPPLPNKQVVGRYEDNFIEGRRKHLQKWLTHVTSHPVLAYSQTMKHFLSVKDKDKWTNGKREIEKDYHKSGRFYCAVEAPVDEINWNDYSRRIEKVSTFIDNFEKHSRILQEVYNNFHKRQSGPICKEFQKIGSSIFNLSRSMSLCPDNNSKDISLLHGLQRTGDVYDRIGKLFRKQAQDDGDLVEDNLEAINGVMKEVPALIELAKCAVNTVETSSRKSTECKITLETVEGIDRNVRVITRTVDAELNWLQTEREKQLRSTMVQYLQNQIQLYTNITTIL 1559
            WKP+     C +    K SK KG+K+FI Y + SS T   +SRRYK FDWLH QLS KY  I IPPLP KQV GRYE++ I+ R+  LQ W+  +  HPVL+ S+   HF+S  D+  W NGKR  EKD +  G F   +  P   ++ N+   ++E+    +   E+  R++QE  N F K  +GP+ + +QK+GS+   L +S  +  D       L   L  T   Y  IG++F    ++D + V +NL +  G ++ VP +I++ K AV        + +E +++    E + + +  ++ TV AE+     E+ + ++STM  YL+ Q   Y  + T L
Sbjct:    8 WKPIQQYYTCIVDKPKKESKLKGLKSFIAYSITSSLTNIQVSRRYKHFDWLHEQLSAKYVLIPIPPLPEKQVAGRYEEDLIDHRKHILQLWVNKICRHPVLSQSEVWLHFISCTDEKDWKNGKRRAEKDEYIGGAFLNCITVPHQPLDPNNVDMQVERFQRSVKTSEEAMRVMQERMNMFQKVFAGPVKQNWQKMGSAFKTLQQSFEI--DETVASRRLTEALAYTASEYHEIGQVFDAHTKNDMEPVLENLYSYKGTVQNVPDIIQVHKQAVQKF-----RDSEGRLSSAEAEKMKQRIDAMSYTVIAEVQHQTAEKVEDMKSTMGTYLKKQAMFYQEVATKL 344          
BLAST of Sorting nexin vs. Ensembl Fly
Match: SH3PX1 (gene:FBgn0040475 transcript:FBtr0076413)

HSP 1 Score: 199.134 bits (505), Expect = 1.336e-55
Identity = 119/410 (29.02%), Postives = 209/410 (50.98%), Query Frame = 3
Query:  354 SQRTSQIVTESSKVNTIRMPKSFLKNGGEEFLLGLAKLSTTIEAKVEVLVDNSKETCVWKPLGDSQFCTIIAHDK-SSKFKGMKTFITYQLQSSYTKDGISRRYKQFDWLHSQLSEKYPCIVIPPLPNKQVVGRYEDNFIEGRRKHLQKWLTHVTSHPVLAYSQTMKHFLSVKDKDKWTNGKREIEKDYHKSGRFYCAVEAPVDEINWNDYSRRIEKVSTFIDNFEKHSRILQEVYNNFHKRQSGPICKEFQKIGSSIFNLSRSMSL----CPDNNSKDISLLHGLQRTGDVYDRIGKLFRKQAQDDGDLVEDNLEAINGVMKEVPALIELAKCAVNTVETSSRKSTECKITLETVEGIDRNVRVITRTVDAELNWLQTEREKQLRSTMVQYLQNQIQLYTNITTILNEA 1568
            +Q  + +   +    T++  K       + ++LGL+     I       +   +++        S +  ++A  K  SKFKGMKTFI YQL  S+    +SRRYK FDWLH +L +K+  I +PPLP+KQ+ GRYE+ F+E RR  LQ+++  V  HPV++  +   HFL+ +D+  W +GKR+ E+D +    +  A+  P   +  +    ++E  + FI + +   R L  + N+  KR      KEFQ+IG  + +L++++++     P  N+  + L   + R G ++  IG+ F  Q + D   + D L    GV+   P +    K A+   +   + + E ++    +  ++R   V++ TV AEL   ++ER+  L+ T+  ++  QI+ Y  +   L EA
Sbjct:  155 TQSLASVAGGTGAAGTVK--KGMFAKSSDSYILGLSSTKEKIPECEMAYITQVEDSIYQWTQNHSPYSVVVASPKKESKFKGMKTFIAYQLTPSFNNISVSRRYKHFDWLHERLVDKFCLIPVPPLPDKQISGRYEEQFVEHRRVQLQEFVDWVCRHPVISKCEVWYHFLTCRDEKIWKSGKRKAERDPYMGVNYCLAISPPDKNLLHSKVDAQVELGTQFIHSMDVAVRNLNNISNDMAKRSMSQSKKEFQRIGDGLSDLAKALAIDERRAPTRNA--VPLSESVGRIGGIFIGIGQAFGDQPKHDWIPLSDRLHIYRGVLNCFPDIFSTHKGAIQKRKDCEKLAGEGRMNNPQLHDVNRRTDVVSYTVLAELTHFKSERDTHLKHTLKNFIAEQIKFYQGVVARLQEA 560          

HSP 2 Score: 62.7734 bits (151), Expect = 7.126e-10
Identity = 26/56 (46.43%), Postives = 39/56 (69.64%), Query Frame = 3
Query:   54 KVIYDFTPEQ-PSDLHIESGEIIVIIDQDVGNGWWKARNRRGEEGLIPANYVEIIS 218
            + +YDFT E   S+L I +G+++ +   DVG GWW+ +N RG+ GL PA YVE++S
Sbjct:    6 RAMYDFTGEPGSSELSIATGDVLSVTRSDVGEGWWEGKNARGQIGLFPAAYVEVMS 61          
BLAST of Sorting nexin vs. Ensembl Fly
Match: Snx3 (gene:FBgn0038065 transcript:FBtr0082641)

HSP 1 Score: 52.7582 bits (125), Expect = 9.018e-8
Identity = 28/80 (35.00%), Postives = 46/80 (57.50%), Query Frame = 3
Query:  648 ISRRYKQFDWLHSQLSEKYPCIVIPPLPNK----QVV-----GRYEDNFIEGRRKHLQKWLTHVTSHPVLAYSQTMKHFL 860
            + RRY  F+WL ++L E+   IV+PPLP K    Q+      G ++++FIE RRK L+ ++  +  HP+    + +  FL
Sbjct:   72 VRRRYSDFEWLRNEL-ERDSKIVVPPLPGKAWKRQMPFRGDEGIFDESFIEERRKGLEAFINKIAGHPLAQNERCLHMFL 150          
BLAST of Sorting nexin vs. Ensembl Fly
Match: Snx3 (gene:FBgn0038065 transcript:FBtr0082642)

HSP 1 Score: 52.7582 bits (125), Expect = 9.018e-8
Identity = 28/80 (35.00%), Postives = 46/80 (57.50%), Query Frame = 3
Query:  648 ISRRYKQFDWLHSQLSEKYPCIVIPPLPNK----QVV-----GRYEDNFIEGRRKHLQKWLTHVTSHPVLAYSQTMKHFL 860
            + RRY  F+WL ++L E+   IV+PPLP K    Q+      G ++++FIE RRK L+ ++  +  HP+    + +  FL
Sbjct:   72 VRRRYSDFEWLRNEL-ERDSKIVVPPLPGKAWKRQMPFRGDEGIFDESFIEERRKGLEAFINKIAGHPLAQNERCLHMFL 150          
BLAST of Sorting nexin vs. Ensembl Fly
Match: nwk (gene:FBgn0263456 transcript:FBtr0309280)

HSP 1 Score: 54.299 bits (129), Expect = 3.457e-7
Identity = 21/52 (40.38%), Postives = 34/52 (65.38%), Query Frame = 3
Query:   57 VIYDFTPEQPSDLHIESGEIIVIIDQDVGNGWWKARNRRGEEGLIPANYVEI 212
             +Y +T + P +L I   E + ++ +  G+GW +ARN RGEEG +P NY++I
Sbjct:  549 ALYSYTAQNPDELTIVENEQLEVVGEGDGDGWLRARNYRGEEGYVPHNYLDI 600          
BLAST of Sorting nexin vs. Ensembl Fly
Match: nwk (gene:FBgn0263456 transcript:FBtr0309277)

HSP 1 Score: 54.299 bits (129), Expect = 3.462e-7
Identity = 21/52 (40.38%), Postives = 34/52 (65.38%), Query Frame = 3
Query:   57 VIYDFTPEQPSDLHIESGEIIVIIDQDVGNGWWKARNRRGEEGLIPANYVEI 212
             +Y +T + P +L I   E + ++ +  G+GW +ARN RGEEG +P NY++I
Sbjct:  549 ALYSYTAQNPDELTIVENEQLEVVGEGDGDGWLRARNYRGEEGYVPHNYLDI 600          
BLAST of Sorting nexin vs. Ensembl Zebrafish
Match: snx18a (sorting nexin 18a [Source:ZFIN;Acc:ZDB-GENE-070705-339])

HSP 1 Score: 235.343 bits (599), Expect = 8.074e-69
Identity = 137/414 (33.09%), Postives = 211/414 (50.97%), Query Frame = 3
Query:  336 SNKERFSQRTSQIVTESSKVNTIRMPKSFLKNGGEEFLLGLAKLSTTIEAKVEVLVDNSKETCVWKPLGDSQFCTIIAHDKSSKFKGMKTFITYQLQSSYTKDGISRRYKQFDWLHSQLSEKYPCIVIPPLPNKQVVGRYEDNFIEGRRKHLQKWLTHVTSHPVLAYSQTMKHFLSVKDKDK--WTNGKREIEKDYHKSGRFYCAVEAPVDEINWNDYSRRIEKVSTFIDNFEKHSRILQEVYNNFHKRQSGPICKEFQKIGSSIFNLSRSMSLCPDNNSKDISLLHGLQRTGDVYDRIGKLFRKQAQDDGDLVEDNLEAINGVMKEVPALIELAKCAVNTVETSSRKSTECKITLETVEGIDRNVRVITRTVDAELNWLQTEREKQLRSTMVQYLQNQIQLYTNITTILNEAL 1571
            S+  R +Q+     T S  +N      +F+K+GGE F+LG A        K+ V++          P   S  CTI    K +KFKGMK++I+Y+L  ++T+  ++RRYK FDWL+++L EK+P I +P +P KQ  GR+E++FI  RR+ L  W+ H+TSHPVLA     +HFLS    D+  W  GKR+ EKD      F+  +  P   ++  D   RI+    F    +     +    + F ++Q     KE+QK+G S   LS++  +  D  S  I L   +  TG+ Y+ IG  F +Q + D D V D L    G +   P +I + K A+  V+ S +   E K+  +  +GI     +I+    AE+ +    R +  +S M  +LQ QI  +  +T  L EAL
Sbjct:  155 SSMPRGAQQAKSSATVSRNLNRF---STFVKSGGEAFVLGEASGFVKDGDKICVVMGQYGPEWQENPYPFS--CTIDDPTKQTKFKGMKSYISYKLTPTHTQSQVNRRYKHFDWLYARLVEKFPVISVPHIPEKQATGRFEEDFISKRRRGLIWWMNHMTSHPVLARCDVFQHFLSCSSTDEKAWKQGKRKAEKDEMVGANFFLTISTPPAPLDLQDVESRIDGFKVFSKKMDDSVIQVNATLSEFARKQIAGFKKEYQKVGQSFKYLSQAFEM--DQQSYSIGLNQAIAYTGEAYEVIGDYFVEQPKQDVDPVMDLLALYQGHLTNYPDIIHVQKGALTKVKESQKHVEEGKMESQHADGIRDRCNIISFATMAEIQYFHQTRVRDFKSQMQHFLQQQISFFQKVTGKLEEAL 561          

HSP 2 Score: 55.0694 bits (131), Expect = 2.151e-7
Identity = 21/57 (36.84%), Postives = 35/57 (61.40%), Query Frame = 3
Query:   45 IEAKVIYDFTPEQPSDLHIESGEIIVIIDQDVGNGWWKARNRRGEEGLIPANYVEII 215
            + A+ +YDF  E P ++ ++  EI+ +  +    GW +  N RG  GL+PA+YVEI+
Sbjct:    3 LRARALYDFNSENPGEISVKENEIVTLYSEQDIEGWLEGTNSRGARGLLPASYVEIL 59          
BLAST of Sorting nexin vs. Ensembl Zebrafish
Match: snx18a (sorting nexin 18a [Source:ZFIN;Acc:ZDB-GENE-070705-339])

HSP 1 Score: 235.343 bits (599), Expect = 8.074e-69
Identity = 137/414 (33.09%), Postives = 211/414 (50.97%), Query Frame = 3
Query:  336 SNKERFSQRTSQIVTESSKVNTIRMPKSFLKNGGEEFLLGLAKLSTTIEAKVEVLVDNSKETCVWKPLGDSQFCTIIAHDKSSKFKGMKTFITYQLQSSYTKDGISRRYKQFDWLHSQLSEKYPCIVIPPLPNKQVVGRYEDNFIEGRRKHLQKWLTHVTSHPVLAYSQTMKHFLSVKDKDK--WTNGKREIEKDYHKSGRFYCAVEAPVDEINWNDYSRRIEKVSTFIDNFEKHSRILQEVYNNFHKRQSGPICKEFQKIGSSIFNLSRSMSLCPDNNSKDISLLHGLQRTGDVYDRIGKLFRKQAQDDGDLVEDNLEAINGVMKEVPALIELAKCAVNTVETSSRKSTECKITLETVEGIDRNVRVITRTVDAELNWLQTEREKQLRSTMVQYLQNQIQLYTNITTILNEAL 1571
            S+  R +Q+     T S  +N      +F+K+GGE F+LG A        K+ V++          P   S  CTI    K +KFKGMK++I+Y+L  ++T+  ++RRYK FDWL+++L EK+P I +P +P KQ  GR+E++FI  RR+ L  W+ H+TSHPVLA     +HFLS    D+  W  GKR+ EKD      F+  +  P   ++  D   RI+    F    +     +    + F ++Q     KE+QK+G S   LS++  +  D  S  I L   +  TG+ Y+ IG  F +Q + D D V D L    G +   P +I + K A+  V+ S +   E K+  +  +GI     +I+    AE+ +    R +  +S M  +LQ QI  +  +T  L EAL
Sbjct:  155 SSMPRGAQQAKSSATVSRNLNRF---STFVKSGGEAFVLGEASGFVKDGDKICVVMGQYGPEWQENPYPFS--CTIDDPTKQTKFKGMKSYISYKLTPTHTQSQVNRRYKHFDWLYARLVEKFPVISVPHIPEKQATGRFEEDFISKRRRGLIWWMNHMTSHPVLARCDVFQHFLSCSSTDEKAWKQGKRKAEKDEMVGANFFLTISTPPAPLDLQDVESRIDGFKVFSKKMDDSVIQVNATLSEFARKQIAGFKKEYQKVGQSFKYLSQAFEM--DQQSYSIGLNQAIAYTGEAYEVIGDYFVEQPKQDVDPVMDLLALYQGHLTNYPDIIHVQKGALTKVKESQKHVEEGKMESQHADGIRDRCNIISFATMAEIQYFHQTRVRDFKSQMQHFLQQQISFFQKVTGKLEEAL 561          

HSP 2 Score: 55.0694 bits (131), Expect = 2.151e-7
Identity = 21/57 (36.84%), Postives = 35/57 (61.40%), Query Frame = 3
Query:   45 IEAKVIYDFTPEQPSDLHIESGEIIVIIDQDVGNGWWKARNRRGEEGLIPANYVEII 215
            + A+ +YDF  E P ++ ++  EI+ +  +    GW +  N RG  GL+PA+YVEI+
Sbjct:    3 LRARALYDFNSENPGEISVKENEIVTLYSEQDIEGWLEGTNSRGARGLLPASYVEIL 59          
BLAST of Sorting nexin vs. Ensembl Zebrafish
Match: snx33 (sorting nexin 33 [Source:ZFIN;Acc:ZDB-GENE-041111-209])

HSP 1 Score: 220.32 bits (560), Expect = 2.036e-63
Identity = 124/388 (31.96%), Postives = 196/388 (50.52%), Query Frame = 3
Query:  417 SFLKNGGEEFLLGLAKLSTTIEAKVEVLVDNSKETCVWKPLGDSQFCTIIAHDKSSKFKGMKTFITYQLQSSYTKDGISRRYKQFDWLHSQLSEKYPCIVIPPLPNKQVVGRYEDNFIEGRRKHLQKWLTHVTSHPVLAYSQTMKHFLSVKDKDKWTNGKREIEKDYHKSGRFYCAVEAPVDEINWNDYSRRIEKVSTFIDNFEKHSRILQEVYNNFHKRQSGPICKEFQKIGSSIFNLSRSMSLCPDNNSKDISLLHGLQRTGDVYDRIGKLFRKQAQDDGDLVEDNLEAINGVMKEVPALIELAKCAVNTVETSSRKSTECKITLETVEGIDRNVRVITRTVDAELNWLQTEREKQLRSTMVQYLQNQIQLYTNITTILNEALSYF 1580
            SF+++G E F+LG   +   I     + +       +  P   S  C+I    K +KFKG+KT+I+Y++  S+T   + RRYK FDWL+++L  K+  I +P LP KQ  GR+E++FIE R++ L  W+ H+TSHPVL+  +  +HFL   D  +W  GKR  EKD      F    + P +  +  D   RI+   +F    +     L  V +   ++  G   KEFQ++G+   ++S+S  L P  +S  +S  + +  TG  Y+ IG++F  Q ++D   + D L    G++   P +I L K A   V+ S R S E K+     +GI +  R +   + AE+N     RE   +  M  YL+ QI  Y  +   L   L  +
Sbjct:  165 SFVRSGVEAFILGDVPMMAKIAESYSIEMGPRGPQWMDNPRPFS--CSIEDPTKQTKFKGIKTYISYRVTPSHTGRPVYRRYKHFDWLYNRLLHKFTVISVPHLPEKQATGRFEEDFIEKRKRRLILWMDHMTSHPVLSQYEGFEHFLMCGDDKQWKLGKRRAEKDEMVGAHFMLTFQIPNEHQDLQDVEERIDSFKSFAKKMDDSVMQLTNVASELVRKHLGGFRKEFQRLGNGFQSISQSFLLDPPYSSDALS--NAISHTGRTYENIGEMFADQPKNDLFQMLDKLSLYQGLLSNFPDIIHLQKGAFAKVKESQRMSDEGKMDQGEADGIRKRCRTVGFALQAEMNHFHQRREVDFKEMMQAYLRQQIAFYQRVGQQLERTLRMY 548          
BLAST of Sorting nexin vs. Ensembl Zebrafish
Match: snx18b (sorting nexin 18b [Source:ZFIN;Acc:ZDB-GENE-080213-6])

HSP 1 Score: 213.772 bits (543), Expect = 6.536e-61
Identity = 127/393 (32.32%), Postives = 201/393 (51.15%), Query Frame = 3
Query:  417 SFLKNGGEEFLLGLAKLSTTIEAKVEVLVDNSKETCVWKPLGDSQFCTIIAHDKSSKFKGMKTFITYQLQSSYTKDGISRRYKQFDWLHSQLSEKYPCIVIPPLPNKQVVGRYEDNFIEGRRKHLQKWLTHVTSHPVLAYSQTMKHFL--SVKDKDKWTNGKREIEKDYHKSGRFYCAVEAPVDEINWNDYSRRIEKVSTFIDNFEKHSRILQEVYNNFHKRQSGPICKEFQKIGSSIFNLSRSMSLCPDNNSKDISLLHGLQRTGDVYDRIGKLFRKQAQDDGDLVEDNLEAINGVMKEVPALIELAKCAVNTVETSSRKSTECKITLETVEGIDRNVRVITRTVDAELNWLQTEREKQLRSTMVQYLQNQIQLYTNITTILNEALSYF*HA 1589
            +F+K+GGE F+LG A        K+ V++  S       P   +  CTI    K +KFKGMK++++Y L  S+T+  ++RRYK FDWL+++L EK+P I +P LP KQ  GR+E++FI  RRK L  W+ H+TSHPVL+     +HFL  S  D+  W  GKR+ EKD      F+  +  P   ++  +   ++E   TF    +++   +    N F ++Q     KE+Q++G +   LS++  +  D       L   +  TG+VY+ IG  F +Q + D + + D L    G +   P +I + K A+   + S +   E   T     GI+    +I+    AE+      R +  ++ M  +LQ QI  +  IT  L EAL  +  A
Sbjct:  177 TFVKSGGEAFVLGEASGLVRDGDKIFVVMGQSGPEWQENPYAFT--CTIDDPTKQTKFKGMKSYMSYGLTPSHTQSQVNRRYKHFDWLYARLVEKFPVISVPHLPEKQATGRFEEDFISKRRKGLIWWMNHMTSHPVLSKCDVFQHFLTCSSTDEKAWKQGKRKAEKDDLVGANFFLTICPPALPLDLQEVENKVEGFKTFTKKMDENIIQVNVTINEFARKQITGFKKEYQRVGQAFRLLSQAFEV--DQQVFSSPLNKAMANTGEVYETIGDYFAEQPRQDLEPISDLLAIYQGHLANFPDIIHVQKGALTKAKESQKHGEEKDGTAGG--GINDRCNIISCATLAEIQHFHCIRVRDFKAQMQYFLQQQISFFQKITGKLEEALDMYDQA 563          

HSP 2 Score: 63.1586 bits (152), Expect = 6.731e-10
Identity = 24/57 (42.11%), Postives = 38/57 (66.67%), Query Frame = 3
Query:   45 IEAKVIYDFTPEQPSDLHIESGEIIVIIDQDVGNGWWKARNRRGEEGLIPANYVEII 215
            + A+ +YDFT E P ++ +   E++ +  ++V +GW +  N RGE GL PA+YVEII
Sbjct:    3 LRARALYDFTSENPGEISVTENEVLTLCSEEVVDGWLEGTNSRGETGLFPASYVEII 59          
BLAST of Sorting nexin vs. Ensembl Zebrafish
Match: snx18b (sorting nexin 18b [Source:ZFIN;Acc:ZDB-GENE-080213-6])

HSP 1 Score: 211.075 bits (536), Expect = 6.149e-60
Identity = 126/393 (32.06%), Postives = 200/393 (50.89%), Query Frame = 3
Query:  417 SFLKNGGEEFLLGLAKLSTTIEAKVEVLVDNSKETCVWKPLGDSQFCTIIAHDKSSKFKGMKTFITYQLQSSYTKDGISRRYKQFDWLHSQLSEKYPCIVIPPLPNKQVVGRYEDNFIEGRRKHLQKWLTHVTSHPVLAYSQTMKHFL--SVKDKDKWTNGKREIEKDYHKSGRFYCAVEAPVDEINWNDYSRRIEKVSTFIDNFEKHSRILQEVYNNFHKRQSGPICKEFQKIGSSIFNLSRSMSLCPDNNSKDISLLHGLQRTGDVYDRIGKLFRKQAQDDGDLVEDNLEAINGVMKEVPALIELAKCAVNTVETSSRKSTECKITLETVEGIDRNVRVITRTVDAELNWLQTEREKQLRSTMVQYLQNQIQLYTNITTILNEALSYF*HA 1589
            +F+K+GGE F+LG A        K+ V++  S       P   +  CTI    K +KFKGMK++++Y L  S+T+  ++RRYK FDWL+++L EK+P I +P LP KQ  GR+E++FI  RRK L  W+ H+TSHPVL+     +HFL  S  D+  W  GKR+ EKD      F+  +  P   ++  +   ++E   TF    +++   +    N F ++Q     KE+Q++G +   LS++  +  D       L   +  TG+VY+ IG  F +Q + D + + D L      +   P +I + K A+   + S +   E   T     GI+    +I+    AE+      R +  ++ M  +LQ QI  +  IT  L EAL  +  A
Sbjct:  177 TFVKSGGEAFVLGEASGLVRDGDKIFVVMGQSGPEWQENPYAFT--CTIDDPTKQTKFKGMKSYMSYGLTPSHTQSQVNRRYKHFDWLYARLVEKFPVISVPHLPEKQATGRFEEDFISKRRKGLIWWMNHMTSHPVLSKCDVFQHFLTCSSTDEKAWKQGKRKAEKDDLVGANFFLTICPPALPLDLQEVENKVEGFKTFTKKMDENIIQVNVTINEFARKQITGFKKEYQRVGQAFRLLSQAFEV--DQQVFSSPLNKAMANTGEVYETIGDYFAEQPRQDLEPISDLLAIYQAHLANFPDIIHVQKGALTKAKESQKHGEEKDGTAGG--GINDRCNIISCATLAEIQHFHCIRVRDFKAQMQYFLQQQISFFQKITGKLEEALDMYDQA 563          

HSP 2 Score: 63.1586 bits (152), Expect = 6.731e-10
Identity = 24/57 (42.11%), Postives = 38/57 (66.67%), Query Frame = 3
Query:   45 IEAKVIYDFTPEQPSDLHIESGEIIVIIDQDVGNGWWKARNRRGEEGLIPANYVEII 215
            + A+ +YDFT E P ++ +   E++ +  ++V +GW +  N RGE GL PA+YVEII
Sbjct:    3 LRARALYDFTSENPGEISVTENEVLTLCSEEVVDGWLEGTNSRGETGLFPASYVEII 59          
BLAST of Sorting nexin vs. Ensembl Xenopus
Match: snx18 (sorting nexin 18 [Source:NCBI gene;Acc:496591])

HSP 1 Score: 221.09 bits (562), Expect = 2.890e-63
Identity = 121/387 (31.27%), Postives = 201/387 (51.94%), Query Frame = 3
Query:  417 SFLKNGGEEFLLGLAKLSTTIEAKVEVLVDNSKETCVWKPLGDSQFCTIIAHDKSSKFKGMKTFITYQLQSSYTKDGISRRYKQFDWLHSQLSEKYPCIVIPPLPNKQVVGRYEDNFIEGRRKHLQKWLTHVTSHPVLAYSQTMKHFLSVKDKDKWTNGKREIEKDYHKSGRFYCAVEAPVDE--INWNDYSRRIEKVSTFIDNFEKHSRILQEVYNNFHKRQSGPICKEFQKIGSSIFNLSRSMSLCPDNNSKDISLLHGLQRTGDVYDRIGKLFRKQAQDDGDLVEDNLEAINGVMKEVPALIELAKCAVNTVETSSRKSTECKITLETVEGIDRNVRVITRTVDAELNWLQTEREKQLRSTMVQYLQNQIQLYTNITTILNEAL 1571
            +F+K+GGE F+LG A  +  +    ++ V    E   W+       C+I    K +KFKGMK++I+Y+L  S+T   + RRYK FDWL+++L +K+P + +P +P KQ  GR+E++FI  R+K L  W+ H+ SHPVLA     +HFLS  D+  W  GKR+ E+D      F+  +  P     +  +D   R++    F    ++    L +    F ++Q+    KE+QK+G ++  L ++  +  D+      L   +  TG+ Y+ IG++F +Q + D D + D L    G +   P +I + + A+  V  S ++  E K+ L+    I     VI+    AE++     R +  +S M  +LQ QI  +  +T  L EAL
Sbjct:  198 AFVKSGGEAFVLGEA--AGFVRDGDKLCVVPGAEGPEWQENPYPFRCSIDEPTKQTKFKGMKSYISYRLLPSHTGLQVHRRYKHFDWLYARLLDKFPVVSVPRIPEKQATGRFEEDFISKRKKGLVWWMEHMCSHPVLARCDAFQHFLSCTDEKAWKQGKRKCERDEMVGANFFLTLSLPPGSPVLEPHDVDGRLDGFKVFTKRMDEGVLQLSQTAGEFARKQAAGFKKEYQKVGQAVRGLGQAFEM--DHMVFSAGLNRAMAFTGEAYEAIGEMFAEQPRQDLDPIMDLLAVYQGHLANFPDIIHVQRGALTKVRESKKQVEEGKLELQKAGEIQERCNVISYATLAEIHHFHKIRVRDFKSQMQHFLQQQICFFQKVTLKLEEAL 580          

HSP 2 Score: 54.299 bits (129), Expect = 5.521e-7
Identity = 21/60 (35.00%), Postives = 35/60 (58.33%), Query Frame = 3
Query:   36 MSQIEAKVIYDFTPEQPSDLHIESGEIIVIIDQDVGNGWWKARNRRGEEGLIPANYVEII 215
            M  + A+ +YDF  E P ++ +   E++ +  +    GW +  N RGE GL PA+YVE++
Sbjct:    1 MMALRARALYDFRAENPGEVSLRESEVLSLCSEQDIEGWLEGLNSRGERGLFPASYVEVL 60          
BLAST of Sorting nexin vs. Ensembl Xenopus
Match: csrp2 (cysteine and glycine rich protein 2 [Source:Xenbase;Acc:XB-GENE-943913])

HSP 1 Score: 219.164 bits (557), Expect = 7.672e-63
Identity = 117/389 (30.08%), Postives = 203/389 (52.19%), Query Frame = 3
Query:  417 SFLKNGGEEFLLG-LAKLSTTIEAKVEVLVDNSKETCVWKPLGDSQFCTIIAHDKSSKFKGMKTFITYQLQSSYTKDGISRRYKQFDWLHSQLSEKYPCIVIPPLPNKQVVGRYEDNFIEGRRKHLQKWLTHVTSHPVLAYSQTMKHFLSVKDKDKWTNGKREIEKDYHKSGRFYCAVEAPVDEINWNDYSRRIEKVSTFIDNFEKHSRILQEVYNNFHKRQSGPICKEFQKIGSSIFNLSRSMSLCPDNNSKDISLLHGLQRTGDVYDRIGKLFRKQAQDDGDLVEDNLEAINGVMKEVPALIELAKCAVNTVETSSRKSTECKITLETVEGIDRNVRVITRTVDAELNWLQTEREKQLRSTMVQYLQNQIQLYTNITTILNEALSYF 1580
            SF+++G E F+LG + +     E+     ++   +   WK       C++    K +KFKG+K++I+Y+L        + RRYK FDWL+++L  K+  I +P LP KQ  GR+E++FI+ R++ L  W+ H+TSHPVL+     +HFLS +D+ +W  GKR  E+D      F   ++ P +  +  D   R++    F    +++   L  V +   ++  G   KEFQ++G+++  LS S  L P  +S+   L+  +  TG  Y+ +G++F +Q ++D     D L    G++   P +I L K A   V+ S R S E ++  +  +GI +  RV+   + AE+N     R +  +  +  YL+ QI  Y  ++  L + L  +
Sbjct:  163 SFVRSGVEAFVLGDVPQFGGVSESHA---IEMGPKGPQWKANPRPFSCSVEEPTKQTKFKGIKSYISYRLTPDPCNSPVYRRYKHFDWLYNRLLHKFTVISVPHLPEKQATGRFEEDFIQKRKRRLVLWMDHMTSHPVLSQYDGFQHFLSCQDEKQWKAGKRRAERDELVGASFLLTLQLPTEHQDLQDVEERVDVFKAFSKKMDENVLQLSSVVSELARKHLGGFRKEFQRLGAALQGLSHSFQLDPPYSSE--PLVGAISHTGRTYEAVGEMFAEQPKNDQFRFLDTLSLYQGLLSNFPDIIHLQKGAFAKVKESQRMSDEGRMEQDEADGIRKRCRVVGFALQAEINHFHQRRLQDFKQAIQHYLKEQILFYRRVSQELEKTLHMY 546          
BLAST of Sorting nexin vs. Ensembl Xenopus
Match: snx9 (sorting nexin 9 [Source:NCBI gene;Acc:100145698])

HSP 1 Score: 213.386 bits (542), Expect = 3.085e-61
Identity = 142/510 (27.84%), Postives = 242/510 (47.45%), Query Frame = 3
Query:   57 VIYDFTPEQPS-DLHIESGEIIVIIDQDVGNGWWKARNRRGEEGLIPANYVEIISXXXXXXXXXXXXXYIDMXXXXXXXXXXXXXXXXXASDMASNKERFSQRTSQIVTESSKVNTIRMPKSFLKNGGEEFLLGLAKLSTTIEAKVEVLVDNSKETCVWKPLGDSQFCTIIAHDKSSKFKGMKTFITYQLQSSYTKDGISRRYKQFDWLHSQLSEKYP-CIVIPPLPNKQVVGRYEDNFIEGRRKHLQKWLTHVTSHPVLAYSQTMKHFLSVKDKDKWTNGKREIEKDYHKSGRFYCAVEAPVDEINWNDYSRRIEKVSTFIDNFEKHSRILQEVYNNFHKRQSGPICKEFQKIGSSIFNLSRSMSLCPDNNSKDISLLHGLQRTGDVYDRIGKLFRKQAQDDGDLVEDNLEAINGVMKEVPALIELAKCAVNTVETSSRKSTECKITLETVEGIDRNVRVITRTVDAELNWLQTEREKQLRSTMVQYLQNQIQLYTNITTILNEALSYF 1580
            ++YDF+ E  + +L ++ GEI+ + ++DVG GW +A+N +G+ GL+P +YV I S   P          + +                    +  N+  +         +    +T   P  +L  G E    G A+      A +++ ++      +W     +  C +    K +K  G+K++I YQL ++ T   ++ RYK FDWL+ +L  K+   I IP LP+KQV GR+E+ FI+ R + LQ W++ +  HPV++ S+T + FL+ +D+ +W  GKR+ EKD       +  VE    +++  +  ++ E VS F    +   + L  V     KR +GP+ KE+QKIG ++  LS+  S        +  L   +   G  Y+ I  L  +Q + D   + +      G +   P +I   K A+  V+ S +     KIT +    + + V V++  + AE+N   + R     S +  YL+ QIQ Y  I   L +ALS F
Sbjct:    6 ILYDFSAEPGNNELTVKEGEIVTVTNKDVGGGWIEAKNSQGDRGLVPTDYVTIKSPASPLPLFTSEGLLLTLMY------------------VFYNQMFYFLAVDDDEWDDDWDDTKSSPPGYL--GSETSETGAAQRGAGRPASMKIPLNYGP---MWVYPTSTYDCIVADPRKGTKLYGLKSYIEYQLTATNTNRSVNHRYKHFDWLYERLLIKFGLAIPIPSLPDKQVTGRFEEEFIKMRMERLQAWMSRMCRHPVISESETFQQFLNFRDEKEWKIGKRKAEKDEIVGSMIFSTVEPEAQDLDMTEVEQKCEAVSRFTRAMDDGVKELLTVGQEHWKRCTGPLPKEYQKIGKALQTLSQVFST--SGYQGETELNSAIIEAGKTYEAIANLVEEQPKKDLHYLMETNHEYKGFLSCFPDIISAHKGALEKVKESDKLVATSKITQQDKVNMMKRVSVMSYALQAEMNHFHSNRIYDYNSVIRLYLEQQIQFYETIAEKLKQALSQF 490          
BLAST of Sorting nexin vs. Ensembl Xenopus
Match: snx9 (sorting nexin 9 [Source:NCBI gene;Acc:100145698])

HSP 1 Score: 204.142 bits (518), Expect = 6.043e-58
Identity = 140/512 (27.34%), Postives = 240/512 (46.88%), Query Frame = 3
Query:   51 AKVIYDFTPEQPS-DLHIESGEIIVIIDQDVGNGWWKARNRRGEEGLIPANYVEIISXXXXXXXXXXXXXYIDMXXXXXXXXXXXXXXXXXASDMASNKERFSQRTSQIVTESSKVNTIRMPKSFLKNGGEEFLLGLAKLSTTIEAKVEVLVDNSKETCVWKPLGDSQFCTIIAHDKSSKFKGMKTFITYQLQSSYTKDGISRRYKQFDWLHSQLSEKYP-CIVIPPLPNKQVVGRYEDNFIEGRRKHLQKWLTHVTSHPVLAYSQTMKHFLSVKDKDKWTNGKREIEKDYHKSGRFYCAVEAPVDEINWNDYSRRIEKVSTFIDNFEKHSRILQEVYNNFHKRQSGPICKEFQKIGSSIFNLSRSMSLCPDNNSKDISLLHGLQRTGDVYDRIGKLFRKQAQDDGDLVEDNLEAINGVMKEVPALIELAKCAVNTVETSSRKSTECKITLETVEGIDRNVRVITRTVDAELNWLQTEREKQLRSTMVQYLQNQIQLYTNITTILNEALSYF 1580
            A+V+YDF+ E  + +L ++ GEI+ + ++DVG GW +A+N +G+ GL+P +                   Y+++                    +  N+  +         +    +T   P  +L  G E    G A+      A +++ ++      +W     +  C +    K +K  G+K++I YQL +  T   ++ RYK FDWL+ +L  K+   I IP LP+KQV GR+E+ FI+ R + LQ W++ +  HPV++ S+T + FL+ +D+ +W  GKR+ EKD       +  VE    +++  +  ++ E VS F    +   + L  V     KR +GP+ KE+QKIG ++  LS+  S        +  L   +   G  Y+ I  L  +Q + D   + +      G +   P +I   K A+  V+ S +     KIT +    + + V V++  + AE+N   + R     S +  YL+ QIQ Y  I   L +ALS F
Sbjct:    4 ARVLYDFSAEPGNNELTVKEGEIVTVTNKDVGGGWIEAKNSQGDRGLVPTD-------------------YVELLTLMY---------------VFYNQMFYFLAVDDDEWDDDWDDTKSSPPGYL--GSETSETGAAQRGAGRPASMKIPLNYGP---MWVYPTSTYDCIVADPRKGTKLYGLKSYIEYQLTN--TNRSVNHRYKHFDWLYERLLIKFGLAIPIPSLPDKQVTGRFEEEFIKMRMERLQAWMSRMCRHPVISESETFQQFLNFRDEKEWKIGKRKAEKDEIVGSMIFSTVEPEAQDLDMTEVEQKCEAVSRFTRAMDDGVKELLTVGQEHWKRCTGPLPKEYQKIGKALQTLSQVFST--SGYQGETELNSAIIEAGKTYEAIANLVEEQPKKDLHYLMETNHEYKGFLSCFPDIISAHKGALEKVKESDKLVATSKITQQDKVNMMKRVSVMSYALQAEMNHFHSNRIYDYNSVIRLYLEQQIQFYETIAEKLKQALSQF 472          
BLAST of Sorting nexin vs. Ensembl Xenopus
Match: snx9 (sorting nexin 9 [Source:NCBI gene;Acc:100145698])

HSP 1 Score: 188.734 bits (478), Expect = 1.375e-51
Identity = 119/400 (29.75%), Postives = 201/400 (50.25%), Query Frame = 3
Query:  384 SSKVNTIRMPKSFLKNGGEEFLLGLAKLSTTIEAKVEVLVDNSKETCVWKPLGDSQFCTIIAHDKSSKFKGMKTFITYQLQSSYTKDGISRRYKQFDWLHSQLSEKYP-CIVIPPLPNKQVVGRYEDNFIEGRRKHLQKWLTHVTSHPVLAYSQTMKHFLSVKDKDKWTNGKREIEKDYHKSGRFYCAVEAPVDEINWNDYSRRIEKVSTFIDNFEKHSRILQEVYNNFHKRQSGPICKEFQKIGSSIFNLSRSMSLCPDNNSKDISLLHGLQRTGDVYDRIGKLFRKQAQDDGDLVEDNLEAINGVMKEVPALIELAKCAVNTVETSSRKSTECKITLETVEGIDRNVRVITRTVDAELNWLQTEREKQLRSTMVQYLQNQIQLYTNITTILNEALSYF 1580
            S K+   + P  F K+G +++L+  AK     + K+ +++ +     V+     +  C +    K +K  G+K++I YQL ++ T   ++ RYK FDWL+ +L  K+   I IP LP+KQV GR+E+ FI+ R + LQ W++ +  HPV++ S+T + FL+ +D+ +W  GKR+ EKD       +  VE    +++  +  ++ E VS F    +   + L  V     KR +GP+ KE+QKIG ++  LS+  S        +  L   +   G  Y+ I  L  +Q + D   + +      G +   P +I   K A+  V+ S +     KIT +    + + V V++  + AE+N   + R     S +  YL+ QIQ Y  I   L +ALS F
Sbjct:  169 SMKIPLSKFP-GFAKSGVDQYLM--AKQIPKTKEKIPIIIGDYGPMWVYP--TSTYDCIVADPRKGTKLYGLKSYIEYQLTATNTNRSVNHRYKHFDWLYERLLIKFGLAIPIPSLPDKQVTGRFEEEFIKMRMERLQAWMSRMCRHPVISESETFQQFLNFRDEKEWKIGKRKAEKDEIVGSMIFSTVEPEAQDLDMTEVEQKCEAVSRFTRAMDDGVKELLTVGQEHWKRCTGPLPKEYQKIGKALQTLSQVFSTS--GYQGETELNSAIIEAGKTYEAIANLVEEQPKKDLHYLMETNHEYKGFLSCFPDIISAHKGALEKVKESDKLVATSKITQQDKVNMMKRVSVMSYALQAEMNHFHSNRIYDYNSVIRLYLEQQIQFYETIAEKLKQALSQF 561          

HSP 2 Score: 57.7658 bits (138), Expect = 4.485e-8
Identity = 22/44 (50.00%), Postives = 34/44 (77.27%), Query Frame = 3
Query:   87 SDLHIESGEIIVIIDQDVGNGWWKARNRRGEEGLIPANYVEIIS 218
            SDL ++ GEI+ + ++DVG GW +A+N +G+ GL+P +YVE IS
Sbjct:    2 SDLTVKEGEIVTVTNKDVGGGWIEAKNSQGDRGLVPTDYVEFIS 45          
BLAST of Sorting nexin vs. Ensembl Mouse
Match: Snx18 (sorting nexin 18 [Source:MGI Symbol;Acc:MGI:2137642])

HSP 1 Score: 234.572 bits (597), Expect = 4.954e-68
Identity = 137/396 (34.60%), Postives = 203/396 (51.26%), Query Frame = 3
Query:  417 SFLKNGGEEFLLGLAKLSTTIEAKVEVLVDNSKETCVWKPLGDS------QF-CTIIAHDKSSKFKGMKTFITYQLQSSYTKDGISRRYKQFDWLHSQLSEKYPCIVIPPLPNKQVVGRYEDNFIEGRRKHLQKWLTHVTSHPVLAYSQTMKHFL---SVKDKDKWTNGKREIEKDYHKSGRFYCAVE-APVDEINWNDYSRRIEKVSTFIDNFEKHSRILQEVYNNFHKRQSGPICKEFQKIGSSIFNLSRSMSLCPDNNSKDISLLHGLQRTGDVYDRIGKLFRKQAQDDGDLVEDNLEAINGVMKEVPALIELAKCAVNTVETSSRKSTECKITLETVEGIDRNVRVITRTVDAELNWLQTEREKQLRSTMVQYLQNQIQLYTNITTILNEAL 1571
            +F+K+GGE F+LG A            + D  K   V  P G         F CTI    K +KFKGMK++I+Y+L  ++T+  + RRYK FDWL+++L+EK+P I +P LP KQ  GR+E++FI  RRK L  W+ H+ SHPVLA     +HFL   S  D+  W  GKR+ EKD      F+  +   P   ++  +   +I+    F    +  +  L    N F ++Q     KE+QK+G S   LS++  L  D  +  + L   +  TGD YD IG+LF +Q + D D V D L    G +   P +I + K A+  V+ S R   E K+ ++  +GI      I+    AE++     R +  +S M  +LQ QI  +  +T  L EAL
Sbjct:  225 TFVKSGGEAFVLGEAS---------GFVKDGDKLCVVLGPYGPEWQENPYPFQCTIDDPTKQTKFKGMKSYISYKLVPTHTQVPVHRRYKHFDWLYARLAEKFPVISVPHLPEKQATGRFEEDFISKRRKGLIWWMNHMASHPVLAQCDVFQHFLTCPSSTDEKAWKQGKRKAEKDEMVGANFFLTLSTPPAAALDLQEVESKIDGFKCFTKKMDDSALQLNHTANEFARKQVTGFKKEYQKVGQSFRGLSQAFEL--DQQAFSVGLNQAIAFTGDAYDAIGELFAEQPRQDLDPVMDLLALYQGHLANFPDIIHVQKGALTKVKESRRHVEEGKMEVQKADGIQDRCNTISFATLAEIHHFHQIRVRDFKSQMQHFLQQQIIFFQKVTQKLEEAL 609          

HSP 2 Score: 50.447 bits (119), Expect = 7.290e-6
Identity = 19/57 (33.33%), Postives = 34/57 (59.65%), Query Frame = 3
Query:   45 IEAKVIYDFTPEQPSDLHIESGEIIVIIDQDVGNGWWKARNRRGEEGLIPANYVEII 215
            + A+ +YDF  E P ++ +   E++ +  +    GW +  N RG+ GL PA+YV++I
Sbjct:    3 LRARALYDFKSENPGEISLREHEVLSLCSEQDIEGWLEGINSRGDRGLFPASYVQVI 59          
BLAST of Sorting nexin vs. Ensembl Mouse
Match: Snx33 (sorting nexin 33 [Source:MGI Symbol;Acc:MGI:2443239])

HSP 1 Score: 223.787 bits (569), Expect = 2.235e-64
Identity = 125/393 (31.81%), Postives = 198/393 (50.38%), Query Frame = 3
Query:  420 FLKNGGEEFLLG----LAKLSTTIEAKVEVLVDNSKETCVWKPLGDSQFCTIIAHDKSSKFKGMKTFITYQLQSSYTKDGISRRYKQFDWLHSQLSEKYPCIVIPPLPNKQVVGRYEDNFIEGRRKHLQKWLTHVTSHPVLAYSQTMKHFLSVKDKDKWTNGKREIEKDYHKSGRFYCAVEAPVDEINWNDYSRRIEKVSTFIDNFEKHSRILQEVYNNFHKRQSGPICKEFQKIGSSIFNLSRSMSLCPDNNSKDISLLHGLQRTGDVYDRIGKLFRKQAQDDGDLVEDNLEAINGVMKEVPALIELAKCAVNTVETSSRKSTECKITLETVEGIDRNVRVITRTVDAELNWLQTEREKQLRSTMVQYLQNQIQLYTNITTILNEALSYF*H 1586
            F+++G E F+LG    +AK++ T        ++       WK       C+I    K +KFKG+K++I+Y+L  ++    + RRYK FDWL+++L  K+  I +P LP KQ  GR+E++FIE R++ L  W+ H+TSHPVL+  +  +HFLS  D  +W  GKR  EKD      F    + P +  +  D   R++    F    +     L  V     ++  G   KEFQK+GS+   +S +  + P   S   +L + +  TG  Y+ +G++F +Q + D   + D L    G++   P +I L K A   V+ S R S E ++  E  +GI R  RV+   + AE+N     RE   +  M  YL+ QI  Y  +   L + L  + H
Sbjct:  189 FVRSGVEAFILGDVPMMAKIAETYS------IEMGPRGPQWKANPHPFACSIEDPTKQTKFKGIKSYISYKLTPTHAGSPVYRRYKHFDWLYNRLLHKFTVISVPHLPEKQATGRFEEDFIEKRKRRLILWMDHMTSHPVLSQYEGFQHFLSCLDDKQWKMGKRRAEKDEMVGASFLLTFQIPTEHQDLQDVEDRVDTFKAFSKKMDDSVLQLSNVAAELVRKHVGGFRKEFQKLGSAFQAISHAFQMDPPFRSD--ALNNAISHTGRTYETVGEMFAEQPKHDLFQMLDTLSLYQGLLSNFPDIIHLQKGAFAKVKESQRMSDEGRMAQEEADGIRRRCRVVGFALQAEMNHFHQRRELDFKHMMQSYLRQQILFYQRVGQQLEKTLHMYDH 573          

HSP 2 Score: 53.9138 bits (128), Expect = 5.738e-7
Identity = 22/57 (38.60%), Postives = 36/57 (63.16%), Query Frame = 3
Query:   45 IEAKVIYDFTPEQPSDLHIESGEIIVIIDQDVGNGWWKARNRRGEEGLIPANYVEII 215
            ++ + +YDF  E   ++ I+  E +VI  +   +GW + +N RGE GL PA+YVEI+
Sbjct:    3 LKGRALYDFHSENKEEISIQQDEELVIFSETSLDGWLQGQNSRGETGLFPASYVEIV 59          
BLAST of Sorting nexin vs. Ensembl Mouse
Match: Snx9 (sorting nexin 9 [Source:MGI Symbol;Acc:MGI:1913866])

HSP 1 Score: 184.496 bits (467), Expect = 5.946e-50
Identity = 120/407 (29.48%), Postives = 201/407 (49.39%), Query Frame = 3
Query:  366 SQIVTESSKVNTIRMPKSFLKNGGEEFLLGLAKLSTTIEAKVEVLVDNSKETCVWKPLGDSQF-CTIIAHDKSSKFKGMKTFITYQLQSSYTKDGISRRYKQFDWLHSQLSEKY-PCIVIPPLPNKQVVGRYEDNFIEGRRKHLQKWLTHVTSHPVLAYSQTMKHFLSVKDKDKWTNGKREIEKDYHKSGRFYCAVEAPVDEINWNDYSRRIEKVSTFIDNFEKHSRILQEVYNNFHKRQSGPICKEFQKIGSSIFNLSRSMSLCPDNNSKDISLLHGLQRTGDVYDRIGKLFRKQAQDDGDLVEDNLEAINGVMKEVPALIELAKCAVNTVETSSRKSTECKITLETVEGIDRNVRVITRTVDAELNWLQTEREKQLRSTMVQYLQNQIQLYTNITTILNEALSYF 1580
            S+    S K+   + P  F K G E++LL  AK     + K+ ++V +     V+     S F C +    K SK  G+K++I YQL  + T   ++ RYK FDWL+ +L  K+   I IP LP+KQV GR+E+ FI+ R + LQ W+T +  HPV++ S+  + FL+ +D+ +W  GKR+ EKD       +  +E    +++  +  ++ + V  F    +   + L  V     KR +GP+ KE+QKIG ++ +L+   S        D++    +   G  Y+ I  L  +Q + D   + +      G +   P +I   K A+  V+ S +     KIT +  + + + V  ++  + AE+N   + R     S +  YL+ Q+Q Y  I   L +ALS F
Sbjct:  194 SRAGASSMKLPLNKFP-GFAKPGMEQYLL--AKQLAKPKEKIAIIVGDYGPMWVYP---TSTFDCVVADPRKGSKMYGLKSYIEYQLTPTNTNRSVNHRYKHFDWLYERLLVKFGSAIPIPSLPDKQVTGRFEEEFIKMRMERLQAWMTRMCRHPVVSESEVFQQFLNFRDEKEWKTGKRKAEKDELVGVMIFSTMEPEAPDLDLIEIEQKCDAVGKFTKAMDDGVKELLTVGQEHWKRCTGPLPKEYQKIGKALQSLAAVFSSSGYQGETDLN--DAITEAGKTYEEIASLVAEQPKKDLHFLMECNHEYKGFLGCFPDIIGAHKGAIEKVKESDKLVATSKITPQDKQTMVKRVGTMSYALQAEMNHFHSNRIYDYNSVIRLYLEQQVQFYETIAEKLRQALSRF 592          

HSP 2 Score: 60.4622 bits (145), Expect = 4.858e-9
Identity = 25/57 (43.86%), Postives = 41/57 (71.93%), Query Frame = 3
Query:   48 EAKVIYDFTPEQPS-DLHIESGEIIVIIDQDVGNGWWKARNRRGEEGLIPANYVEII 215
            +A+V+YDF  E  + +L +  GEII + + +VG GW + +N +GE+GL+P +YVEI+
Sbjct:    4 KARVMYDFAAEPGNNELTVTEGEIITVTNPNVGGGWLEGKNNKGEQGLVPTDYVEIL 60          
BLAST of Sorting nexin vs. Ensembl Mouse
Match: Snx30 (sorting nexin family member 30 [Source:MGI Symbol;Acc:MGI:2443882])

HSP 1 Score: 88.9669 bits (219), Expect = 2.571e-18
Identity = 87/354 (24.58%), Postives = 147/354 (41.53%), Query Frame = 3
Query:  540 GDSQFCTIIAHDKSSKFKGMKTFITYQLQSSYTKD-------GISRRYKQFDWLHSQLSEKYPCIVIPPLPNK----QVVGRYEDNFIEGRRKHLQKWLTHVTSHPVLAYSQTMKHFLSVKDKDKWTNG-----KREIEKDYHKSGRFYCAVEAPVDEINWNDYSRRIEKVSTFIDNFEKHSRILQEVYNN-----FHKRQSGPICKEFQKIGSSIFNLSRSMSLCPDNNSKDISLLHGLQRTGDVYDRIGKLFRKQAQDDGDLVEDNLEAINGVMKEVPALIELAKCAVNTVETSSRKSTECKITLETVEGIDRNVRVITRTVDAELNWLQTEREKQLRSTMVQYLQNQIQLY 1538
            G+++   +   D       M+T+ITY++ +  T+         + RRY+ FDWL ++L E  P  +IPPLP K     VV R+ + F+E RRK L K+L  +T HPVL++++    FL+ KD + +         R  E   H +G  Y     P++    +DY      + TF        RI Q +           R+ GP+   +  +   +      +S C  N S  +  L     T D+ +    + R+       L  D+++ +     +V A  E    AV     + RK    K+  +  +  DR +      + A++   Q+ +    R  +V      IQ Y
Sbjct:   86 GEARDLFVTVDDPKKHVCTMETYITYRITTKSTRVEFDLPEYSVRRRYQDFDWLRNKLEESQPTHLIPPLPEKFVVKGVVDRFSEEFVETRRKALDKFLKRITDHPVLSFNEHFNVFLTAKDLNAYKKQGIALLSRVGESVKHVTGG-YKLRSRPLEFAAISDY------LDTFALKLGTIDRIAQRIIKEEIEYLVELREYGPVYSTWSALEGELAEPLEGVSACIGNCSTALEEL-----TDDITEEFLPVLREYV-----LYSDSMKGVLKKRDQVQAEYEAKLEAV-----ALRKEERPKVPADVEKCQDR-MECFNADLKADMERWQSNKRHDFRQLLVGLADKNIQYY 416          
BLAST of Sorting nexin vs. Ensembl Mouse
Match: Snx7 (sorting nexin 7 [Source:MGI Symbol;Acc:MGI:1923811])

HSP 1 Score: 82.8037 bits (203), Expect = 2.163e-16
Identity = 61/201 (30.35%), Postives = 106/201 (52.74%), Query Frame = 3
Query:  552 FCTIIAHDKSSKFKGMKTFITYQLQSSYTKDG-------ISRRYKQFDWLHSQLSEKYPCIVIPPLPNKQVVG----RYEDNFIEGRRKHLQKWLTHVTSHPVLAYSQTMKHFLSVKDKDKWTNGKREIEKDYHKSGRFYCAVEA--------PVDEINWNDYSRRIEKVSTFIDNFEKHS-RILQEVYNNFHK-RQSGPI 1091
            F T+ A +  S    ++TFITY++ +  ++         + RRY+ F WL  +L E +P ++IPPLP K +V     R+ D+FIE RRK L K+L  +  HP L +++  K FL+ +  ++ ++ K++      + G+   AV +        P + +  N++   IE  S  I+  +K S RI +E  + F + ++ GPI
Sbjct:   83 FITVDAPE--SHVTTIETFITYRIVTKTSRGEFDSSEFEVRRRYQDFLWLKGKLEEAHPTLIIPPLPEKFIVKGMVERFNDDFIETRRKALHKFLNRIADHPTLTFNEDFKVFLTAQ-AEELSSYKKQGPGLLSRMGQTVRAVASSMRGVKNRPEEFMEMNNF---IETFSQKINLIDKISQRIYKEERDYFDEMKEYGPI 277          
BLAST of Sorting nexin vs. UniProt/SwissProt
Match: sp|Q8I4E2|LST4_CAEEL (Sorting nexin lst-4 OS=Caenorhabditis elegans OX=6239 GN=lst-4 PE=1 SV=1)

HSP 1 Score: 239.195 bits (609), Expect = 2.180e-69
Identity = 136/395 (34.43%), Postives = 216/395 (54.68%), Query Frame = 3
Query:  384 SSKVN-TIRMPKSFLKNGGEEFLLGLAKLSTTIEAKVEVLVDNSKETCVWKPLGDSQFCTIIAHDKSSKFKGMKTFITYQLQSSYT--KDGISRRYKQFDWLHSQLSEKYPCIVIPPLPNKQVVGRYEDNFIEGRRKHLQKWLTHVTSHPVLAYSQTMKHFLSVKDKDKWTNGKREIEKDYHKSGRFYCAVEAPVDEINWNDYSRRIEKVSTFIDNFEKHSRILQEVYNNFHKRQSGPICKEFQKIGSSIFNLSRSMSLCPDNNSKDISLLHGLQRTGDVYDRIGKLFRKQAQDDGDLVEDNLEAINGVMKEVPALIELAKCAVNTVETSSRKSTECKITLETVEGIDRNVRVITRTVDAELNWLQTEREKQLRSTMVQYLQNQIQLYTNITTIL 1559
            S+KVN  I    +F+K+G E +++G +K ++ I  + EV+++N      WKP+     C +    K SK KG+K+FI Y + SS T  +  +SRRYK FDWLH QLS KY  I IPPLP KQV GRYE++ I+ R+  LQ W+  +  HPVL+ S+   HF+S  D+  W NGKR  EKD +  G F   +  P   ++ N+   ++E+    +   E+  R++QE  N F K  +GP+ + +QK+GS+   L +S  +  D       L   L  T   Y  IG++F    ++D + V +NL +  G ++ VP +I++ K AV        + +E +++    E + + +  ++ TV AE+     E+ + ++STM  YL+ Q   Y  + T L
Sbjct:  173 SNKVNKNINRFSNFVKSGVEAYVIGESKTTSQISERHEVVMNNG--IIQWKPIQQYYTCIVDKPKKESKLKGLKSFIAYSITSSLTNIQRQVSRRYKHFDWLHEQLSAKYVLIPIPPLPEKQVAGRYEEDLIDHRKHILQLWVNKICRHPVLSQSEVWLHFISCTDEKDWKNGKRRAEKDEYIGGAFLNCITVPHQPLDPNNVDMQVERFQRSVKTSEEAMRVMQERMNMFQKVFAGPVKQNWQKMGSAFKTLQQSFEI--DETVASRRLTEALAYTASEYHEIGQVFDAHTKNDMEPVLENLYSYKGTVQNVPDIIQVHKQAVQKF-----RDSEGRLSSAEAEKMKQRIDAMSYTVIAEVQHQTAEKVEDMKSTMGTYLKKQAMFYQEVATKL 558          
BLAST of Sorting nexin vs. UniProt/SwissProt
Match: sp|Q91ZR2|SNX18_MOUSE (Sorting nexin-18 OS=Mus musculus OX=10090 GN=Snx18 PE=1 SV=1)

HSP 1 Score: 225.328 bits (573), Expect = 8.083e-64
Identity = 122/343 (35.57%), Postives = 183/343 (53.35%), Query Frame = 3
Query:  555 CTIIAHDKSSKFKGMKTFITYQLQSSYTKDGISRRYKQFDWLHSQLSEKYPCIVIPPLPNKQVVGRYEDNFIEGRRKHLQKWLTHVTSHPVLAYSQTMKHFL---SVKDKDKWTNGKREIEKDYHKSGRFYCAVE-APVDEINWNDYSRRIEKVSTFIDNFEKHSRILQEVYNNFHKRQSGPICKEFQKIGSSIFNLSRSMSLCPDNNSKDISLLHGLQRTGDVYDRIGKLFRKQAQDDGDLVEDNLEAINGVMKEVPALIELAKCAVNTVETSSRKSTECKITLETVEGIDRNVRVITRTVDAELNWLQTEREKQLRSTMVQYLQNQIQLYTNITTILNEAL 1571
            CTI    K +KFKGMK++I+Y+L  ++T+  + RRYK FDWL+++L+EK+P I +P LP KQ  GR+E++FI  RRK L  W+ H+ SHPVLA     +HFL   S  D+  W  GKR+ EKD      F+  +   P   ++  +   +I+    F    +  +  L    N F ++Q     KE+QK+G S   LS++  L  D  +  + L   +  TGD YD IG+LF +Q + D D V D L    G +   P +I + K A+  V+ S R   E K+ ++  +GI      I+    AE++     R +  +S M  +LQ QI  +  +T  L EAL
Sbjct:  268 CTIDDPTKQTKFKGMKSYISYKLVPTHTQVPVHRRYKHFDWLYARLAEKFPVISVPHLPEKQATGRFEEDFISKRRKGLIWWMNHMASHPVLAQCDVFQHFLTCPSSTDEKAWKQGKRKAEKDEMVGANFFLTLSTPPAAALDLQEVESKIDGFKCFTKKMDDSALQLNHTANEFARKQVTGFKKEYQKVGQSFRGLSQAFEL--DQQAFSVGLNQAIAFTGDAYDAIGELFAEQPRQDLDPVMDLLALYQGHLANFPDIIHVQKGALTKVKESRRHVEEGKMEVQKADGIQDRCNTISFATLAEIHHFHQIRVRDFKSQMQHFLQQQIIFFQKVTQKLEEAL 608          
BLAST of Sorting nexin vs. UniProt/SwissProt
Match: sp|Q4VAA7|SNX33_MOUSE (Sorting nexin-33 OS=Mus musculus OX=10090 GN=Snx33 PE=1 SV=1)

HSP 1 Score: 223.787 bits (569), Expect = 1.563e-63
Identity = 125/393 (31.81%), Postives = 198/393 (50.38%), Query Frame = 3
Query:  420 FLKNGGEEFLLG----LAKLSTTIEAKVEVLVDNSKETCVWKPLGDSQFCTIIAHDKSSKFKGMKTFITYQLQSSYTKDGISRRYKQFDWLHSQLSEKYPCIVIPPLPNKQVVGRYEDNFIEGRRKHLQKWLTHVTSHPVLAYSQTMKHFLSVKDKDKWTNGKREIEKDYHKSGRFYCAVEAPVDEINWNDYSRRIEKVSTFIDNFEKHSRILQEVYNNFHKRQSGPICKEFQKIGSSIFNLSRSMSLCPDNNSKDISLLHGLQRTGDVYDRIGKLFRKQAQDDGDLVEDNLEAINGVMKEVPALIELAKCAVNTVETSSRKSTECKITLETVEGIDRNVRVITRTVDAELNWLQTEREKQLRSTMVQYLQNQIQLYTNITTILNEALSYF*H 1586
            F+++G E F+LG    +AK++ T        ++       WK       C+I    K +KFKG+K++I+Y+L  ++    + RRYK FDWL+++L  K+  I +P LP KQ  GR+E++FIE R++ L  W+ H+TSHPVL+  +  +HFLS  D  +W  GKR  EKD      F    + P +  +  D   R++    F    +     L  V     ++  G   KEFQK+GS+   +S +  + P   S   +L + +  TG  Y+ +G++F +Q + D   + D L    G++   P +I L K A   V+ S R S E ++  E  +GI R  RV+   + AE+N     RE   +  M  YL+ QI  Y  +   L + L  + H
Sbjct:  189 FVRSGVEAFILGDVPMMAKIAETYS------IEMGPRGPQWKANPHPFACSIEDPTKQTKFKGIKSYISYKLTPTHAGSPVYRRYKHFDWLYNRLLHKFTVISVPHLPEKQATGRFEEDFIEKRKRRLILWMDHMTSHPVLSQYEGFQHFLSCLDDKQWKMGKRRAEKDEMVGASFLLTFQIPTEHQDLQDVEDRVDTFKAFSKKMDDSVLQLSNVAAELVRKHVGGFRKEFQKLGSAFQAISHAFQMDPPFRSD--ALNNAISHTGRTYETVGEMFAEQPKHDLFQMLDTLSLYQGLLSNFPDIIHLQKGAFAKVKESQRMSDEGRMAQEEADGIRRRCRVVGFALQAEMNHFHQRRELDFKHMMQSYLRQQILFYQRVGQQLEKTLHMYDH 573          

HSP 2 Score: 53.9138 bits (128), Expect = 4.013e-6
Identity = 22/57 (38.60%), Postives = 36/57 (63.16%), Query Frame = 3
Query:   45 IEAKVIYDFTPEQPSDLHIESGEIIVIIDQDVGNGWWKARNRRGEEGLIPANYVEII 215
            ++ + +YDF  E   ++ I+  E +VI  +   +GW + +N RGE GL PA+YVEI+
Sbjct:    3 LKGRALYDFHSENKEEISIQQDEELVIFSETSLDGWLQGQNSRGETGLFPASYVEIV 59          
BLAST of Sorting nexin vs. UniProt/SwissProt
Match: sp|Q8WV41|SNX33_HUMAN (Sorting nexin-33 OS=Homo sapiens OX=9606 GN=SNX33 PE=1 SV=1)

HSP 1 Score: 222.631 bits (566), Expect = 4.054e-63
Identity = 124/391 (31.71%), Postives = 199/391 (50.90%), Query Frame = 3
Query:  420 FLKNGGEEFLLG----LAKLSTTIEAKVEVLVDNSKETCVWKPLGDSQFCTIIAHDKSSKFKGMKTFITYQLQSSYTKDGISRRYKQFDWLHSQLSEKYPCIVIPPLPNKQVVGRYEDNFIEGRRKHLQKWLTHVTSHPVLAYSQTMKHFLSVKDKDKWTNGKREIEKDYHKSGRFYCAVEAPVDEINWNDYSRRIEKVSTFIDNFEKHSRILQEVYNNFHKRQSGPICKEFQKIGSSIFNLSRSMSLCPDNNSKDISLLHGLQRTGDVYDRIGKLFRKQAQDDGDLVEDNLEAINGVMKEVPALIELAKCAVNTVETSSRKSTECKITLETVEGIDRNVRVITRTVDAELNWLQTEREKQLRSTMVQYLQNQIQLYTNITTILNEALSYF 1580
            F+++G E F+LG    +AK++ T        ++       WK       C++    K +KFKG+K++I+Y+L  ++    + RRYK FDWL+++L  K+  I +P LP KQ  GR+E++FIE R++ L  W+ H+TSHPVL+  +  +HFLS  D  +W  GKR  EKD      F    + P +  +  D   R++    F    +     L  V +   ++  G   KEFQK+GS+   +S S  + P   S+  +L   +  TG  Y+ IG++F +Q ++D   + D L    G++   P +I L K A   V+ S R S E ++  +  +GI R  RV+   + AE+N     RE   +  M  YL+ QI  Y  +   L + L  +
Sbjct:  189 FVRSGVEAFILGDVPMMAKIAETYS------IEMGPRGPQWKANPHPFACSVEDPTKQTKFKGIKSYISYKLTPTHAASPVYRRYKHFDWLYNRLLHKFTVISVPHLPEKQATGRFEEDFIEKRKRRLILWMDHMTSHPVLSQYEGFQHFLSCLDDKQWKMGKRRAEKDEMVGASFLLTFQIPTEHQDLQDVEDRVDTFKAFSKKMDDSVLQLSTVASELVRKHVGGFRKEFQKLGSAFQAISHSFQMDPPFCSE--ALNSAISHTGRTYEAIGEMFAEQPKNDLFQMLDTLSLYQGLLSNFPDIIHLQKGAFAKVKESQRMSDEGRMVQDEADGIRRRCRVVGFALQAEMNHFHQRRELDFKHMMQNYLRQQILFYQRVGQQLEKTLRMY 571          

HSP 2 Score: 53.9138 bits (128), Expect = 3.682e-6
Identity = 22/57 (38.60%), Postives = 36/57 (63.16%), Query Frame = 3
Query:   45 IEAKVIYDFTPEQPSDLHIESGEIIVIIDQDVGNGWWKARNRRGEEGLIPANYVEII 215
            ++ + +YDF  E   ++ I+  E +VI  +   +GW + +N RGE GL PA+YVEI+
Sbjct:    3 LKGRALYDFHSENKEEISIQQDEDLVIFSETSLDGWLQGQNSRGETGLFPASYVEIV 59          
BLAST of Sorting nexin vs. UniProt/SwissProt
Match: sp|Q28GP7|SNX33_XENTR (Sorting nexin-33 OS=Xenopus tropicalis OX=8364 GN=snx33 PE=2 SV=1)

HSP 1 Score: 219.164 bits (557), Expect = 4.064e-62
Identity = 117/389 (30.08%), Postives = 203/389 (52.19%), Query Frame = 3
Query:  417 SFLKNGGEEFLLG-LAKLSTTIEAKVEVLVDNSKETCVWKPLGDSQFCTIIAHDKSSKFKGMKTFITYQLQSSYTKDGISRRYKQFDWLHSQLSEKYPCIVIPPLPNKQVVGRYEDNFIEGRRKHLQKWLTHVTSHPVLAYSQTMKHFLSVKDKDKWTNGKREIEKDYHKSGRFYCAVEAPVDEINWNDYSRRIEKVSTFIDNFEKHSRILQEVYNNFHKRQSGPICKEFQKIGSSIFNLSRSMSLCPDNNSKDISLLHGLQRTGDVYDRIGKLFRKQAQDDGDLVEDNLEAINGVMKEVPALIELAKCAVNTVETSSRKSTECKITLETVEGIDRNVRVITRTVDAELNWLQTEREKQLRSTMVQYLQNQIQLYTNITTILNEALSYF 1580
            SF+++G E F+LG + +     E+     ++   +   WK       C++    K +KFKG+K++I+Y+L        + RRYK FDWL+++L  K+  I +P LP KQ  GR+E++FI+ R++ L  W+ H+TSHPVL+     +HFLS +D+ +W  GKR  E+D      F   ++ P +  +  D   R++    F    +++   L  V +   ++  G   KEFQ++G+++  LS S  L P  +S+   L+  +  TG  Y+ +G++F +Q ++D     D L    G++   P +I L K A   V+ S R S E ++  +  +GI +  RV+   + AE+N     R +  +  +  YL+ QI  Y  ++  L + L  +
Sbjct:  163 SFVRSGVEAFVLGDVPQFGGVSESHA---IEMGPKGPQWKANPRPFSCSVEEPTKQTKFKGIKSYISYRLTPDPCNSPVYRRYKHFDWLYNRLLHKFTVISVPHLPEKQATGRFEEDFIQKRKRRLVLWMDHMTSHPVLSQYDGFQHFLSCQDEKQWKAGKRRAERDELVGASFLLTLQLPTEHQDLQDVEERVDVFKAFSKKMDENVLQLSSVVSELARKHLGGFRKEFQRLGAALQGLSHSFQLDPPYSSE--PLVGAISHTGRTYEAVGEMFAEQPKNDQFRFLDTLSLYQGLLSNFPDIIHLQKGAFAKVKESQRMSDEGRMEQDEADGIRKRCRVVGFALQAEINHFHQRRLQDFKQAIQHYLKEQILFYRRVSQELEKTLHMY 546          
BLAST of Sorting nexin vs. TrEMBL
Match: A0A4E0R7W2 (Sorting nexin 9 variant OS=Fasciola hepatica OX=6192 GN=D915_005884 PE=4 SV=1)

HSP 1 Score: 297.36 bits (760), Expect = 2.979e-89
Identity = 181/543 (33.33%), Postives = 286/543 (52.67%), Query Frame = 3
Query:   45 IEAKVIYDFTPEQPSDLHIESGEIIVIIDQDVGNGWWKARNRRGEEGLIPANYVEII---SXXXXXXXXXXXXXYIDMXXXXXXXXXXXXXXXXXASDMASNK-ERF--------------SQRT---------SQIVTESSKVNTIR--MPKSFLKNGGEEFLLGLAKLSTTIEAKVEVLVDNSKETCVWKPLGDSQFCTIIAHDKSSKFKGMKTFITYQLQSSYTKDGISRRYKQFDWLHSQLSEKYPCIVIPPLPNKQVVGRYEDNFIEGRRKHLQKWLTHVTSHPVLAYSQTMKHFLSVKDKDKWTNGKREIEKDYHKSGRFYCAVEA--PVDEINWNDYSRRIEKVSTFIDNFEKHSRILQEVYNNFHKRQSGPICKEFQKIGSSIFNLSRSMSLCPDNNSKDISLLHGLQRTGDVYDRIGKLFRKQAQDDGDLVEDNLEAINGVMKEVPALIELAKCAVNTVETSSRKSTECKITLETVEGIDRNVRVITRTVDAELNWLQTEREKQLRSTMVQYLQNQIQLYTNITTILNEALSYF 1580
            + A+VIYDF+ +   +L + +GE + I DQ VG+GWW ARN  G EGLIP+++VE +       P  PPP+   Y D    +D D D    + +  S +  N  +RF              S RT         + I T+S ++  +R   P+SFL++GG++FLL     +     + E +++      VW+PL     C I +  K SK KG+K+FI YQL +S TK  +SRRYK FDWL+ +L  KYPC+ IPPLP K + GRYED F++ RRK LQ WL  +  HPV+A S    HFL+  D  +W  GKRE E D  + GRFY  V++  P   +++N      E    F    E+ ++IL +   ++H++ SG   K++ ++ ++ F L RS+        ++++L+  L   G+ Y  I +++   A +   ++ D L   + +    P+++ L KCA  + + + R + E K++      I     VITR+V AE NW+  +   +  +   +YL+ Q + +  I   L++A S F
Sbjct:    1 MRARVIYDFSAQAEGELSVAAGEEVTITDQSVGSGWWGARNDFGREGLIPSSFVEPLDIPEPNIPPPPPPQMMNYGDASAVQDWDDDWDSDESDHGSMVQPNATDRFLGPSTRKQSENTSCSSRTFGQVPGSGPTPIHTDSMRLVPLRKGFPRSFLRSGGDDFLLNNDPPTL---PQTEAIIEFVNGIFVWRPLDTPIQCKISSFHKDSKMKGIKSFIAYQLNTSLTKAHVSRRYKHFDWLYCRLVAKYPCVRIPPLPEKAITGRYEDEFVDERRKLLQLWLDRMCKHPVVAQSHVFIHFLTCADVKRWKPGKREAETDRCQGGRFYFDVDSKDPPCALDYNLAC--AEAAEKFAIEMERDTKILCDTLCDYHRKLSGAHAKDYSELSTACFRLCRSLETDVHTKDRNVTLIRALTGAGEAYKAI-RIYHAAACEPTVVLLDCLRDFSRLFNGFPSVMCLGKCACISSDEADRLAAEGKLSHTDATSIRTGSLVITRSVQAECNWIMEQLRAEYLTKFAEYLREQARFHRQIADQLDQAASLF 537          
BLAST of Sorting nexin vs. TrEMBL
Match: A0A075AC92 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_00616 PE=4 SV=1)

HSP 1 Score: 282.722 bits (722), Expect = 2.159e-83
Identity = 176/537 (32.77%), Postives = 264/537 (49.16%), Query Frame = 3
Query:   45 IEAKVIYDFTPEQPSDLHIESGEIIVIIDQDVGNGWWKARNRRGEEGLIPANYVEIISXXXXXXXXXXXXXYIDMXXXXXXXXXXXXXXXXXASDMASNKERFSQRTSQI---------------VTESSKVNTIRMP-------KSFLKNGGEEFLLGLAKLSTTIEAKVEVLVDNSKETCVWKPLGDSQFCTIIAHDKSSKFKGMKTFITYQLQSSYTKDGISRRYKQFDWLHSQLSEKYPCIVIPPLPNKQVVGRYEDNFIEGRRKHLQKWLTHVTSHPVLAYSQTMKHFLSVKDKDKWTNGKREIEKDYHKSGRFYCAV--EAPVDEINWNDYSRR-IEKVSTFIDNFEKHSRILQEVYNNFHKRQSGPICKEFQKIGSSIFNLSRSMSLCPDNNSKDISLLHGLQRTGDVYDRIGKLFRKQAQDDGDLVEDNLEAINGVMKEVPALIELAKCAVNTVETSSRKSTECKITLETVEGIDRNVRVITRTVDAELNWLQTEREKQLRSTMVQYLQNQIQLYTNITTILNEALSYF 1580
            +  +V++DF  +   +L I +GE + I DQ VG+GWW A N  G+ GL+P  +VE I  PEP  PPP PP  I   E+++    D        +  +       +R S++               +T S    ++R         +SF+K+G EEFLL L   S   EA +E       E   W+P G S  C I++  K SK KGMK+FI YQL S +    ++RRYK FDWLH++L  K+PCI IP LP+K + GRYED+F+E RRK LQ+WL  +  HPV++     KHFLS  D  +W  GKRE E D+ +  RF+ A+  E PV      DYS   I+       + E+  R+  E    FH+R +    K+F  + S+   + R+++    + ++++ L      TGD +  +      Q++    L+E   E     +  +PA++ L K A   VE + R   E K++    E I     VI R+V AE  W+  +  +     +  YL ++          L  A S+F
Sbjct:   38 VRVRVLFDFAAQGVGELSITTGEQLTITDQTVGDGWWSAVNSSGQRGLVPCAFVEPIDPPEPNVPPPPPPANIQQTEWDEEWDSDDSNSTVPTTYRSGKPNDAVRRCSELNQPGSPVKSQFISTGITGSPAGESVRFAPVRKAFTRSFIKSGAEEFLLQLETPSVHTEAVIEF----RDEAFCWRPSGQSIQCKILSFHKDSKMKGMKSFIAYQLTSPFVSSHVNRRYKHFDWLHARLVSKFPCICIPSLPDKAITGRYEDDFLEERRKQLQQWLDRMCRHPVVSQCSVFKHFLSCTDAKRWKQGKREAETDHLQGARFFFAINSEEPVTPA---DYSLEIIDSAEKLAADLERGVRVFAEALVEFHRRMTTSTSKDFLAVSSAFLGVCRAINCDIYDKNRNMPLFAAFSNTGDAFRSLSVYHAVQSEPTTQLLECVREHAR-TLATLPAVVSLGKSACVAVEEARRLLAEGKLSQHDAESIQSGAVVIVRSVQAECVWIMQQLRQDFLERVKDYLLDRAAFCRQYADQLQSAASFF 566          
BLAST of Sorting nexin vs. TrEMBL
Match: C1LG69 (Sorting nexin-18 OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 281.567 bits (719), Expect = 2.451e-83
Identity = 180/533 (33.77%), Postives = 287/533 (53.85%), Query Frame = 3
Query:   45 IEAKVIYDFTPEQPSDLHIESGEIIVIIDQDVGNGWWKARNRRGEEGLIPANYVEIISXXXXXXXXXXXXXYIDMXXXXXXXXXXXXXXXXXASDMASNKERFSQRTSQIV---TESS----------KVNTIR--MPKSFLKNGGEEFLLGLAKLS-TTIEAKVEVLVDNSKETCVWKPLGDSQFCTIIAHDKSSKFKGMKTFITYQLQSSYTKDGISRRYKQFDWLHSQLSEKYPCIVIPPLPNKQVVGRYEDNFIEGRRKHLQKWLTHVTSHPVLAYSQTMKHFLSVKDKDKWTNGKREIEKDYHKSGRFYCAVEAPVDEINWNDYSRRIEKVSTFIDNFEKHSRILQEVYNNFHKRQSGPICKEFQKIGSSIFNLSRSMSLCPDNNSKDISLLHGLQRTGDVYDRIGKLFRKQAQDDGDLVEDNLEAINGVMKEVPALIELAKCAVNTVETSSRKST-----ECKITLETVEGIDRNVRVITRTVDAELNWLQTEREKQLRSTMVQYLQNQIQLYTNITTILNEALSYF 1580
            ++ +VIYDF+ +   +L +  GE + I +Q+VG+GWW+A N  G+EGLIP+ +VEII  PEPT PPP  P   +  +  D   +  ++ D++ +D A+  +  + R+ Q+V   T+SS          +   IR   P+SF++NGGE+FLLG         EA ++++ D    T  W+ +       I +  K SK KG+K+FI YQ+ +S +   +SRRYK FDWLHS+L  KYPC+ IPPLP K + GRYED+F++ RRK LQ+WLT +  HPV+++S    HFL+  D  KW  GKRE E D  + GRFY AVE      + +    + E    F+ + ++ ++ L E  N +H++ S  I KEF  +  +  N+S+++         +  L   L  TG  +  +  +   Q++   +L ++ L+    ++     +I LAK A  TV+  +R S      E K +   V  I     +ITR+V AE N + ++   +  + +  YL  Q + Y  I  ++ ++   F
Sbjct:    1 MKVRVIYDFSAQWSGELSVSIGEELTITNQNVGSGWWQAVNAFGKEGLIPSEFVEIIELPEPTAPPPSLPP-TEFGKEIDRFDEWDDEWDSDENDTATLNKNLNDRSQQVVSKQTDSSISVPNNPDYIRTTLIRKFFPRSFIRNGGEDFLLGHDPPPFPQTEANIDLIDD----TFRWRYVSSDLTSCISSFRKDSKMKGIKSFIAYQITNSLSHTQVSRRYKHFDWLHSRLLSKYPCVCIPPLPEKAITGRYEDDFVDERRKWLQQWLTRMCMHPVISHSSVFLHFLTCTDFKKWKLGKREAETDKLQGGRFYFAVETKSGHTSQDYTVEKAEAAERFLSDLDRSTKFLSETVNEYHRKLSTSIRKEFSTLSLAFLNMSKAIESDVHTKPLNTKLCESLTATGTTFRTVACIHSLQSEASINL-QECLKEFTRLLPSTSNIISLAKAACLTVDELNRVSNNNSADEQKYSQSDVNRIQSGALIITRSVQAECNHIMSQIRNEWMNKIKDYLNEQARFYHQIAELIEKSAQSF 527          
BLAST of Sorting nexin vs. TrEMBL
Match: A0A4Z2D6X6 (Sorting nexin-33 isoform 1 OS=Schistosoma japonicum OX=6182 GN=EWB00_004003 PE=4 SV=1)

HSP 1 Score: 281.182 bits (718), Expect = 3.739e-83
Identity = 180/533 (33.77%), Postives = 286/533 (53.66%), Query Frame = 3
Query:   45 IEAKVIYDFTPEQPSDLHIESGEIIVIIDQDVGNGWWKARNRRGEEGLIPANYVEIISXXXXXXXXXXXXXYIDMXXXXXXXXXXXXXXXXXASDMASNKERFSQRTSQIV---TESS----------KVNTIR--MPKSFLKNGGEEFLLGLAKLS-TTIEAKVEVLVDNSKETCVWKPLGDSQFCTIIAHDKSSKFKGMKTFITYQLQSSYTKDGISRRYKQFDWLHSQLSEKYPCIVIPPLPNKQVVGRYEDNFIEGRRKHLQKWLTHVTSHPVLAYSQTMKHFLSVKDKDKWTNGKREIEKDYHKSGRFYCAVEAPVDEINWNDYSRRIEKVSTFIDNFEKHSRILQEVYNNFHKRQSGPICKEFQKIGSSIFNLSRSMSLCPDNNSKDISLLHGLQRTGDVYDRIGKLFRKQAQDDGDLVEDNLEAINGVMKEVPALIELAKCAVNTVETSSRKST-----ECKITLETVEGIDRNVRVITRTVDAELNWLQTEREKQLRSTMVQYLQNQIQLYTNITTILNEALSYF 1580
            ++ +VIYDF+ +   +L +  GE + I +Q+VG+GWW+A N  G+EGLIP+ +VEII  PEPT PPP  P   +  +  D   +  ++ D++ +D A+  +  + R+ Q+V   T+SS          +   IR   P+SF++NGGE+FLLG         EA ++++ D    T  W+ +       I +  K SK KG+K+FI YQ+ +S +   +SRRYK FDWLHS+L  KYPC+ IPPLP K + GRYED+F++ RRK LQ+WLT +  HPV+++S    HFL+  D  KW  GKRE E D  + GRFY AVE      + +    + E    F+ + ++ ++ L E  N +H++ S  I KEF  +  +  N+S+++         +  L   L  TG  +  +  +   Q++   +L ++ L+    ++     +I LAK A  TV+  +R S      E K     V  I     +ITR+V AE N + ++   +  + +  YL  Q + Y  I  ++ ++   F
Sbjct:    1 MKVRVIYDFSAQWSGELSVSIGEELTITNQNVGSGWWQAVNAFGKEGLIPSEFVEIIELPEPTAPPPSLPP-TEFGKEIDRFDEWDDEWDSDENDTATLNKNLNDRSQQVVSKQTDSSISVPNNPDYIRTTLIRKFFPRSFIRNGGEDFLLGHDPPPFPQTEANIDLIDD----TFRWRYVSSDLTSCISSFRKDSKMKGIKSFIAYQITNSLSHTQVSRRYKHFDWLHSRLLSKYPCVCIPPLPEKAITGRYEDDFVDERRKWLQQWLTRMCMHPVISHSSVFLHFLTCTDFKKWKLGKREAETDKLQGGRFYFAVETKSGHTSQDYTVEKAEAAERFLSDLDRSTKFLSETVNEYHRKLSTSIRKEFSTLSLAFLNMSKAIESDVHTKPLNTKLCESLTATGTTFRTVACIHSLQSEASINL-QECLKEFTRLLPSTSNIISLAKAACLTVDELNRVSNNNSADEQKYCQSDVNRIQSGALIITRSVQAECNHIMSQIRNEWMNKIKDYLNEQARFYHQIAELIEKSAQSF 527          
BLAST of Sorting nexin vs. TrEMBL
Match: A0A4Y2JWP3 (Sorting nexin lst-4 OS=Araneus ventricosus OX=182803 GN=lst-4_3 PE=4 SV=1)

HSP 1 Score: 280.026 bits (715), Expect = 1.187e-82
Identity = 169/533 (31.71%), Postives = 273/533 (51.22%), Query Frame = 3
Query:   45 IEAKVIYDFTPEQPS-DLHIESGEIIVIIDQDVGNGWWKARNRRGEEGLIPANYVEIISX--------------XXXXXXXXXXXXYIDMXXXXXXXXXXXXXXXXXASDMASNKERFSQRTSQIVTESSKVNTIRMPKSF------LKNGGEEFLLGLAKLSTTIEAKVEVLVDNSKETCVWKPLGDSQFCTIIAHDKSSKFKGMKTFITYQLQSSYTKDGISRRYKQFDWLHSQLSEKYPCIVIPPLPNKQVVGRYEDNFIEGRRKHLQKWLTHVTSHPVLAYSQTMKHFLSVKDKDKWTNGKREIEKDYHKSGRFYCAVEAPVDEINWNDYSRRIEKVSTFIDNFEKHSRILQEVYNNFHKRQSGPICKEFQKIGSSIFNLSRSMSLCPDNNSKDISLLHGLQRTGDVYDRIGKLFRKQAQDDGDLVEDNLEAINGVMKEVPALIELAKCAVNTVETSSRKSTECKITLETVEGIDRNVRVITRTVDAELNWLQTEREKQLRSTMVQYLQNQIQLYTNITTILNEALSYF 1580
             + + +YDF  +  S +L I + EI+ + +QDVG GWW+  N RG++GL PA YVE  S                + T         +D  +  D DWDD + +        SN    + R S+ +  + +     + KSF      +K+GGE ++LG  K+S   E  + ++  N +    W        C++ + +K +K KG+K+FI YQL  S+    +SRRYK FDWLH +L EK+  I IPPLP+KQ+ GRYE +FI+ R+  LQ W+  +  HPVL+ S+   HFL+  D  +W +GKR  EKD    G F+ A+  P   +   +  ++I+  + F+   +   + L  V  + HKR +GP+ KE Q++  S  +L  +  +    +S   SL   ++ T  VY+ +GK++ +Q + D + + D L    G++   P ++ + K A+N V    + + + +++ + V  I +   VI+    +E+N    ER    +S M  YL  QI  Y  ITT L E L+YF
Sbjct:    5 FQVRALYDFDAQPGSGELSIAANEILTVTNQDVGEGWWEGVNSRGQKGLFPAGYVEAASSAPPPAMPPPPPPADAQITAFSESVLPGVDAVDDWDDDWDDDDSEPGAVQTQVSNASLVTTRESRDLQRAVESRGT-LKKSFNRFSTFVKSGGEGYILGETKISVPTEQCITIIETNGE--IQWLESTSPYTCSVDSPNKKTKLKGLKSFIAYQLIPSFNNIAVSRRYKHFDWLHERLEEKFTLIPIPPLPDKQISGRYEKDFIDHRKNQLQMWVNRICRHPVLSQSEVWMHFLTCTDDKRWKSGKRNAEKDKLIGGSFFHAISTPSIPLENANVEKQIDLFNRFVMKMDDSVKQLFNVAVDQHKRYAGPVKKEIQRMSESFNDLGTAFGMYSSEHSD--SLTTAIKYTASVYEELGKMYEEQPKYDAEPMADVLHEYKGMLSAWPDVLHIQKSALNKVAEHKKLAEDGRLSQDDVAAISQRTDVISYATLSEINHFHNERVAYFKSMMETYLTAQIDFYQRITTKLQETLAYF 532          
BLAST of Sorting nexin vs. Ensembl Cavefish
Match: snx18a (sorting nexin 18 [Source:NCBI gene;Acc:103026104])

HSP 1 Score: 231.876 bits (590), Expect = 1.793e-67
Identity = 130/387 (33.59%), Postives = 200/387 (51.68%), Query Frame = 3
Query:  417 SFLKNGGEEFLLGLAKLSTTIEAKVEVLVDNSKETCVWKPLGDSQFCTIIAHDKSSKFKGMKTFITYQLQSSYTKDGISRRYKQFDWLHSQLSEKYPCIVIPPLPNKQVVGRYEDNFIEGRRKHLQKWLTHVTSHPVLAYSQTMKHFL--SVKDKDKWTNGKREIEKDYHKSGRFYCAVEAPVDEINWNDYSRRIEKVSTFIDNFEKHSRILQEVYNNFHKRQSGPICKEFQKIGSSIFNLSRSMSLCPDNNSKDISLLHGLQRTGDVYDRIGKLFRKQAQDDGDLVEDNLEAINGVMKEVPALIELAKCAVNTVETSSRKSTECKITLETVEGIDRNVRVITRTVDAELNWLQTEREKQLRSTMVQYLQNQIQLYTNITTILNEAL 1571
            +F+K+GGE F+LG A        K+ V++          P   S  CTI    K +KFKGMK++I+Y+L  ++T+  ++RRYK FDWL+++L EK+P I +P +P KQ  GR+E++FI  RRK L  W+ H+TSHPVLA     +HFL  S  D+  W  GKR+ EKD      F+  +  P   ++  +   +I+    F    +     +    N F ++Q     KE+QK+G S   LS++  L  D  +    L   +  TG+ Y+ IG  F +Q + D D V D L    G +   P +I + K A+  V+ S +   E K+  +  +GI+    +I+    AE+      R +  ++ M  YLQ QI  +  +T  L EAL
Sbjct:  199 TFVKSGGEAFVLGEASGFVKDGDKICVVMGQYGPEWQENPYPFS--CTIDDPTKQTKFKGMKSYISYKLTPTHTQSQVNRRYKHFDWLYARLVEKFPVISVPHIPEKQATGRFEEDFISKRRKGLIWWMNHMTSHPVLARCDVFQHFLTCSSTDEKAWKQGKRKAEKDEMVGANFFLTISTPAAPLDLQEVESKIDGFKAFTKKMDDSVIQVNATLNEFARKQIAGFKKEYQKVGQSFKYLSQAFEL--DQQAYSTGLNQAIAYTGEAYEAIGDYFAEQPKQDVDPVMDLLALYQGHLANYPDIIHVQKGALTKVKESQKHVEEGKMERQQADGINERCNIISFATLAEIQHFHHIRVRDYKAQMQHYLQQQISFFQKVTGKLEEAL 581          

HSP 2 Score: 60.4622 bits (145), Expect = 3.528e-9
Identity = 24/56 (42.86%), Postives = 38/56 (67.86%), Query Frame = 3
Query:   45 IEAKVIYDFTPEQPSDLHIESGEIIVIIDQDVGNGWWKARNRRGEEGLIPANYVEI 212
            ++A+V+YDFT E P ++ ++  EI+ +  +    GW +  N RGE GL+PA+YVEI
Sbjct:    3 LQARVLYDFTSENPGEISVKENEIVTLYSEQDIEGWLEGTNSRGERGLLPASYVEI 58          
BLAST of Sorting nexin vs. Ensembl Cavefish
Match: snx33 (sorting nexin 33 [Source:NCBI gene;Acc:103035633])

HSP 1 Score: 220.32 bits (560), Expect = 1.541e-63
Identity = 123/388 (31.70%), Postives = 197/388 (50.77%), Query Frame = 3
Query:  417 SFLKNGGEEFLLGLAKLSTTIEAKVEVLVDNSKETCVWKPLGDSQFCTIIAHDKSSKFKGMKTFITYQLQSSYTKDGISRRYKQFDWLHSQLSEKYPCIVIPPLPNKQVVGRYEDNFIEGRRKHLQKWLTHVTSHPVLAYSQTMKHFLSVKDKDKWTNGKREIEKDYHKSGRFYCAVEAPVDEINWNDYSRRIEKVSTFIDNFEKHSRILQEVYNNFHKRQSGPICKEFQKIGSSIFNLSRSMSLCPDNNSKDISLLHGLQRTGDVYDRIGKLFRKQAQDDGDLVEDNLEAINGVMKEVPALIELAKCAVNTVETSSRKSTECKITLETVEGIDRNVRVITRTVDAELNWLQTEREKQLRSTMVQYLQNQIQLYTNITTILNEALSYF 1580
            SF+++G E F+LG   +   I     +  +       WK       C++    K +KFKG+KT+I+Y++  S+T   + RRYK FDWL+++L  K+  I +P LP KQ  GR+E++FIE R++ L  W+ H+TSHPVL+  +  +HFL   D  +W  GKR  EKD      F   +  P +  +  D   RI+   +F    +     L  V +   ++  G   KEFQ++G+S  ++S++  L P  +S   +L + +  TG  Y+ IG++F +Q + D   + D L    G++   P +I L K A   V+ S R S E K+  +  +GI +  R +   + AE+N     RE   +  M  YL+ QI  Y  +   L   L  +
Sbjct:  165 SFVRSGVEAFVLGDVPMMAKIAEAYSI--EMGPRGPQWKESPQPFCCSVEDPTKQTKFKGIKTYISYRVTPSHTGRPVYRRYKHFDWLYNRLLHKFTVISVPHLPEKQATGRFEEDFIEKRKRRLILWMDHMTSHPVLSQYEGFEHFLMCGDDKQWKLGKRRAEKDEMVGAHFMLTLHIPNEHQDLQDVEERIDTFKSFAKKMDDSVLQLTHVASELVRKHLGGFRKEFQRLGNSFQSISQAFMLDPPYSSD--ALNNAISHTGRTYENIGEMFAEQPKFDLFHMLDKLSLYQGLLSNFPDIIHLQKGAFAKVKESQRMSDEGKMDQDEADGIRKRCRTVGFALQAEMNHFHQRREVDFKEMMQAYLRQQIAFYQRVGQQLERTLHMY 548          

HSP 2 Score: 55.4546 bits (132), Expect = 1.520e-7
Identity = 23/57 (40.35%), Postives = 36/57 (63.16%), Query Frame = 3
Query:   45 IEAKVIYDFTPEQPSDLHIESGEIIVIIDQDVGNGWWKARNRRGEEGLIPANYVEII 215
            ++AK +Y F  E   ++ I+  E ++I +++  +GW +  N RGE GL PA YVEII
Sbjct:    3 LKAKALYTFQSENKEEISIQENEELLIFEENSVDGWLRGENSRGERGLFPATYVEII 59          
BLAST of Sorting nexin vs. Ensembl Cavefish
Match: snx18b (sorting nexin-18-like [Source:NCBI gene;Acc:103036978])

HSP 1 Score: 213.386 bits (542), Expect = 8.661e-61
Identity = 130/425 (30.59%), Postives = 210/425 (49.41%), Query Frame = 3
Query:  321 ASDMASNKERFSQRTSQIVTESSKVNTIRMPKSFLKNGGEEFLLGLAKLSTTIEAKVEVLVDNSKETCVWKPLGDSQFCTIIAHDKSSKFKGMKTFITYQLQSSYTKDGISRRYKQFDWLHSQLSEKYPCIVIPPLPNKQVVGRYEDNFIEGRRKHLQKWLTHVTSHPVLAYSQTMKHFL--SVKDKDKWTNGKREIEKDYHKSGRFYCAVEAPVDEINWNDYSRRIEKVSTFIDNFEKHSRILQEVYNNFHKRQSGPICKEFQKIGSSIFNLSRSMSLCPDNNSKDISLLHGLQRTGDVYDRIGKLFRKQAQDDGDLVEDNLEAINGVMKEVPALIELAKCAVNTVETSSRKSTECKITLETVEGIDRNVRVITRTVDAELNWLQTEREKQLRSTMVQYLQNQIQLYTNITTILNEALSYF*HA 1589
            +S+ +++  R S +     T +   N  R   +F+K+GGE F+LG A      E K+ V++          P+  +  CTI    K +KFKGMK++++Y L  S+T+  ++RRYK FDWL+++L E++P I +P LP KQ  GR+E++FI  RRK L  W+ H+T+HPVL+     +HFL  S  D+  W  GKR+ E+D      F+  +  PV  ++  +   +++    F    +++   +      F ++Q     KE+Q++G +   L ++  L  D     + L   +  T   Y+ IG  F +Q + D + V D L    G +   P +I + K A+   + S R S E     +   GI     +I+    AE+      R +  ++ M  YLQ QI  Y  IT  L E L  F  A
Sbjct:  153 SSNFSASPRRGSSQQQSRSTATVGRNLNRF-STFVKSGGEAFVLGEASGFVREEDKICVVMGQFGPEWQQNPVPFT--CTIDDPTKQTKFKGMKSYMSYGLTPSHTQSQVNRRYKHFDWLYARLVERFPVISVPHLPEKQATGRFEEDFITKRRKGLVWWMNHMTTHPVLSRCDVFQHFLTCSSTDEKAWKQGKRKAERDCLVGANFFLTIVPPVAPLDLQEVESKVDGFKAFAKKMDENLTQVNVTLGEFARKQVTGFRKEYQRVGQAFQLLGQAFEL--DQQEYSVKLNQAIGFTSQAYEAIGDYFAEQPRQDLEPVSDLLAIYQGHLANFPDIIHVQKGALTKTKESQRHSEE----KDGPAGIHERCNIISCATLAEMQHFHRTRVRDFKAQMQHYLQQQIIFYQRITGKLEETLHMFDQA 568          

HSP 2 Score: 60.8474 bits (146), Expect = 2.730e-9
Identity = 23/58 (39.66%), Postives = 38/58 (65.52%), Query Frame = 3
Query:   45 IEAKVIYDFTPEQPSDLHIESGEIIVIIDQDVGNGWWKARNRRGEEGLIPANYVEIIS 218
            + A+ +YDF  E P ++ +   E++ +  ++V +GW +  N RGE GL PA+YVEI+S
Sbjct:    3 LRARALYDFVSENPGEISVVESELLTLYSEEVVDGWLEGTNSRGESGLFPASYVEILS 60          
BLAST of Sorting nexin vs. Ensembl Cavefish
Match: snx9a (sorting nexin-9-like [Source:NCBI gene;Acc:103023149])

HSP 1 Score: 185.652 bits (470), Expect = 4.014e-51
Identity = 109/353 (30.88%), Postives = 182/353 (51.56%), Query Frame = 3
Query:  546 SQFCTIIAHDK-SSKFKGMKTFITYQLQSSYTKDGISRRYKQFDWLHSQLSEKYPC-IVIPPLPNKQVVGRYEDNFIEGRRKHLQKWLTHVTSHPVLAYSQTMKHFLSVKDKDKWTNGKREIEKDYHKSGRFYCAVEAPVDEINWNDYSRRIEKVSTFIDNFEKHSRILQEVYNNFHKRQSGPICKEFQKIG------SSIFNLSRSMSLCPDNNSKDISLLHGLQRTGDVYDRIGKLFRKQAQDDGDLVEDNLEAINGVMKEVPALIELAKCAVNTVETSSRKSTECKITLETVEGIDRNVRVITRTVDAELNWLQTEREKQLRSTMVQYLQNQIQLYTNITTILNEALSYF 1580
            +Q   ++AH K  +K  G+K++I YQ+  + T   ++ RYK FDWL+ +L EK+ C I IP LP+KQV GR+ED FI+ R + LQ W++ +  HPV++ S+  + FL+ KD+  W  GKR+ EKD       +  ++  + E++  +  ++ E  S F  + +   + L  V +   KR +GP+ KE+Q+IG      SS+FN S            + +L   L  TG  Y+ I ++   Q + D   + +      G++   P LI + + A+  V+ + R     KI  +  + + +N+  ++  + AE+N   + R       M  YLQ Q+Q Y  I   L  ALS +
Sbjct:  171 TQLDCVVAHPKKGTKMYGLKSYIEYQIAPNTTHKSVNHRYKHFDWLYERLLEKFGCAIPIPSLPDKQVTGRFEDEFIKMRMERLQGWMSRMCRHPVVSNSEVFQLFLTYKDEKDWKEGKRKAEKDERVGVMVFSTMDPEMRELDPTEVEKKCETFSHFSRSMDDGVKDLLAVGHLHWKRCAGPLQKEYQRIGKAFQSLSSVFNTSAYQG--------EATLTDALTATGKTYEEIAEIVAGQPKKDLHFLLETNNEYKGLLGCFPDLIGVHRAAIEKVKEADRLVAMNKIGPQDKQTMQKNLSTMSYALQAEMNHFHSNRIYDYNRVMQLYLQEQVQFYETIAGKLKHALSQY 515          

HSP 2 Score: 59.3066 bits (142), Expect = 8.644e-9
Identity = 23/59 (38.98%), Postives = 45/59 (76.27%), Query Frame = 3
Query:   45 IEAKVIYDFTPEQPS-DLHIESGEIIVIIDQDVGNGWWKARNRRGEEGLIPANYVEIIS 218
            ++A+V+YDFT E  + +L ++ GE++ +++Q VG GW +A+N +G+ GL+P +Y++ I+
Sbjct:    3 VKAQVLYDFTAEPGNNELSVQEGEMLTVMNQAVGGGWVEAQNSKGQTGLVPEDYIQQIN 61          
BLAST of Sorting nexin vs. Ensembl Cavefish
Match: snx9b (sorting nexin-9 [Source:NCBI gene;Acc:103024560])

HSP 1 Score: 177.178 bits (448), Expect = 1.056e-47
Identity = 104/344 (30.23%), Postives = 172/344 (50.00%), Query Frame = 3
Query:  555 CTIIAHDKSSKFKGMKTFITYQLQSSYTKDGISRRYKQFDWLHSQLSEKY-PCIVIPPLPNKQVVGRYEDNFIEGRRKHLQKWLTHVTSHPVLAYSQTMKHFLSVKDKDKWTNGKREIEKDYHKSGRFYCAVEA-PVDEINWNDYSRRIEKVSTFIDNFEKHSRILQEVYNNFHKRQSGPICKEFQKIGSSIFNLSRSMSLCPDNNSKDISLLHGLQRTGDVYDRIGKLFRKQAQDDGDLVEDNLEAINGVMKEVPALIELAKCAVNTVETSSRKSTECKITLETVEGIDRNVRVITRTVDAELNWLQTEREKQLRSTMVQYLQNQIQLYTNITTILNEALSYF 1580
            C +    K SK  G+K++I YQ+  + T   ++ RYK FDWL+ +L EK+   I IP LP+KQV GR+E+ FI+ R + LQ W+T +  HPV++ S+  + FL+ KD+  W  GKR+ EKD       +  +E   V ++  ++  ++ E+ S F    +   + L  V N   KR +GP+ KE+Q+IG +  NLS   +        + +L   L   G  Y+ I ++  +Q + D   + +      G++   P  I + K A+  V+ + +     KIT      + +    ++  + AE+N   + R       M QYL+ Q++ Y  I   L  A S F
Sbjct:  208 CVVADPKKGSKMYGLKSYIEYQVTPNTTNKPVNHRYKHFDWLYERLLEKFGSAIPIPCLPDKQVTGRFEEEFIKMRMERLQGWMTRMCRHPVVSSSEVFQLFLTYKDEKDWKTGKRKAEKDETVGVMIFSTIEPEGVPDLEIHEVEQKCEQFSRFTKAMDDGVKDLLTVGNEHWKRCTGPLPKEYQRIGKAFQNLSSVFT--SSGYEGEATLTDALTAAGKTYEEIAQMVAEQPRKDLHFLMETNNEYKGLLGCFPDTIGVHKAAIEKVKEADKLVAASKITSAEKVTMGKRASSMSYALQAEMNHFHSNRIYDYNRVMQQYLEEQVKFYETIAEKLRHAHSQF 549          

HSP 2 Score: 61.6178 bits (148), Expect = 1.432e-9
Identity = 27/55 (49.09%), Postives = 40/55 (72.73%), Query Frame = 3
Query:   51 AKVIYDFTPEQPS-DLHIESGEIIVIIDQDVGNGWWKARNRRGEEGLIPANYVEI 212
            A+V+YDF+ E  + +L +  GE I I +Q++G GW +ARN RGE GL+P +YVE+
Sbjct:    5 AQVLYDFSAEPGNNELSVREGETITITNQNIGGGWIEARNSRGEVGLVPEDYVEL 59          
BLAST of Sorting nexin vs. Ensembl Sea Lamprey
Match: snx18b (sorting nexin 18b [Source:ZFIN;Acc:ZDB-GENE-080213-6])

HSP 1 Score: 209.149 bits (531), Expect = 4.645e-60
Identity = 124/388 (31.96%), Postives = 190/388 (48.97%), Query Frame = 3
Query:  420 FLKNGGEEFLLGLAKLSTTIEAKVEVLVDNSKETCVWKPLGDSQF---CTIIAHDKSSKFKGMKTFITYQLQSSYTKDGISRRYKQFDWLHSQLSEKYPCIVIPPLPNKQVVGRYEDNFIEGRRKHLQKWLTHVTSHPVLAYSQTMKHFLSVKDKDKWTNGKREIEKDYHKSGRFYCAVEA-PVDEINWNDYSRRIEKVSTFIDNFEKHSRILQEVYNNFHKRQSGPICKEFQKIGSSIFNLSRSMSLCPDNNSKDISLLHGLQRTGDVYDRIGKLFRKQAQDDGDLVEDNLEAINGVMKEVPALIELAKCAVNTVETSSRKSTECKITLETVEGIDRNVRVITRTVDAELNWLQTEREKQLRSTMVQYLQNQIQLYTNITTILNEAL 1571
            ++K GGE F+ G      T+     V VD +     W    D+ F   C+I    K +KFKGMK+FI+Y+L  ++T   +SRRYK FDWL+ +L +K+P + +P LP KQ  GR+ ++F++ RR+ L  W+ H+T HPVLA     +HFL+  D+  W  GKR  EKD     +FY  + A P   ++  D   R +   +F    ++   +L        ++      ++FQK+G    NL +S     D+     +L   +  TG+ Y  IG+LF +Q Q D   + D      G++   P +I + K AV  V+ S R + E K+    +  +      ++    AE N     R K     M  YLQ QI  Y  I   L+E+L
Sbjct:  161 YVKAGGEAFISGDVT-GCTVNVGDRVRVDIADRGPAWP---DNPFPFTCSIEDPTKQTKFKGMKSFISYRLTPTFTGRAVSRRYKHFDWLYGRLVQKFPVVSVPHLPEKQATGRFVEDFVQKRRRGLILWMNHMTGHPVLAQCDAFQHFLTCTDEKAWKQGKRRAEKDDAVGAKFYLTISAPPTSHLDLQDVEARTDSFRSFSKRMDESVVLLNGTAGEMARKHCIDYKRDFQKMGQVFENLGQSFE--QDDQHYSDNLTKAITHTGNTYVAIGELFAQQPQQDLQPLMDVTCLYQGLLANFPDIIHIQKGAVAKVKESQRAADEGKMDAGQLTEVQTRTNTVSHATLAEFNHFHCTRVKDFGQIMQLYLQQQIAFYQAIAGRLDESL 542          

HSP 2 Score: 58.5362 bits (140), Expect = 3.297e-9
Identity = 22/60 (36.67%), Postives = 36/60 (60.00%), Query Frame = 3
Query:   36 MSQIEAKVIYDFTPEQPSDLHIESGEIIVIIDQDVGNGWWKARNRRGEEGLIPANYVEII 215
            M    A+ +YDF  E   ++ I   +++ + ++ VG+GW++  N RGE GL PA YVE +
Sbjct:    1 MVSRRARALYDFQSENEGEISIRERDVLTVFNEGVGDGWFEGTNSRGERGLFPATYVEFL 60          
BLAST of Sorting nexin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001438.1 (pep scaffold:Pmarinus_7.0:GL485280:2234:11313:-1 gene:ENSPMAG00000001299.1 transcript:ENSPMAT00000001438.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 104.76 bits (260), Expect = 1.049e-24
Identity = 53/144 (36.81%), Postives = 74/144 (51.39%), Query Frame = 3
Query:  555 CTIIAHDKSSKFKGMKTFITYQLQSSYTKDG----------ISRRYKQFDWLHSQLSEKYPCIVIPPLPNK-QVVGRYEDNFIEGRRKHLQKWLTHVTSHPVLAYSQTMKHFLSVKDK-DKWTNGKREIEKDYHKSGRFYCAVE 950
            C + A  K SKF G+K+++ Y+L +S               + RRYKQF WL ++L EK+P +V+P LP       RY    +  R   L  WL HVT HP LA    ++HFL+  D  ++W  GKR  E+D      FY  V+
Sbjct:   12 CAVSAPSKRSKFGGIKSYLAYELTTSSAAAAAAADSPAPSPVWRRYKQFAWLRARLEEKFPAVVVPRLPGTLPAAARYAPECVRRRVGELSLWLEHVTGHPALAGCDVLRHFLTCGDNVEEWKGGKRRAERDRDVGHSFYLGVD 155          
BLAST of Sorting nexin vs. Ensembl Sea Lamprey
Match: snx30 (sorting nexin family member 30 [Source:NCBI gene;Acc:550496])

HSP 1 Score: 81.6481 bits (200), Expect = 7.226e-17
Identity = 41/104 (39.42%), Postives = 62/104 (59.62%), Query Frame = 3
Query:  594 GMKTFITYQLQSSYTK---DG----ISRRYKQFDWLHSQLSEKYPCIVIPPLPN----KQVVGRYEDNFIEGRRKHLQKWLTHVTSHPVLAYSQTMKHFLSVKD 872
             M+T+ITY++    T+   DG    + RRY+ FDWL ++L E  P  +IPPLP     K VV R+ ++F+  R+K L K+L  + +HP L++S     FL+ KD
Sbjct:   39 AMETYITYRVTVRTTRSEYDGMEFVVRRRYQDFDWLRTKLEETQPTHIIPPLPEKFVMKGVVDRFTEDFVTTRQKALDKFLNRLANHPTLSFSSYFHSFLTAKD 142          
BLAST of Sorting nexin vs. Ensembl Sea Lamprey
Match: snx3 (sorting nexin 3 [Source:ZFIN;Acc:ZDB-GENE-030131-921])

HSP 1 Score: 53.1434 bits (126), Expect = 4.887e-9
Identity = 30/93 (32.26%), Postives = 49/93 (52.69%), Query Frame = 3
Query:  648 ISRRYKQFDWLHSQLSEKYPCIVIPPLPNKQVV---------GRYEDNFIEGRRKHLQKWLTHVTSHPVLAYSQTMKHFLSVKDKDK-WTNGK 896
            + RRY  F+WL ++L E+   IV+PPLP K            G ++D+FI  RR  L++++  +  HP+    + +  FL  +  DK +  GK
Sbjct:   14 VRRRYSDFEWLKNEL-ERDSKIVVPPLPGKAFTRLLPFRGDDGIFDDSFIAERRSGLEQFINKIAGHPLAQNERCLHMFLQDETIDKGYVPGK 105          
BLAST of Sorting nexin vs. Ensembl Sea Lamprey
Match: snx1a (sorting nexin 1a [Source:ZFIN;Acc:ZDB-GENE-060302-3])

HSP 1 Score: 52.373 bits (124), Expect = 2.357e-7
Identity = 55/243 (22.63%), Postives = 101/243 (41.56%), Query Frame = 3
Query:  594 GMKTFITYQLQSSYT-------KDGISRRYKQFDWLHSQLSEKYP--CIVIPPLPNKQVVGRYE-----DN-----FIEGRRKHLQKWLTHVTSHPVLAYSQTMKHFLSVKDKDKWTNGKREIEKDYHKSGRFYCAVEAPVDEIN-----WNDYSRRIEKVSTFIDNFEKHSRILQEVYNNF-----HKRQSGPICKEFQKIGSSIFN------LSRSMSLCPDNNSKDISLLHGLQRTGDVY 1217
            GM  ++ Y + ++ +       +  + RR+  F  L+ +L+EK+     ++PP P K V+G  +     D+     F+E RR  L+++L   + HP L      + FL   +  +  N +         +G      +A  D +N      N+     E+     +N E     L++++ NF     H+++       F K  + + N      LSR++S   +   K I  LH  Q   D+Y
Sbjct:  182 GMNAYMAYNVTTTTSLPMFKRKEFTVKRRFSDFLGLYEKLTEKFSHSGFIVPPAPEKSVLGMTKVKVGKDDPSSVEFVERRRAALERYLQRTSKHPTLMQDPDFRDFLERDELPRAVNTQA-----LSGAGILRMVTKA-ADAVNKMTIKMNESDSWFEEKQLEFENLETQ---LRKLHGNFEGLVNHRKEMSLNTAAFAKSAAMLGNSEDNTALSRALSQLAEVEEK-IDALHQEQANADLY 414          
BLAST of Sorting nexin vs. Ensembl Yeast
Match: VPS5 (Nexin-1 homolog; required for localizing membrane proteins from a prevacuolar/late endosomal compartment back to late Golgi; structural component of retromer membrane coat complex; forms a retromer subcomplex with Vps17p; required for recruiting the retromer complex to the endosome membranes; VPS5 has a paralog, YKR078W, that arose from the whole genome duplication [Source:SGD;Acc:S000005595])

HSP 1 Score: 67.3958 bits (163), Expect = 3.422e-12
Identity = 31/75 (41.33%), Postives = 43/75 (57.33%), Query Frame = 3
Query:  648 ISRRYKQFDWLHSQLSEKYPCIVIPPLPNKQVVGRYEDNFIEGRRKHLQKWLTHVTSHPVLAYSQTMKHFLSVKD 872
            +SRRY+ F WL+ QL   +   VIPP P KQ VG +++NFIE RR  ++  L  +   PVL   +    FL+  D
Sbjct:  317 VSRRYRDFRWLYRQLQNNHWGKVIPPPPEKQSVGSFKENFIENRRFQMESMLKKICQDPVLQKDKDFLLFLTSDD 391          
BLAST of Sorting nexin vs. Ensembl Yeast
Match: YSC84 (Actin-binding protein; involved in bundling of actin filaments and endocytosis of actin cortical patches; activity stimulated by Las17p; contains SH3 domain similar to Rvs167p; YSC84 has a paralog, LSB3, that arose from the whole genome duplication [Source:SGD;Acc:S000001058])

HSP 1 Score: 53.5286 bits (127), Expect = 6.788e-8
Identity = 24/55 (43.64%), Postives = 34/55 (61.82%), Query Frame = 3
Query:   51 AKVIYDFTPEQPSDLHIESGEIIVIIDQ-DVGNGWWKARNRRGEEGLIPANYVEI 212
            A  +Y+F  EQP DL  + G++I I+ + D  N WW  R   G+EG+ PANYV +
Sbjct:  414 AVALYNFAGEQPGDLAFKKGDVITILKKSDSQNDWWTGRTN-GKEGIFPANYVRV 467          
BLAST of Sorting nexin vs. Ensembl Yeast
Match: SNX4 (Sorting nexin; involved in retrieval of late-Golgi SNAREs from post-Golgi endosomes to the trans-Golgi network and in cytoplasm to vacuole transport; contains a PX phosphoinositide-binding domain; forms complexes with Snx41p and with Atg20p [Source:SGD;Acc:S000003573])

HSP 1 Score: 51.9878 bits (123), Expect = 1.792e-7
Identity = 43/175 (24.57%), Postives = 84/175 (48.00%), Query Frame = 3
Query:  648 ISRRYKQFDWLHSQLSEKYPCIVIPPLPNKQVV-----GRYEDNFIEGRRKHLQKWLTHVTSHPVLAYSQTMKHFLSVKDKDKWTNGKREIEKDYHKSGRFYCAVEAPVDEIN------WNDYSRRIEKVSTFIDNFEKHSRILQEVYNNFHK--RQSGPICKEFQKIGSSIFNL 1133
            + RRY     LH  L  ++P  +IPPLP+K+V       R+   F + R   LQ +L  V+ HP L+ S+  K FL  KD   W + ++ ++           +++   DE+       +    ++ E+ +   +  +K  R + ++   FHK  +++  + +++ K+GS++  L
Sbjct:   75 VHRRYSDLLLLHDILLNRFPTCIIPPLPDKKVFQYIAGDRFSQRFTQKRCHSLQNFLRRVSLHPDLSQSKVFKTFLVSKD---WESHRKVLQD----------SLQPNKDEVTDAFMNAFKTVHKQNEEFTEIREKSDKLDRTVTKIDKLFHKVVKKNDSMSEDYTKLGSNLQEL 236          
BLAST of Sorting nexin vs. Ensembl Yeast
Match: PEX13 (Peroxisomal importomer complex component; integral peroxisomal membrane protein required for docking and translocation of peroxisomal matrix proteins; interacts with the PTS1 signal recognition factor Pex5p and the PTS2 signal recognition factor Pex7p; forms a complex with Pex14p and Pex17p; human homolog PEX13 complements yeast null mutant [Source:SGD;Acc:S000004181])

HSP 1 Score: 50.447 bits (119), Expect = 4.196e-7
Identity = 23/60 (38.33%), Postives = 36/60 (60.00%), Query Frame = 3
Query:   51 AKVIYDFTPEQPS-DLHIESGEIIVIIDQDVGNG----WWKARNRRGEEGLIPANYVEII 215
            A+ +YDF PE P  ++ ++ G+++ I+ +    G    WWK R + G  G IP NY+EII
Sbjct:  311 ARALYDFVPENPEMEVALKKGDLMAILSKKDPLGRDSDWWKVRTKNGNIGYIPYNYIEII 370          
BLAST of Sorting nexin vs. Ensembl Yeast
Match: MVP1 (Protein required for sorting proteins to the vacuole; Mvp1p and Vps1p act in concert to promote membrane traffic to the vacuole; participates in transcription initiation and/or early elongation of specific genes; interacts with "foot domain" of RNA polymerase II; deletion results in abnormal CTD-Ser5 phosphorylation of RNA polymerase II at specific promoter regions; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000004606])

HSP 1 Score: 50.8322 bits (120), Expect = 4.605e-7
Identity = 29/92 (31.52%), Postives = 47/92 (51.09%), Query Frame = 3
Query:  597 MKTFITYQLQSSYTKDGISRRYKQFDWLHSQLSEKYPCIVIPPLPNKQVVGRYEDN-FIEGRRKHLQKWLTHVTSHPVLAYSQTMKHFLSVK 869
            +K  I     S   +  + RRY  F WL   L ++YP  +IP LP K++  +  D  F++ RR  L +++  V  HP L+    +  FL+V+
Sbjct:  152 VKHLIALPSTSPSEERTVVRRYSDFLWLREILLKRYPFRMIPELPPKRIGSQNADQLFLKKRRIGLSRFINLVMKHPKLSNDDLVLTFLTVR 243          
BLAST of Sorting nexin vs. Ensembl Nematostella
Match: EDO49827 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7REN9])

HSP 1 Score: 244.588 bits (623), Expect = 2.771e-73
Identity = 165/537 (30.73%), Postives = 273/537 (50.84%), Query Frame = 3
Query:   36 MSQIEAKVIYDFTPEQPSDLHIESGEIIVIIDQ-------DVGNGWWKARNRRGEEGLIPANYVEIIS-------------XXXXXXXXXXXXXYIDMXXXXXXXXXXXXXXXXXASDMASNKERFSQRTSQIVTESSKVNTIRMPKSFLKNGGEEFLLGLAK--LSTTIEAKVEVLVDNSK--ETCVWKPLGDSQFCTIIAHDKSSKFKGMKTFITYQLQSSYTKDGISRRYKQFDWLHSQLSEKYPCIVIPPLPNKQVVGRYEDNFIEGRRKHLQKWLTHVTSHPVLAYSQTMKHFLSVKDKDK-WTNGKREIEKDYHKSGRFYCAVEAPVDEINWNDYSRRIEKVSTFIDNFEKHSRILQEVYNNFHKRQS-------GPICKEFQKIGSSIFNLSRSMSLCPDNNSKDISLLHGLQRTGDVYDRIGKLFRKQAQDDGDLVEDNLEAINGVMKEVPALIELAKCAVNTVETSSRKSTECKITLETVEGIDRNVRVITRTVDAELNWLQTEREKQLRSTMVQYLQNQIQLYTNIT 1550
            M+  + +V+YDF      D    +GE+IV +D+       DVG GWW+   + G +GL P  YVE+IS              P     PP    Y D ++F+D   DD+    +     AS  +R    +S   T + + +  R    F+K+GGE ++LG A+  L    E  V V+  + +   + VW+P      C++   +K SKFKGMK+FI+Y +  + T   +SRR+K FDWL+++L +KY  I IPPLP+KQ+ GR+ ++F+E RR+ L+KW+  +  HPVL+ S  + HFL+  D +K W  GKR+ E D    G F+ AVE P  +++       +  + + IDNF K  R +++   N   R +       G    E++KIG +   LS+S ++  D      +L   ++ TG  YD IG++F +Q + D   + D L+  +G++ + P ++++ K  +  V+   +   + K+ +  V+ +      IT    AE+N     R    +  M  +LQ QI  +  ++
Sbjct:    1 MAGQKVRVLYDF------DGDTATGELIVSVDEVLTVTRTDVGEGWWEGITQSGIKGLFPEAYVEVISEPVAPPMPTVPIQTPSAPYQPPPSNDYYDAEDFDDDWDDDTGSSYSGGDPQASTMQRRDTGSSIHRTGTVRKSMNRF-SVFVKSGGEAYVLGTAEESLQVPPEETVRVITRSGEGAASIVWEPSSAPFTCSVTEPEKKSKFKGMKSFISYNVVPTNTMRPVSRRFKHFDWLYNRLVDKYTLIAIPPLPDKQITGRFGEDFVEKRREKLEKWVGRLCQHPVLSKSPVVNHFLTCADSEKEWKAGKRKAENDKFTGGAFFRAVECPPTKLS-------LYAIDSHIDNFGKFVRSMEDSVKNIVDRGTTHCEKCIGSYKTEYKKIGGTFTALSQSFAV-DDITENSQALTKAVEHTGKTYDDIGEMFAEQPRQDFLPLIDGLKEYSGMLSQYPEILQIHKGTIGKVKECIKLKEDEKMEVRIVDTVSSRADTITAVSFAEMNHFHQLRVADFKVMMQSFLQEQIAFHQRVS 522          
BLAST of Sorting nexin vs. Ensembl Nematostella
Match: EDO31460 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXV9])

HSP 1 Score: 130.954 bits (328), Expect = 1.269e-33
Identity = 66/176 (37.50%), Postives = 104/176 (59.09%), Query Frame = 3
Query:  648 ISRRYKQFDWLHSQLSEKYPCIVIPPLPNKQVVGRYEDNFIEGRRKHLQKWLTHVTSHPVLAYSQTMKHFLSVKDKDK-WTNGKREIEKDYHKSGRFYCAVEAPVDEINWNDYSRRIEKVSTFIDNFEKHSRILQEVYNNFHKRQS-------GPICKEFQKIGSSIFNLSRSMSL 1151
            +SRR+K FDWL+++L +KY  I IPPLP+KQ+ GR+ ++F+E RR+ L+KW+  +  HPVL+ S  + HFL+  D +K W  GKR+ E D    G F+ AVE P  +++       +  + + IDNF K  R +++   N   R +       G    E++KIG +   LS+S ++
Sbjct:    4 VSRRFKHFDWLYNRLVDKYTLIAIPPLPDKQITGRFGEDFVEKRREKLEKWVGRLCQHPVLSKSPVVNHFLTCADSEKEWKAGKRKAENDKFTGGAFFRAVECPPTKLS-------LYAIDSHIDNFGKFVRSMEDSVKNIVDRGTTHCEKCIGSYKTEYKKIGGTFTGLSQSFAV 172          
BLAST of Sorting nexin vs. Ensembl Nematostella
Match: EDO40294 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7T4])

HSP 1 Score: 66.2402 bits (160), Expect = 9.860e-12
Identity = 35/115 (30.43%), Postives = 59/115 (51.30%), Query Frame = 3
Query:  510 SKETCVWKPLGDSQFCTIIAH----DKSSKFKGMKT-FITYQLQSSYTKD-------GISRRYKQFDWLHSQLSEKYPCIVIPPLPNKQVVGRYEDNFIEGRRKHLQKWLTHVTS 818
            S   C W     S+      H    D  +  K M+  +  Y++++  + D        + RRY +F WL  +L+E++P   IPPLP K+V+GR++  FI+ R++ L+ WL  + S
Sbjct:   11 SDSACFWSKPTPSRDAPCDMHVTVRDPRTHVKDMRAQYTDYKIETEGSSDIMPLGACTVRRRYSEFTWLRKKLAEEFPNASIPPLPGKRVLGRFDTEFIKNRQQGLEHWLRSLLS 125          
BLAST of Sorting nexin vs. Ensembl Nematostella
Match: EDO46895 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNQ3])

HSP 1 Score: 64.3142 bits (155), Expect = 4.931e-11
Identity = 28/86 (32.56%), Postives = 47/86 (54.65%), Query Frame = 3
Query:  624 QSSYTKDGISRRYKQFDWLHSQLSEKYPCIVIPPLPNKQV----VGRYEDNFIEGRRKHLQKWLTHVTSHPVLAYSQTMKHFLSVK 869
            Q  + +  + RRY+ F WL  ++ E YP  +IPPLP K        R+   F++ R   L K++T +  HPV++++  +  FL+ K
Sbjct:   54 QFDHPEYSVRRRYQDFLWLRQRMQESYPTHIIPPLPEKHSFTKHFDRFSPEFLKARELALNKFMTRIADHPVMSFNDHLHVFLTAK 139          
BLAST of Sorting nexin vs. Ensembl Nematostella
Match: EDO31495 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXR2])

HSP 1 Score: 60.8474 bits (146), Expect = 9.383e-10
Identity = 28/77 (36.36%), Postives = 47/77 (61.04%), Query Frame = 3
Query:  648 ISRRYKQFDWLHSQLSEKYPCIVIPPLPNKQVVGRYEDNFIEGRRKHLQKWLTHVTSHPVLAYSQTMKHFLSVKDKD 878
            +SRRY  F   H  L  ++P  ++P LP K+++G  ++ FIE RR+ L+++LT V  HP+L   + +  F ++K  D
Sbjct:  220 VSRRYNDFVAFHDLLISRFPYRMVPKLPPKKLMGANKE-FIEARRRALKRFLTLVARHPILCNDKIVVLFFTIKGSD 295          
BLAST of Sorting nexin vs. Ensembl Medaka
Match: SNX18 (sorting nexin 18 [Source:NCBI gene;Acc:101166878])

HSP 1 Score: 238.424 bits (607), Expect = 5.131e-70
Identity = 132/387 (34.11%), Postives = 203/387 (52.45%), Query Frame = 3
Query:  417 SFLKNGGEEFLLGLAKLSTTIEAKVEVLVDNSKETCVWKPLGDSQFCTIIAHDKSSKFKGMKTFITYQLQSSYTKDGISRRYKQFDWLHSQLSEKYPCIVIPPLPNKQVVGRYEDNFIEGRRKHLQKWLTHVTSHPVLAYSQTMKHFLSVKDKDK--WTNGKREIEKDYHKSGRFYCAVEAPVDEINWNDYSRRIEKVSTFIDNFEKHSRILQEVYNNFHKRQSGPICKEFQKIGSSIFNLSRSMSLCPDNNSKDISLLHGLQRTGDVYDRIGKLFRKQAQDDGDLVEDNLEAINGVMKEVPALIELAKCAVNTVETSSRKSTECKITLETVEGIDRNVRVITRTVDAELNWLQTEREKQLRSTMVQYLQNQIQLYTNITTILNEAL 1571
            +F+K+GGE F+LG A        K+ V++ N        P   S  C I    K +KFKGMK++I+Y+L  ++T++ ++RRYK FDWL+++L EK+P I +P +P KQ  GR+E++FI  RRK L  W+ H+TSHPVLA     +HFL+    D+  W  GKR+ EKD      F+  +  P   +++ +   +++   TF    +  +  L    + F ++Q     KE+QK+G S   LS++  +  D  +    L H +  TGD Y+ IG+ F +Q   D D + D L    G M   P +I + K A+  V+ S +   E K+     EGI     +I+    AE+      R +  ++ M  YLQ QI  +  IT  L EAL
Sbjct:  179 TFVKSGGEAFVLGEAAGFVKDGDKICVVMGNYGPEWQENPYPFS--CAIDDPTKQTKFKGMKSYISYKLTPTHTQNPVNRRYKHFDWLYARLVEKFPVISVPHIPEKQATGRFEEDFISKRRKGLIWWMNHMTSHPVLARCDVFQHFLTCNSADEKAWKQGKRKAEKDDMVGANFFLTISPPAVPLDFQEVESKVDGFKTFSKRMDDSALQLHATVSEFARKQISGFRKEYQKVGMSFKFLSQAFEM--DQQAYSSGLNHAISFTGDTYEAIGEYFSEQPSKDLDPIMDLLALYQGHMANYPDIIHVQKGALTKVKESQKHVEEGKMDRAQAEGISDRCNIISYATLAEIQHFHQIRVRDFKTQMQHYLQQQIAFFQKITGKLEEAL 561          

HSP 2 Score: 58.9214 bits (141), Expect = 9.754e-9
Identity = 24/57 (42.11%), Postives = 37/57 (64.91%), Query Frame = 3
Query:   45 IEAKVIYDFTPEQPSDLHIESGEIIVIIDQDVGNGWWKARNRRGEEGLIPANYVEII 215
            + A+V+YDFT E P +L ++  E++ +  +    GW +  N RGE GL PA+YVEI+
Sbjct:    3 LRARVLYDFTSENPGELSVKESELLTLHSEQDIEGWLEGANGRGERGLFPASYVEIL 59          
BLAST of Sorting nexin vs. Ensembl Medaka
Match: snx33 (sorting nexin 33 [Source:NCBI gene;Acc:101171161])

HSP 1 Score: 221.09 bits (562), Expect = 1.227e-63
Identity = 124/392 (31.63%), Postives = 203/392 (51.79%), Query Frame = 3
Query:  417 SFLKNGGEEFLLG----LAKLSTTIEAKVEVLVDNSKETCVWKPLGDSQFCTIIAHDKSSKFKGMKTFITYQLQSSYTKDGISRRYKQFDWLHSQLSEKYPCIVIPPLPNKQVVGRYEDNFIEGRRKHLQKWLTHVTSHPVLAYSQTMKHFLSVKDKDKWTNGKREIEKDYHKSGRFYCAVEAPVDEINWNDYSRRIEKVSTFIDNFEKHSRILQEVYNNFHKRQSGPICKEFQKIGSSIFNLSRSMSLCPDNNSKDISLLHGLQRTGDVYDRIGKLFRKQAQDDGDLVEDNLEAINGVMKEVPALIELAKCAVNTVETSSRKSTECKITLETVEGIDRNVRVITRTVDAELNWLQTEREKQLRSTMVQYLQNQIQLYTNITTILNEALSYF 1580
            SF+++G E F+LG    +AK++ +   ++  L         WK   +   C+I    K +KFKG+KT+I+Y++  S+T   + RRYK FDWL+++L  K+  I +P LP KQ  GR+E++FIE R++ L  W+ H+TSHPVL+  +  +HFL   D  +W  GKR  EKD      F   ++ P +  +  D   R++   TF    +     L  V +   ++  G   KEFQ++G++  ++S++  L P + S  ++  + +  TG  Y+ IG+LF +Q + D   + D L    G++   P +I L K A   V+ S R S E K+     +GI +  R +   + AE++     RE   +  M  YL+ QI  Y  +   L   L  +
Sbjct:  171 SFVRSGVEAFVLGDVPMMAKIAESYTIEMGPLGPK------WKENPNPFICSIEDPTKQTKFKGIKTYISYRVTPSHTGRPVYRRYKHFDWLYNRLLNKFTVISVPHLPEKQATGRFEEDFIEKRKRRLILWMNHMTSHPVLSQYEGFEHFLMCADDKQWKLGKRRAEKDEMVGAHFMLTLQIPNEHQDLQDVEERVDNFKTFAKKMDDSVMQLTNVASELVRKHLGGFRKEFQRLGNAFQSISQAFMLDPPHRSDGLN--NAISHTGRTYENIGELFAEQPKYDLFQMLDKLSLYQGLLANFPDIIHLQKGAFAKVKESQRMSDEGKMDQGEADGIRKRCRTVGFALQAEMSHFHERREVDFKDMMQAYLKEQIAFYQRVVQQLERTLRMY 554          

HSP 2 Score: 50.447 bits (119), Expect = 5.473e-6
Identity = 20/57 (35.09%), Postives = 33/57 (57.89%), Query Frame = 3
Query:   45 IEAKVIYDFTPEQPSDLHIESGEIIVIIDQDVGNGWWKARNRRGEEGLIPANYVEII 215
            ++A  +Y F  E   ++ I+  E + I D++  +GW+   N RGE GL P  YVE++
Sbjct:    3 VKAVALYTFLSENKEEISIQENEELTIFDENSLDGWYLGENSRGERGLFPKTYVEVV 59          
BLAST of Sorting nexin vs. Ensembl Medaka
Match: snx18b (sorting nexin-18 [Source:NCBI gene;Acc:101159837])

HSP 1 Score: 217.238 bits (552), Expect = 2.782e-62
Identity = 121/386 (31.35%), Postives = 196/386 (50.78%), Query Frame = 3
Query:  417 SFLKNGGEEFLLGLAKLSTTIEAKVEVLVDNSKETCVWKPLGDSQFCTIIAHDKSSKFKGMKTFITYQLQSSYTKDGISRRYKQFDWLHSQLSEKYPCIVIPPLPNKQVVGRYEDNFIEGRRKHLQKWLTHVTSHPVLAYSQTMKHFLSV-KDKDKWTNGKREIEKDYHKSGRFYCAVEAPVDEINWNDYSRRIEKVSTFIDNFEKHSRILQEVYNNFHKRQSGPICKEFQKIGSSIFNLSRSMSLCPDNNSKDISLLHGLQRTGDVYDRIGKLFRKQAQDDGDLVEDNLEAINGVMKEVPALIELAKCAVNTVETSSRKSTECKITLETVEGIDRNVRVITRTVDAELNWLQTEREKQLRSTMVQYLQNQIQLYTNITTILNEAL 1571
            +F+K+GGE FLLG A        K+ V+V   K    W+       CTI    + +KFKGMK++++Y L  ++T   ++RRYK FDWL+ +L E++P I +P LP KQ  GR+E++F+  RRK L  W+ H+TSHPVLA+    +HFL+   D+  W  GKR+ EKD      F+  +  P   ++  +   +I+    F    +++  ++    N F ++Q+    KE+ K+G S   LS++  L  D     + L   +  TG+ Y++IG  F +Q   D D + D L+   G +   P ++ + K A+  V+   ++            G+     +I+    AE+      R +  RS M  +L+ QI  +  IT  L  AL
Sbjct:  168 TFVKSGGEAFLLGEASAFVKDGDKICVVV--GKYGPEWQEDPYPFTCTIDDPTRQTKFKGMKSYMSYGLTPTHTNTQVNRRYKHFDWLYGRLVERFPVISVPHLPEKQATGRFEEDFLSKRRKGLMWWMNHMTSHPVLAHCNVFQHFLTCSPDEKAWKMGKRKAEKDDLVGANFFLTISPPAVPLDLQEVENKIDNFKMFTKKLDENIVVMNATINEFARKQTTGFQKEYHKVGQSFKLLSQAFEL--DQQIFSLGLNRAIAYTGEAYEKIGDYFAEQPHQDLDHISDLLDLYRGHLANFPDILHVQKGALTKVKECPKQEG----------GLQERCNIISCATMAEIQHFHRTRVRDFRSQMQHHLRQQISFFQKITAKLENAL 539          
BLAST of Sorting nexin vs. Ensembl Medaka
Match: snx9b (sorting nexin 9 [Source:NCBI gene;Acc:101165023])

HSP 1 Score: 184.111 bits (466), Expect = 3.078e-50
Identity = 115/401 (28.68%), Postives = 199/401 (49.63%), Query Frame = 3
Query:  384 SSKVNTIRMPKSFLKNGGEEFLLGLAKLSTTIEAKVEVLVDNSKETCVWKPLGDSQF-CTIIAHDKSSKFKGMKTFITYQLQSSYTKDGISRRYKQFDWLHSQLSEKY-PCIVIPPLPNKQVVGRYEDNFIEGRRKHLQKWLTHVTSHPVLAYSQTMKHFLSVKDKDKWTNGKREIEKDYHKSGRFYCAVEAPVDEINWNDYSRRIEKVSTFIDNFEKHSRILQEVYNNFHKRQSGPICKEFQKIGSSIFNLSRSMSLCPDNNSKDISLLHGLQRTGDVYDRIGKLFRKQAQDDGDLVEDNLEAINGVMKEVPALIELAKCAVNTVETSSRKSTECKITLETVEGIDRNVRVITRTVDAELNWLQTEREKQLRSTMVQYLQNQIQLYTNITTILNEALSYF 1580
            S K++  + P  F K+G E FLL   K +   + K+ + +        +    ++Q  C +    K SK  G+K++I YQ+  + T   ++ RYK FDWL+ +L +K+   I IP LP+KQV GR+E+ FI+ R + LQ W+T +  HPV++ S+  + FLS KD+  W  GKR+ EKD       +  +EA   +++  +  ++ E+ S F    +   + +  V N   KR +GP+ KE+Q+IG +  NLS   +        + +L   +   G  Y+ I ++  +Q + D   + +      G++   P  I + K A++ V+ + +     KIT +    + +    ++  + AE+N   + R       M QYL+ Q++ Y  I   L  A S F
Sbjct:  160 SMKISLNKFP-GFSKSGPELFLL--CKQAAKGKEKISIYLGEVGPVWFYP---EAQLDCIVADPKKGSKMYGLKSYIEYQITPNTTNRPVNHRYKHFDWLYERLLDKFGSAIPIPSLPDKQVTGRFEEEFIKMRMERLQGWMTRMCRHPVVSSSEVFQLFLSYKDEKDWKMGKRKAEKDETVGVMIFTTIEAEAPDLDLAEVEQKCEQFSRFTKAMDDGVKEILTVGNEHWKRCTGPLPKEYQRIGKAFQNLSSVFT--SSGYQGEATLTDAMTAAGKTYEEIAQIVAEQPKKDLHFLMETNNEYKGLLGCFPDTIGVHKAAIDKVKEADKLVNTNKITAQDKVTMAKRASTMSYALQAEMNHFHSNRIYDYNRVMQQYLEEQVKFYETIAAKLRHAHSQF 552          

HSP 2 Score: 53.9138 bits (128), Expect = 4.280e-7
Identity = 22/54 (40.74%), Postives = 38/54 (70.37%), Query Frame = 3
Query:   60 IYDFTPEQPS-DLHIESGEIIVIIDQDVGNGWWKARNRRGEEGLIPANYVEIIS 218
            +YDFT E  + +L ++ GE I + + ++G GW +A+N RGE GL+P +Y+E ++
Sbjct:    1 LYDFTAEPGNVELTVKEGETITVTNANIGGGWIEAQNSRGETGLVPEDYIEHLT 54          
BLAST of Sorting nexin vs. Ensembl Medaka
Match: snx9b (sorting nexin 9 [Source:NCBI gene;Acc:101165023])

HSP 1 Score: 183.726 bits (465), Expect = 8.574e-50
Identity = 116/400 (29.00%), Postives = 198/400 (49.50%), Query Frame = 3
Query:  384 SSKVNTIRMPKSFLKNGGEEFLLGLAKLSTTIEAKVEVLVDNSKETCVWKPLGDSQFCTIIAHDKSSKFKGMKTFITYQLQSSYTKDGISRRYKQFDWLHSQLSEKY-PCIVIPPLPNKQVVGRYEDNFIEGRRKHLQKWLTHVTSHPVLAYSQTMKHFLSVKDKDKWTNGKREIEKDYHKSGRFYCAVEAPVDEINWNDYSRRIEKVSTFIDNFEKHSRILQEVYNNFHKRQSGPICKEFQKIGSSIFNLSRSMSLCPDNNSKDISLLHGLQRTGDVYDRIGKLFRKQAQDDGDLVEDNLEAINGVMKEVPALIELAKCAVNTVETSSRKSTECKITLETVEGIDRNVRVITRTVDAELNWLQTEREKQLRSTMVQYLQNQIQLYTNITTILNEALSYF 1580
            S K++  + P  F K+G E FLL   K +   + K+ + +   +   VW        C +    K SK  G+K++I YQ+  + T   ++ RYK FDWL+ +L +K+   I IP LP+KQV GR+E+ FI+ R + LQ W+T +  HPV++ S+  + FLS KD+  W  GKR+ EKD       +  +EA   +++  +  ++ E+ S F    +   + +  V N   KR +GP+ KE+Q+IG +  NLS   +        + +L   +   G  Y+ I ++  +Q + D   + +      G++   P  I + K A++ V+ + +     KIT +    + +    ++  + AE+N   + R       M QYL+ Q++ Y  I   L  A S F
Sbjct:  202 SMKISLNKFP-GFSKSGPELFLL--CKQAAKGKEKISIYL--GEVGPVWFYPEAQLDCIVADPKKGSKMYGLKSYIEYQITPNTTNRPVNHRYKHFDWLYERLLDKFGSAIPIPSLPDKQVTGRFEEEFIKMRMERLQGWMTRMCRHPVVSSSEVFQLFLSYKDEKDWKMGKRKAEKDETVGVMIFTTIEAEAPDLDLAEVEQKCEQFSRFTKAMDDGVKEILTVGNEHWKRCTGPLPKEYQRIGKAFQNLSSVFTSS--GYQGEATLTDAMTAAGKTYEEIAQIVAEQPKKDLHFLMETNNEYKGLLGCFPDTIGVHKAAIDKVKEADKLVNTNKITAQDKVTMAKRASTMSYALQAEMNHFHSNRIYDYNRVMQQYLEEQVKFYETIAAKLRHAHSQF 594          

HSP 2 Score: 57.7658 bits (138), Expect = 2.676e-8
Identity = 24/56 (42.86%), Postives = 40/56 (71.43%), Query Frame = 3
Query:   45 IEAKVIYDFTPEQPS-DLHIESGEIIVIIDQDVGNGWWKARNRRGEEGLIPANYVE 209
             +A+V+YDFT E  + +L ++ GE I + + ++G GW +A+N RGE GL+P +Y+E
Sbjct:    3 FKAQVLYDFTAEPGNVELTVKEGETITVTNANIGGGWIEAQNSRGETGLVPEDYIE 58          
BLAST of Sorting nexin vs. Planmine SMEST
Match: SMESG000005937.1 (SMESG000005937.1)

HSP 1 Score: 875.544 bits (2261), Expect = 0.000e+0
Identity = 420/420 (100.00%), Postives = 420/420 (100.00%), Query Frame = 3
Query:  321 ASDMASNKERFSQRTSQIVTESSKVNTIRMPKSFLKNGGEEFLLGLAKLSTTIEAKVEVLVDNSKETCVWKPLGDSQFCTIIAHDKSSKFKGMKTFITYQLQSSYTKDGISRRYKQFDWLHSQLSEKYPCIVIPPLPNKQVVGRYEDNFIEGRRKHLQKWLTHVTSHPVLAYSQTMKHFLSVKDKDKWTNGKREIEKDYHKSGRFYCAVEAPVDEINWNDYSRRIEKVSTFIDNFEKHSRILQEVYNNFHKRQSGPICKEFQKIGSSIFNLSRSMSLCPDNNSKDISLLHGLQRTGDVYDRIGKLFRKQAQDDGDLVEDNLEAINGVMKEVPALIELAKCAVNTVETSSRKSTECKITLETVEGIDRNVRVITRTVDAELNWLQTEREKQLRSTMVQYLQNQIQLYTNITTILNEALSYF 1580
            ASDMASNKERFSQRTSQIVTESSKVNTIRMPKSFLKNGGEEFLLGLAKLSTTIEAKVEVLVDNSKETCVWKPLGDSQFCTIIAHDKSSKFKGMKTFITYQLQSSYTKDGISRRYKQFDWLHSQLSEKYPCIVIPPLPNKQVVGRYEDNFIEGRRKHLQKWLTHVTSHPVLAYSQTMKHFLSVKDKDKWTNGKREIEKDYHKSGRFYCAVEAPVDEINWNDYSRRIEKVSTFIDNFEKHSRILQEVYNNFHKRQSGPICKEFQKIGSSIFNLSRSMSLCPDNNSKDISLLHGLQRTGDVYDRIGKLFRKQAQDDGDLVEDNLEAINGVMKEVPALIELAKCAVNTVETSSRKSTECKITLETVEGIDRNVRVITRTVDAELNWLQTEREKQLRSTMVQYLQNQIQLYTNITTILNEALSYF
Sbjct:   19 ASDMASNKERFSQRTSQIVTESSKVNTIRMPKSFLKNGGEEFLLGLAKLSTTIEAKVEVLVDNSKETCVWKPLGDSQFCTIIAHDKSSKFKGMKTFITYQLQSSYTKDGISRRYKQFDWLHSQLSEKYPCIVIPPLPNKQVVGRYEDNFIEGRRKHLQKWLTHVTSHPVLAYSQTMKHFLSVKDKDKWTNGKREIEKDYHKSGRFYCAVEAPVDEINWNDYSRRIEKVSTFIDNFEKHSRILQEVYNNFHKRQSGPICKEFQKIGSSIFNLSRSMSLCPDNNSKDISLLHGLQRTGDVYDRIGKLFRKQAQDDGDLVEDNLEAINGVMKEVPALIELAKCAVNTVETSSRKSTECKITLETVEGIDRNVRVITRTVDAELNWLQTEREKQLRSTMVQYLQNQIQLYTNITTILNEALSYF 438          
BLAST of Sorting nexin vs. Planmine SMEST
Match: SMESG000005938.1 (SMESG000005938.1)

HSP 1 Score: 288.115 bits (736), Expect = 3.234e-92
Identity = 140/308 (45.45%), Postives = 203/308 (65.91%), Query Frame = 3
Query:  657 RYKQFDWLHSQLSEKYPCIVIPPLPNKQVVGRYEDNFIEGRRKHLQKWLTHVTSHPVLAYSQTMKHFLSVKDKDKWTNGKREIEKDYHKSGRFYCAVEAPVDEINWNDYSRRIEKVSTFIDNFEKHSRILQEVYNNFHKRQSGPICKEFQKIGSSIFNLSRSMSLCPDNNSKDISLLHGLQRTGDVYDRIGKLFRKQAQDDGDLVEDNLEAINGVMKEVPALIELAKCAVNTVETSSRKSTECKITLETVEGIDRNVRVITRTVDAELNWLQTEREKQLRSTMVQYLQNQIQLYTNITTILNEALSYF 1580
            RY QFDWL++Q +EKYPCIV+PPLP +QV GR++  FIE R+  LQ WL H+T HPVL+ S  +K F S  DK KW   K +++ D  K+G FY AV+AP D ++    S  + KV+ FID++ K+S  L + +  FHK Q+  + KE+ KI     +++ S++  PD N     L  GL + G+ Y  IG LF  QA+ D   VE NL  +NG+ KE+P+++EL+  A+NT+ +    S+E K+  ET++ +DR V+++TRTVDAEL+WLQ  R+ Q+RS M Q+L+NQI+L+T IT IL++ L  F
Sbjct:    3 RYNQFDWLYNQFAEKYPCIVVPPLPGRQVAGRFKSEFIESRKVLLQHWLNHITEHPVLSNSYAIKMFFSESDKKKWKIAKLKVKNDVFKNGGFYNAVKAPTDILDIPKISEHLNKVALFIDDYYKNSCCLSDGFRRFHKYQNEGMLKEYSKISKRFLDITESLAKNPDQNQDGQDLTQGLNKIGNAYQEIGVLFESQAKIDSSFVEPNLGEMNGITKEIPSILELSNGALNTLNSCINMSSESKLDEETIKNVDRGVQLVTRTVDAELSWLQNRRQHQMRSVMCQHLKNQIELFTQITAILSDTLKNF 310          
BLAST of Sorting nexin vs. Planmine SMEST
Match: SMESG000075553.1 (SMESG000075553.1)

HSP 1 Score: 74.7146 bits (182), Expect = 4.458e-14
Identity = 37/104 (35.58%), Postives = 62/104 (59.62%), Query Frame = 3
Query:  570 HDKSSKFKGMKTFITYQLQSS--YTKDGISRRYKQFDWLHSQLSEKYPCIVIPPLPNKQ---VVGRYEDNFIEGRRKHLQKWLTHVTSHPVLAYSQTMKHFLSV 866
            + K+S F  ++TFI Y +Q++  +    + RRY  F WL  +LS++YP  ++PPLP+K     + R+   FIE RR  L+K+L  +T H +L+  +    FL++
Sbjct:   47 YKKASSF--LETFIVYTIQTTGNFRPYSVERRYNDFQWLFQRLSDRYPMAIVPPLPDKHNLTAIERFSGIFIELRRNALEKFLQRLTDHKILSLDKEFWAFLTL 148          
BLAST of Sorting nexin vs. Planmine SMEST
Match: SMESG000016684.1 (SMESG000016684.1)

HSP 1 Score: 55.8398 bits (133), Expect = 6.734e-8
Identity = 30/80 (37.50%), Postives = 45/80 (56.25%), Query Frame = 3
Query:  645 GISRRYKQFDWLHSQLSEKYPCIVIPPLPNK-------QVVGRYED-NFIEGRRKHLQKWLTHVTSHPVLAYSQTMKHFL 860
             + RRY +FD L + L++ YP  VIPPLP+K        V  +  D +FI+ RR+ L+ +L  + SHP L     + +FL
Sbjct:   82 SVLRRYSEFDSLRASLTKLYPACVIPPLPSKINSLNPWNVAHQKRDSDFIDSRRQRLEMFLNRILSHPKLKTEILIFNFL 161          
BLAST of Sorting nexin vs. Planmine SMEST
Match: SMESG000016192.1 (SMESG000016192.1)

HSP 1 Score: 50.447 bits (119), Expect = 3.296e-6
Identity = 32/109 (29.36%), Postives = 47/109 (43.12%), Query Frame = 3
Query:  594 GMKTFITYQLQSSYTKDG-------ISRRYKQFDWLHSQLSEKY---PCIVIPPLPNKQVVGRY------EDN----FIEGRRKHLQKWLTHVTSHPVLAYSQTMKHFL 860
            GM  +  Y++ +   +         + RR+  F  LH +L  KY    CI IPP P K   G        ED     F+E RR  L+++L  +  HP+L      + FL
Sbjct:   76 GMAAYFIYKINTKTNRPSFLHQEITVRRRFSDFLGLHERLKLKYLFAGCI-IPPAPEKNAFGNTKLKLSKEDQTNSEFLERRRAALERYLQRIARHPLLVIDADFREFL 183          
The following BLAST results are available for this feature:
BLAST of Sorting nexin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SNX188.050e-6834.60sorting nexin 18 [Source:HGNC Symbol;Acc:HGNC:1924... [more]
SNX338.442e-6431.71sorting nexin 33 [Source:HGNC Symbol;Acc:HGNC:2846... [more]
SNX181.205e-5432.99sorting nexin 18 [Source:HGNC Symbol;Acc:HGNC:1924... [more]
SNX182.086e-5435.38sorting nexin 18 [Source:HGNC Symbol;Acc:HGNC:1924... [more]
SNX97.933e-5329.67sorting nexin 9 [Source:HGNC Symbol;Acc:HGNC:14973... [more]
back to top
BLAST of Sorting nexin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lst-49.194e-7234.61Sorting nexin lst-4 [Source:UniProtKB/Swiss-Prot;... [more]
lst-46.337e-7134.43Sorting nexin lst-4 [Source:UniProtKB/Swiss-Prot;... [more]
lst-41.714e-7034.43Sorting nexin lst-4 [Source:UniProtKB/Swiss-Prot;... [more]
lst-44.929e-7034.43Sorting nexin lst-4 [Source:UniProtKB/Swiss-Prot;... [more]
lst-48.176e-6835.17Sorting nexin lst-4 [Source:UniProtKB/Swiss-Prot;... [more]
back to top
BLAST of Sorting nexin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SH3PX11.336e-5529.02gene:FBgn0040475 transcript:FBtr0076413[more]
Snx39.018e-835.00gene:FBgn0038065 transcript:FBtr0082641[more]
Snx39.018e-835.00gene:FBgn0038065 transcript:FBtr0082642[more]
nwk3.457e-740.38gene:FBgn0263456 transcript:FBtr0309280[more]
nwk3.462e-740.38gene:FBgn0263456 transcript:FBtr0309277[more]
back to top
BLAST of Sorting nexin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
snx18a8.074e-6933.09sorting nexin 18a [Source:ZFIN;Acc:ZDB-GENE-070705... [more]
snx18a8.074e-6933.09sorting nexin 18a [Source:ZFIN;Acc:ZDB-GENE-070705... [more]
snx332.036e-6331.96sorting nexin 33 [Source:ZFIN;Acc:ZDB-GENE-041111-... [more]
snx18b6.536e-6132.32sorting nexin 18b [Source:ZFIN;Acc:ZDB-GENE-080213... [more]
snx18b6.149e-6032.06sorting nexin 18b [Source:ZFIN;Acc:ZDB-GENE-080213... [more]
back to top
BLAST of Sorting nexin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
snx182.890e-6331.27sorting nexin 18 [Source:NCBI gene;Acc:496591][more]
csrp27.672e-6330.08cysteine and glycine rich protein 2 [Source:Xenbas... [more]
snx93.085e-6127.84sorting nexin 9 [Source:NCBI gene;Acc:100145698][more]
snx96.043e-5827.34sorting nexin 9 [Source:NCBI gene;Acc:100145698][more]
snx91.375e-5129.75sorting nexin 9 [Source:NCBI gene;Acc:100145698][more]
back to top
BLAST of Sorting nexin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Snx184.954e-6834.60sorting nexin 18 [Source:MGI Symbol;Acc:MGI:213764... [more]
Snx332.235e-6431.81sorting nexin 33 [Source:MGI Symbol;Acc:MGI:244323... [more]
Snx95.946e-5029.48sorting nexin 9 [Source:MGI Symbol;Acc:MGI:1913866... [more]
Snx302.571e-1824.58sorting nexin family member 30 [Source:MGI Symbol;... [more]
Snx72.163e-1630.35sorting nexin 7 [Source:MGI Symbol;Acc:MGI:1923811... [more]
back to top
BLAST of Sorting nexin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8I4E2|LST4_CAEEL2.180e-6934.43Sorting nexin lst-4 OS=Caenorhabditis elegans OX=6... [more]
sp|Q91ZR2|SNX18_MOUSE8.083e-6435.57Sorting nexin-18 OS=Mus musculus OX=10090 GN=Snx18... [more]
sp|Q4VAA7|SNX33_MOUSE1.563e-6331.81Sorting nexin-33 OS=Mus musculus OX=10090 GN=Snx33... [more]
sp|Q8WV41|SNX33_HUMAN4.054e-6331.71Sorting nexin-33 OS=Homo sapiens OX=9606 GN=SNX33 ... [more]
sp|Q28GP7|SNX33_XENTR4.064e-6230.08Sorting nexin-33 OS=Xenopus tropicalis OX=8364 GN=... [more]
back to top
BLAST of Sorting nexin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4E0R7W22.979e-8933.33Sorting nexin 9 variant OS=Fasciola hepatica OX=61... [more]
A0A075AC922.159e-8332.77Uncharacterized protein OS=Opisthorchis viverrini ... [more]
C1LG692.451e-8333.77Sorting nexin-18 OS=Schistosoma japonicum OX=6182 ... [more]
A0A4Z2D6X63.739e-8333.77Sorting nexin-33 isoform 1 OS=Schistosoma japonicu... [more]
A0A4Y2JWP31.187e-8231.71Sorting nexin lst-4 OS=Araneus ventricosus OX=1828... [more]
back to top
BLAST of Sorting nexin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
snx18a1.793e-6733.59sorting nexin 18 [Source:NCBI gene;Acc:103026104][more]
snx331.541e-6331.70sorting nexin 33 [Source:NCBI gene;Acc:103035633][more]
snx18b8.661e-6130.59sorting nexin-18-like [Source:NCBI gene;Acc:103036... [more]
snx9a4.014e-5130.88sorting nexin-9-like [Source:NCBI gene;Acc:1030231... [more]
snx9b1.056e-4730.23sorting nexin-9 [Source:NCBI gene;Acc:103024560][more]
back to top
BLAST of Sorting nexin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
snx18b4.645e-6031.96sorting nexin 18b [Source:ZFIN;Acc:ZDB-GENE-080213... [more]
ENSPMAT00000001438.11.049e-2436.81pep scaffold:Pmarinus_7.0:GL485280:2234:11313:-1 g... [more]
snx307.226e-1739.42sorting nexin family member 30 [Source:NCBI gene;A... [more]
snx34.887e-932.26sorting nexin 3 [Source:ZFIN;Acc:ZDB-GENE-030131-9... [more]
snx1a2.357e-722.63sorting nexin 1a [Source:ZFIN;Acc:ZDB-GENE-060302-... [more]
back to top
BLAST of Sorting nexin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
VPS53.422e-1241.33Nexin-1 homolog; required for localizing membrane ... [more]
YSC846.788e-843.64Actin-binding protein; involved in bundling of act... [more]
SNX41.792e-724.57Sorting nexin; involved in retrieval of late-Golgi... [more]
PEX134.196e-738.33Peroxisomal importomer complex component; integral... [more]
MVP14.605e-731.52Protein required for sorting proteins to the vacuo... [more]
back to top
BLAST of Sorting nexin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO498272.771e-7330.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO314601.269e-3337.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO402949.860e-1230.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO468954.931e-1132.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO314959.383e-1036.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Sorting nexin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SNX185.131e-7034.11sorting nexin 18 [Source:NCBI gene;Acc:101166878][more]
snx331.227e-6331.63sorting nexin 33 [Source:NCBI gene;Acc:101171161][more]
snx18b2.782e-6231.35sorting nexin-18 [Source:NCBI gene;Acc:101159837][more]
snx9b3.078e-5028.68sorting nexin 9 [Source:NCBI gene;Acc:101165023][more]
snx9b8.574e-5029.00sorting nexin 9 [Source:NCBI gene;Acc:101165023][more]
back to top
BLAST of Sorting nexin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000005937.10.000e+0100.00SMESG000005937.1[more]
SMESG000005938.13.234e-9245.45SMESG000005938.1[more]
SMESG000075553.14.458e-1435.58SMESG000075553.1[more]
SMESG000016684.16.734e-837.50SMESG000016684.1[more]
SMESG000016192.13.296e-629.36SMESG000016192.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011933 ID=SMED30011933|Name=Sorting nexin|organism=Schmidtea mediterranea sexual|type=transcript|length=1942bp
TGTAATCTTAGCAATTAATTTCCAGTTATATTTAAATGTCTCAAATAGAA
GCTAAAGTTATTTATGATTTTACACCTGAACAGCCCAGTGATCTTCACAT
TGAATCAGGTGAGATAATTGTTATTATAGATCAAGATGTAGGAAATGGGT
GGTGGAAAGCCAGAAATAGAAGAGGCGAAGAAGGATTAATTCCAGCAAAT
TATGTAGAAATCATTAGCTGCCCTGAGCCAACTTGTCCACCACCAAGACC
TCCCACTTACATTGACATGAAAGAATTTGAAGATAGTGATTGGGATGACA
GCGAAAAGGATGATAATGAAGCTTCCGATATGGCATCAAATAAAGAGCGA
TTTTCACAAAGAACTTCTCAAATCGTAACAGAATCAAGTAAAGTTAATAC
AATCAGGATGCCAAAATCATTTTTAAAAAATGGTGGCGAAGAATTTCTTC
TTGGTTTAGCTAAACTTTCAACAACGATTGAAGCCAAAGTTGAAGTTCTG
GTTGACAATTCTAAAGAAACATGTGTATGGAAACCACTTGGAGATTCTCA
ATTTTGTACAATTATAGCTCATGATAAAAGTTCAAAATTTAAAGGAATGA
AAACTTTCATCACTTATCAATTGCAGTCTTCGTATACTAAAGATGGAATT
AGCCGCCGATATAAGCAATTTGATTGGCTCCATTCACAACTCTCAGAAAA
ATATCCGTGCATTGTTATTCCACCATTGCCTAACAAGCAAGTTGTCGGCA
GATATGAAGATAACTTTATTGAAGGTCGGCGGAAACATTTACAGAAATGG
TTGACACATGTGACCTCGCATCCGGTTTTAGCTTATAGCCAAACAATGAA
ACATTTTCTTTCCGTTAAAGATAAGGATAAATGGACCAATGGAAAAAGAG
AAATTGAGAAAGATTATCACAAAAGTGGGCGGTTTTATTGTGCTGTTGAA
GCACCAGTCGATGAAATAAATTGGAATGATTATTCTAGAAGAATAGAAAA
AGTTTCAACTTTTATTGATAATTTTGAGAAGCACTCTAGAATATTACAAG
AAGTTTATAATAATTTCCATAAACGACAAAGTGGACCAATATGCAAGGAA
TTTCAGAAGATCGGATCATCTATTTTTAATTTATCCAGATCAATGAGTCT
ATGTCCAGATAACAACAGTAAAGATATAAGTCTTCTCCATGGTTTACAAA
GAACAGGAGACGTATACGATAGAATCGGAAAATTATTCAGAAAACAAGCT
CAAGACGACGGAGATCTAGTTGAAGACAATTTAGAAGCCATAAATGGTGT
GATGAAAGAAGTGCCTGCATTGATCGAGTTAGCTAAATGTGCGGTAAACA
CAGTAGAAACCAGTTCAAGGAAAAGTACTGAATGTAAAATTACTTTGGAA
ACTGTTGAAGGGATTGATCGAAACGTAAGAGTTATTACAAGAACTGTCGA
TGCTGAATTGAATTGGTTGCAAACGGAACGAGAAAAGCAATTGCGCTCTA
CAATGGTCCAGTATTTGCAAAATCAAATTCAGCTTTATACAAATATTACA
ACTATTTTAAATGAAGCTCTTTCATATTTCTGACATGCCTGAAAACCACA
ATCTTTTGTTAATTTTGATTTAATTTTTATTATTTAACCTAATTGACCAG
ATATTTTTTATGATTTTGTACTTTGGCCGCCATTCACCTTTTGGTAAGGC
AACTCATTTTCGATTGACTTTATTATTGTTATTAGAAACTTTGTATTGAA
TTAAATAATCTGATATATAGAAGAACTGTTCGATGATTTTGTTAAATTTT
TGTCTGTTTTCCACAATTGAAAATAGTAGAAAATGTTAGATTTTTTTATA
CGCGAAAGTCGTAAACAATTTTCTCTCTTGCTTTCATTCTGAATAGCTGT
ATTAATTTTTGTATATTTGTTGTAGGTCTTATTATATTTCAG
back to top

protein sequence of SMED30011933-orf-1

>SMED30011933-orf-1 ID=SMED30011933-orf-1|Name=SMED30011933-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=516bp
MSQIEAKVIYDFTPEQPSDLHIESGEIIVIIDQDVGNGWWKARNRRGEEG
LIPANYVEIISCPEPTCPPPRPPTYIDMKEFEDSDWDDSEKDDNEASDMA
SNKERFSQRTSQIVTESSKVNTIRMPKSFLKNGGEEFLLGLAKLSTTIEA
KVEVLVDNSKETCVWKPLGDSQFCTIIAHDKSSKFKGMKTFITYQLQSSY
TKDGISRRYKQFDWLHSQLSEKYPCIVIPPLPNKQVVGRYEDNFIEGRRK
HLQKWLTHVTSHPVLAYSQTMKHFLSVKDKDKWTNGKREIEKDYHKSGRF
YCAVEAPVDEINWNDYSRRIEKVSTFIDNFEKHSRILQEVYNNFHKRQSG
PICKEFQKIGSSIFNLSRSMSLCPDNNSKDISLLHGLQRTGDVYDRIGKL
FRKQAQDDGDLVEDNLEAINGVMKEVPALIELAKCAVNTVETSSRKSTEC
KITLETVEGIDRNVRVITRTVDAELNWLQTEREKQLRSTMVQYLQNQIQL
YTNITTILNEALSYF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0000278mitotic cell cycle
GO:0015031protein transport
GO:0000281mitotic cytokinesis
GO:0006886intracellular protein transport
GO:0006897endocytosis
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR027267AH/BAR_dom_sf
IPR036871PX_dom_sf
IPR036028SH3-like_dom_sf
IPR001452SH3_domain
IPR001683Phox
IPR019497Sorting_nexin_WASP-bd-dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0035091phosphatidylinositol binding
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001452SH3 domainPRINTSPR00452SH3DOMAINcoord: 18..33
score: 25.83
coord: 48..60
score: 44.33
coord: 4..14
score: 23.38
coord: 36..45
score: 30.51
IPR001452SH3 domainSMARTSM00326SH3_2coord: 4..61
e-value: 1.3E-18
score: 77.9
IPR001452SH3 domainPFAMPF00018SH3_1coord: 7..54
e-value: 4.6E-14
score: 51.8
IPR001452SH3 domainPROSITEPS50002SH3coord: 1..62
score: 26.777
IPR001683Phox homologous domainSMARTSM00312PX_2coord: 169..278
e-value: 1.1E-24
score: 98.0
IPR001683Phox homologous domainPFAMPF00787PXcoord: 181..277
e-value: 1.2E-22
score: 80.0
IPR001683Phox homologous domainPROSITEPS50195PXcoord: 172..282
score: 18.139
IPR019497Sorting nexin protein, WASP-binding domainPFAMPF10456BAR_3_WASP_bdgcoord: 279..514
e-value: 2.3E-44
score: 151.7
IPR027267AH/BAR domain superfamilyGENE3DG3DSA:1.20.1270.60coord: 326..515
e-value: 8.1E-41
score: 141.6
NoneNo IPR availableGENE3DG3DSA:2.30.30.40coord: 1..66
e-value: 8.3E-21
score: 75.3
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 83..111
NoneNo IPR availablePANTHERPTHR45827FAMILY NOT NAMEDcoord: 5..71
coord: 85..513
IPR036871PX domain superfamilyGENE3DG3DSA:3.30.1520.10coord: 151..284
e-value: 8.2E-37
score: 127.9
IPR036871PX domain superfamilySUPERFAMILYSSF64268PX domaincoord: 169..283
IPR036028SH3-like domain superfamilySUPERFAMILYSSF50044SH3-domaincoord: 5..74