Tubulin-specific chaperone cofactor E-like protein

Overview
NameTubulin-specific chaperone cofactor E-like protein
Smed IDSMED30011922
Length (bp)1513
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tubulin-specific chaperone cofactor E-like protein (SMED30011922) t-SNE clustered cells

Violin plots show distribution of expression levels for Tubulin-specific chaperone cofactor E-like protein (SMED30011922) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tubulin-specific chaperone cofactor E-like protein (SMED30011922) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tubulin-specific chaperone cofactor E-like protein (SMED30011922) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011922

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30011922SMESG000068159.1 PL08001B1C02ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
nervous systemSMED30011922SMESG000068159.1 dd_Smed_v4_5186_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tubulin-specific chaperone cofactor E-like protein vs. Ensembl Human
Match: TBCEL (tubulin folding cofactor E like [Source:HGNC Symbol;Acc:HGNC:28115])

HSP 1 Score: 114.775 bits (286), Expect = 4.119e-27
Identity = 118/393 (30.03%), Postives = 199/393 (50.64%), Query Frame = 3
Query:  204 RRRLPSSLSLDGKEIELIDFDDSSLEMVEAVKSLHLNNNLINSWEYVINLLNNIPGLEXXXXXXXXXXQFQDSFVKLMPDIVYPKLKVLILNETGVPWEMVLSLLPRLPSLETLHLSKNIQPLSKEIAINSSPFPSVTQLFYNYNCCSDLQEICLMGDLFPCXXXXXXXXXXXXXXQPENQEDSEMNWLHYHFPRLTSLNVSENKLNKWDSVDYVESLQNVTDLRISNQPLFESLKADEIWNQLVARMGNISKLNGSTITDENRIDAQRAFMRYYLD--SDAKPPKFYDLQKXXXXXXXXXXXXLSPEHFIPVKVICDDRQLELIVDVRSTVSEAKKLFCQKFGISDPY-NFVLKYWDHVMTEIQGPELMKSGNRNLYAYRVSKNDWFTLDKK 1373
            R  LPS L L+   I     +         V  L L++N +  W  V  +++N+P LE LNLSSN       S ++      +  ++ L+LN +   WE V  +L  LP LE L L  N     + ++  S    S+  L    N   D  EI  +G +FP L+ L+L  N+L ++  E  +DS    L   FP L S+++ ++ L  W+ +D + S   + ++R+   PL +    +E    ++AR+ ++SKLNGS +TD  R D++R F+RYY+D   +  P ++++L   +G +  +A ++L P+    V+V  +D+  E+ + +  TV+E KK    K  +  P  N +L Y+DH      GPE MK  +R L+++ +   D   ++ K
Sbjct:   46 RLNLPSVLVLNSCGITCAGDEKEIAAFCAHVSELDLSDNKLEDWHEVSKIVSNVPQLEFLNLSSN---PLNLSVLERTCAGSFSGVRKLVLNNSKASWETVHMILQELPDLEELFLCLNDY---ETVSCPSICCHSLKLLHITDNNLQDWTEIRKLGVMFPSLDTLVLANNHLNAI--EEPDDS----LARLFPNLRSISLHKSGLQSWEDIDKLNSFPKLEEVRLLGIPLLQPYTTEERRKLVIARLPSVSKLNGSVVTDGEREDSERFFIRYYVDVPQEEVPFRYHELITKYGKLEPLAEVDLRPQSSAKVEVHFNDQVEEMSIRLDQTVAELKKQL--KTLVQLPTSNMLLYYFDHEAP--FGPEEMKYSSRALHSFGIRDGDKIYVESK 422          
BLAST of Tubulin-specific chaperone cofactor E-like protein vs. Ensembl Human
Match: TBCEL (tubulin folding cofactor E like [Source:HGNC Symbol;Acc:HGNC:28115])

HSP 1 Score: 114.775 bits (286), Expect = 4.119e-27
Identity = 118/393 (30.03%), Postives = 199/393 (50.64%), Query Frame = 3
Query:  204 RRRLPSSLSLDGKEIELIDFDDSSLEMVEAVKSLHLNNNLINSWEYVINLLNNIPGLEXXXXXXXXXXQFQDSFVKLMPDIVYPKLKVLILNETGVPWEMVLSLLPRLPSLETLHLSKNIQPLSKEIAINSSPFPSVTQLFYNYNCCSDLQEICLMGDLFPCXXXXXXXXXXXXXXQPENQEDSEMNWLHYHFPRLTSLNVSENKLNKWDSVDYVESLQNVTDLRISNQPLFESLKADEIWNQLVARMGNISKLNGSTITDENRIDAQRAFMRYYLD--SDAKPPKFYDLQKXXXXXXXXXXXXLSPEHFIPVKVICDDRQLELIVDVRSTVSEAKKLFCQKFGISDPY-NFVLKYWDHVMTEIQGPELMKSGNRNLYAYRVSKNDWFTLDKK 1373
            R  LPS L L+   I     +         V  L L++N +  W  V  +++N+P LE LNLSSN       S ++      +  ++ L+LN +   WE V  +L  LP LE L L  N     + ++  S    S+  L    N   D  EI  +G +FP L+ L+L  N+L ++  E  +DS    L   FP L S+++ ++ L  W+ +D + S   + ++R+   PL +    +E    ++AR+ ++SKLNGS +TD  R D++R F+RYY+D   +  P ++++L   +G +  +A ++L P+    V+V  +D+  E+ + +  TV+E KK    K  +  P  N +L Y+DH      GPE MK  +R L+++ +   D   ++ K
Sbjct:   46 RLNLPSVLVLNSCGITCAGDEKEIAAFCAHVSELDLSDNKLEDWHEVSKIVSNVPQLEFLNLSSN---PLNLSVLERTCAGSFSGVRKLVLNNSKASWETVHMILQELPDLEELFLCLNDY---ETVSCPSICCHSLKLLHITDNNLQDWTEIRKLGVMFPSLDTLVLANNHLNAI--EEPDDS----LARLFPNLRSISLHKSGLQSWEDIDKLNSFPKLEEVRLLGIPLLQPYTTEERRKLVIARLPSVSKLNGSVVTDGEREDSERFFIRYYVDVPQEEVPFRYHELITKYGKLEPLAEVDLRPQSSAKVEVHFNDQVEEMSIRLDQTVAELKKQL--KTLVQLPTSNMLLYYFDHEAP--FGPEEMKYSSRALHSFGIRDGDKIYVESK 422          
BLAST of Tubulin-specific chaperone cofactor E-like protein vs. Ensembl Human
Match: AP000646.1 (novel protein)

HSP 1 Score: 92.0485 bits (227), Expect = 2.621e-19
Identity = 87/277 (31.41%), Postives = 140/277 (50.54%), Query Frame = 3
Query:  204 RRRLPSSLSLDGKEIELIDFDDSSLEMVEAVKSLHLNNNLINSWEYVINLLNNIPGLEXXXXXXXXXXQFQDSFVKLMPDIVYPKLKVLILNETGVPWEMVLSLLPRLPSLETLHLSKNIQPLSKEIAINSSPFPSVTQLFYNYNCCSDLQEICLMGDLFPCXXXXXXXXXXXXXXQPENQEDSEMNWLHYHFPRLTSLNVSENKLNKWDSVDYVESLQNVTDLRISNQPLFESLKADEIWNQLVARMGNISKLNGSTITDENRIDAQRAFMRYYLD 1034
            R  LPS L L+   I     +         V  L L++N +  W  V  +++N+P LE LNLSSN       S ++      +  ++ L+LN +   WE V  +L  LP LE L L  N     + ++  S    S+  L    N   D  EI  +G +FP L+ L+L  N+L ++  E  +DS    L   FP L S+++ ++ L  W+ +D + S   + ++R+   PL +    +E    ++AR+ ++SKLNGS +TD  R D++R F+RYY+D
Sbjct:   30 RLNLPSVLVLNSCGITCAGDEKEIAAFCAHVSELDLSDNKLEDWHEVSKIVSNVPQLEFLNLSSN---PLNLSVLERTCAGSFSGVRKLVLNNSKASWETVHMILQELPDLEELFLCLNDY---ETVSCPSICCHSLKLLHITDNNLQDWTEIRKLGVMFPSLDTLVLANNHLNAI--EEPDDS----LARLFPNLRSISLHKSGLQSWEDIDKLNSFPKLEEVRLLGIPLLQPYTTEERRKLVIARLPSVSKLNGSVVTDGEREDSERFFIRYYVD 294          
BLAST of Tubulin-specific chaperone cofactor E-like protein vs. Ensembl Human
Match: TBCEL (tubulin folding cofactor E like [Source:HGNC Symbol;Acc:HGNC:28115])

HSP 1 Score: 61.6178 bits (148), Expect = 3.309e-11
Identity = 26/77 (33.77%), Postives = 47/77 (61.04%), Query Frame = 3
Query:  804 VSENKLNKWDSVDYVESLQNVTDLRISNQPLFESLKADEIWNQLVARMGNISKLNGSTITDENRIDAQRAFMRYYLD 1034
            + +  L  W+ +D + S   + ++R+   PL +    +E    ++AR+ ++SKLNGS +TD  R D++R F+RYY+D
Sbjct:    1 MGKKGLQSWEDIDKLNSFPKLEEVRLLGIPLLQPYTTEERRKLVIARLPSVSKLNGSVVTDGEREDSERFFIRYYVD 77          
BLAST of Tubulin-specific chaperone cofactor E-like protein vs. Ensembl Human
Match: TBCE (tubulin folding cofactor E [Source:HGNC Symbol;Acc:HGNC:11582])

HSP 1 Score: 58.5362 bits (140), Expect = 1.844e-8
Identity = 69/254 (27.17%), Postives = 116/254 (45.67%), Query Frame = 3
Query:  279 EMVEAVKSLHLNNNLINSWEYVINLLNNIPGLEXXXXXXXXXXQFQDSFVKLMPDIVYPKLKVLILNETGVPWEMVLSLLPRLPSLETLHLSKNIQPLSKEIAINSSP---FPSVTQLFYNYNCCSDLQEICLMGDLFPCXXXXXXXXXXXXXXQPENQEDSEMNWLHYHFPRLTSLNVSENKLNKWDSVDYVESLQNVTDLRISNQPLFESLKADEIWNQL-VARMGNISKLNGSTITDENR----IDAQRAF 1016
            E    ++ + L+ NL++SW+ VI++ + +  LE LN+S N L     S +     +    LKVL+LN+TG+ W  VL  +   P LE L+L  N       I I+  P     +V  L  + N   D  ++ L+  L    + ++          P    D+ +      FP L  L V++N++++W   + +E L ++  L     PL +  K  E    L +A +G +  LN   I  E R    +D ++AF
Sbjct:  150 EACPNIRKVDLSKNLLSSWDEVIHIADQLRHLEVLNVSENKLKFPSGSVLTGTLSV----LKVLVLNQTGITWAEVLRCVAGCPGLEELYLESN------NIFISERPTDVLQTVKLLDLSSNQLIDENQLYLIAHLPRLEQLILSDTGISSLHFP----DAGIGCKTSMFPSLKYLVVNDNQISQWSFFNELEKLPSLRALSCLRNPLTKEDKEAETARLLIIASIGQLKTLNKCEILPEERRRAELDYRKAF 389          
BLAST of Tubulin-specific chaperone cofactor E-like protein vs. Ensembl Celegans
Match: coel-1 (Tubulin folding COfactor E-Like protein [Source:UniProtKB/TrEMBL;Acc:Q8IFX8])

HSP 1 Score: 93.9745 bits (232), Expect = 1.805e-20
Identity = 93/354 (26.27%), Postives = 165/354 (46.61%), Query Frame = 3
Query:  225 LSLDGKEIELIDFDDSSLEMVEAVKSLHLNNNLINSWEYVINLLNNIPGLEXXXXXXXXXXQFQDSFVKLMPDIVYPKLKVLILNETGVPWEMVLSLLPRLPSLETLHLSKN-----------IQPLSKEIAINSSPF---PSVTQLFYNY-NCCSDLQEICLMGDLFPCXXXXXXXXXXXXXXQPENQEDSEMNWLHY-HFPRLTSLNVSENKLNKWDSVDYVESLQNVTDLRISNQPLFESLKADEIWNQLVARMGNISKLNGSTITDENRIDAQRAFMRYYLDSDAKPPKFYDLQKXXXXXXXXXXXXLSPEHFIPVKVICDDRQL--ELIVDVRSTVSEAKKLFCQKFGI 1232
            L L+   I+ I   +    +   V    L  N I+ W  +  +L N+P L  LN+  NPLN   D       ++    L  +ILN T +P++ + S L  LP +  LH+S N           I    + + +N   F    SV  +   + N CS          +F C                EN      +  H+   P    LN+++  ++ WDS+D +  + +++DLR+ N PL ++L  +E  + ++ R+ ++  LNGS I+ E R  ++R F+RYY +   KP ++  L   HGN+  +  I+L+P+    VK++C+++++  E+ + +  TV +  K+   K G+
Sbjct:   49 LVLNNMNIDTIGDSEKLATLASHVSEADLGWNQISKWSDIACILKNLPHLRVLNIGHNPLNPVIDH------ELPVSTLHTIILNGTHLPFKTLQSFLSVLPKVTELHMSDNQFNDDDDCDEPISTTVRTVHLNRCGFLKWSSVMNVVKRFPNVCS----------VFVC----------------ENPLKDVTHCKHFEQLPFWNFLNLAKTSIDSWDSLDQLNRMTSISDLRVPNIPLLDALTNEERLHLIIGRLHHLRVLNGSKISSEQREQSERFFIRYYQEQKEKPLQYKTLIDKHGNLEKLVTIDLTPKKEAVVKILCEEKEVNQEITISLEPTVLDFMKILDPKVGV 370          
BLAST of Tubulin-specific chaperone cofactor E-like protein vs. Ensembl Celegans
Match: coel-1 (Tubulin folding COfactor E-Like protein [Source:UniProtKB/TrEMBL;Acc:Q8IFX8])

HSP 1 Score: 83.1889 bits (204), Expect = 6.999e-17
Identity = 48/157 (30.57%), Postives = 95/157 (60.51%), Query Frame = 3
Query:  777 HFPRL---TSLNVSENKLNKWDSVDYVESLQNVTDLRISNQPLFESLKADEIWNQLVARMGNISKLNGSTITDENRIDAQRAFMRYYLDSDAKPPKFYDLQKXXXXXXXXXXXXLSPEHFIPVKVICDDRQL--ELIVDVRSTVSEAKKLFCQKFGI 1232
            HF +L     LN+++  ++ WDS+D +  + +++DLR+ N PL ++L  +E  + ++ R+ ++  LNGS I+ E R  ++R F+RYY +   KP ++  L   HGN+  +  I+L+P+    VK++C+++++  E+ + +  TV +  K+   K G+
Sbjct:  200 HFEQLPFWNFLNLAKTSIDSWDSLDQLNRMTSISDLRVPNIPLLDALTNEERLHLIIGRLHHLRVLNGSKISSEQREQSERFFIRYYQEQKEKPLQYKTLIDKHGNLEKLVTIDLTPKKEAVVKILCEEKEVNQEITISLEPTVLDFMKILDPKVGV 356          
BLAST of Tubulin-specific chaperone cofactor E-like protein vs. Ensembl Fly
Match: mlt (gene:FBgn0265512 transcript:FBtr0088370)

HSP 1 Score: 141.354 bits (355), Expect = 1.479e-36
Identity = 130/410 (31.71%), Postives = 210/410 (51.22%), Query Frame = 3
Query:  213 LPSSLSLDGKEIELIDFDDSSLEMVEAVKSLHLNNNLINSWEYVINLLNNIPGLEXXXXXXXXXXQFQDSFVKLMPDIVYPKLKVLILNETGVPWEMVLSLLPRLPSLETLHLSKN------IQPLSKEIAIN------------SSPFPSVTQLFYNYNCCSDLQEICLMGDLFPCXXXXXXXXXXXXXXQPENQEDSEMNWLHYHFPRLTSLNVSENKLNKWDSVDYVESLQNVTDLRISNQPLFESLKADEIWNQ--LVARMGNISKLN-GSTITDENRIDAQRAFMRYYLDS--DAKPPKFYDLQKXXXXXXXXXXXXLSPEHFIPVKVICDDRQLELIVDVRSTVSEAKKLFCQKFGISDPYNFVLKYWDHVMTEIQGPELMKSGNRNLYAYRVSKNDWFTLDKK 1373
            +P+ L L+  +I+     DS  E  + V+ L L  N ++ W  V ++L ++P +E LNLS N L     S +  +P      LK L+LN T + W  V +LL  LP L+ LHLS N      I     E  +             +   P++  L +  N     QEIC +G LFP LE L+L    ++SLQ E   ++     H +FP L  LN+S  +L+ W ++D +     + +LR+ + PL+ESL+  E   +  L+AR+ N+  LN G  I+ + R+D++RAF+RYY+D   + +P ++ +L +IHG ++ + N++L P+  + V    +D      VD+  TV++ K    +  G++ P    L Y D    E  GPE M+  N+ LY+Y +   D   +D K
Sbjct:   60 VPALLVLNDCDIDSAGDFDSIREKCQRVRELDLAQNKLSDWSEVFSILEHMPRIEFLNLSKNQLA----SPIGTLPTAPTINLKSLVLNGTYLDWACVDTLLKNLPVLQELHLSLNNYRQVLIDAEEAEQRLQETETPEETERRITKAHPALKTLHFTGNPVEHWQEICRLGRLFPNLEALVLADCPIKSLQAEESSET-----HRYFPSLRLLNLSSAQLDSWAAIDELAKFSELRNLRVKHWPLWESLECTEHERRQLLIARLPNVEMLNGGGKISSDERVDSERAFVRYYMDKPEEERPARYQELLQIHGKLDPLVNVSLKPDKRVKVLFTYNDVSESRFVDIYLTVNDLKVKLEKLVGLA-PNKMRLYYLDQDYKEF-GPEEMRYPNKQLYSYNIQSGDEIIIDAK 458          
BLAST of Tubulin-specific chaperone cofactor E-like protein vs. Ensembl Fly
Match: mlt (gene:FBgn0265512 transcript:FBtr0331945)

HSP 1 Score: 141.354 bits (355), Expect = 1.479e-36
Identity = 130/410 (31.71%), Postives = 210/410 (51.22%), Query Frame = 3
Query:  213 LPSSLSLDGKEIELIDFDDSSLEMVEAVKSLHLNNNLINSWEYVINLLNNIPGLEXXXXXXXXXXQFQDSFVKLMPDIVYPKLKVLILNETGVPWEMVLSLLPRLPSLETLHLSKN------IQPLSKEIAIN------------SSPFPSVTQLFYNYNCCSDLQEICLMGDLFPCXXXXXXXXXXXXXXQPENQEDSEMNWLHYHFPRLTSLNVSENKLNKWDSVDYVESLQNVTDLRISNQPLFESLKADEIWNQ--LVARMGNISKLN-GSTITDENRIDAQRAFMRYYLDS--DAKPPKFYDLQKXXXXXXXXXXXXLSPEHFIPVKVICDDRQLELIVDVRSTVSEAKKLFCQKFGISDPYNFVLKYWDHVMTEIQGPELMKSGNRNLYAYRVSKNDWFTLDKK 1373
            +P+ L L+  +I+     DS  E  + V+ L L  N ++ W  V ++L ++P +E LNLS N L     S +  +P      LK L+LN T + W  V +LL  LP L+ LHLS N      I     E  +             +   P++  L +  N     QEIC +G LFP LE L+L    ++SLQ E   ++     H +FP L  LN+S  +L+ W ++D +     + +LR+ + PL+ESL+  E   +  L+AR+ N+  LN G  I+ + R+D++RAF+RYY+D   + +P ++ +L +IHG ++ + N++L P+  + V    +D      VD+  TV++ K    +  G++ P    L Y D    E  GPE M+  N+ LY+Y +   D   +D K
Sbjct:   60 VPALLVLNDCDIDSAGDFDSIREKCQRVRELDLAQNKLSDWSEVFSILEHMPRIEFLNLSKNQLA----SPIGTLPTAPTINLKSLVLNGTYLDWACVDTLLKNLPVLQELHLSLNNYRQVLIDAEEAEQRLQETETPEETERRITKAHPALKTLHFTGNPVEHWQEICRLGRLFPNLEALVLADCPIKSLQAEESSET-----HRYFPSLRLLNLSSAQLDSWAAIDELAKFSELRNLRVKHWPLWESLECTEHERRQLLIARLPNVEMLNGGGKISSDERVDSERAFVRYYMDKPEEERPARYQELLQIHGKLDPLVNVSLKPDKRVKVLFTYNDVSESRFVDIYLTVNDLKVKLEKLVGLA-PNKMRLYYLDQDYKEF-GPEEMRYPNKQLYSYNIQSGDEIIIDAK 458          
BLAST of Tubulin-specific chaperone cofactor E-like protein vs. Ensembl Fly
Match: mlt (gene:FBgn0265512 transcript:FBtr0088369)

HSP 1 Score: 141.354 bits (355), Expect = 1.479e-36
Identity = 130/410 (31.71%), Postives = 210/410 (51.22%), Query Frame = 3
Query:  213 LPSSLSLDGKEIELIDFDDSSLEMVEAVKSLHLNNNLINSWEYVINLLNNIPGLEXXXXXXXXXXQFQDSFVKLMPDIVYPKLKVLILNETGVPWEMVLSLLPRLPSLETLHLSKN------IQPLSKEIAIN------------SSPFPSVTQLFYNYNCCSDLQEICLMGDLFPCXXXXXXXXXXXXXXQPENQEDSEMNWLHYHFPRLTSLNVSENKLNKWDSVDYVESLQNVTDLRISNQPLFESLKADEIWNQ--LVARMGNISKLN-GSTITDENRIDAQRAFMRYYLDS--DAKPPKFYDLQKXXXXXXXXXXXXLSPEHFIPVKVICDDRQLELIVDVRSTVSEAKKLFCQKFGISDPYNFVLKYWDHVMTEIQGPELMKSGNRNLYAYRVSKNDWFTLDKK 1373
            +P+ L L+  +I+     DS  E  + V+ L L  N ++ W  V ++L ++P +E LNLS N L     S +  +P      LK L+LN T + W  V +LL  LP L+ LHLS N      I     E  +             +   P++  L +  N     QEIC +G LFP LE L+L    ++SLQ E   ++     H +FP L  LN+S  +L+ W ++D +     + +LR+ + PL+ESL+  E   +  L+AR+ N+  LN G  I+ + R+D++RAF+RYY+D   + +P ++ +L +IHG ++ + N++L P+  + V    +D      VD+  TV++ K    +  G++ P    L Y D    E  GPE M+  N+ LY+Y +   D   +D K
Sbjct:   60 VPALLVLNDCDIDSAGDFDSIREKCQRVRELDLAQNKLSDWSEVFSILEHMPRIEFLNLSKNQLA----SPIGTLPTAPTINLKSLVLNGTYLDWACVDTLLKNLPVLQELHLSLNNYRQVLIDAEEAEQRLQETETPEETERRITKAHPALKTLHFTGNPVEHWQEICRLGRLFPNLEALVLADCPIKSLQAEESSET-----HRYFPSLRLLNLSSAQLDSWAAIDELAKFSELRNLRVKHWPLWESLECTEHERRQLLIARLPNVEMLNGGGKISSDERVDSERAFVRYYMDKPEEERPARYQELLQIHGKLDPLVNVSLKPDKRVKVLFTYNDVSESRFVDIYLTVNDLKVKLEKLVGLA-PNKMRLYYLDQDYKEF-GPEEMRYPNKQLYSYNIQSGDEIIIDAK 458          
BLAST of Tubulin-specific chaperone cofactor E-like protein vs. Ensembl Zebrafish
Match: tbcelb (tubulin folding cofactor E-like b [Source:ZFIN;Acc:ZDB-GENE-100921-13])

HSP 1 Score: 122.094 bits (305), Expect = 8.011e-30
Identity = 121/386 (31.35%), Postives = 195/386 (50.52%), Query Frame = 3
Query:  204 RRRLPSSLSLDGKEIELIDFDDSSLEMVEAVKSLHLNNNLINSWEYVINLLNNIPGLEXXXXXXXXXXQFQDSFVKLMPDIVYPKLKVLILNETGVPWEMVLSLLPRLPSLETLHLSKNIQPLSKEIAINSSPFPSVTQLFYNYNCCSDLQEICLMGDLFPCXXXXXXXXXXXXXXQPENQEDSEMNWLHYHFPRLTSLNVSENKLNKWDSVDYVESLQNVTDLRISNQPLFESLKADEIWNQLVARMGNISKLNGSTITDENRIDAQRAFMRYYLD--SDAKPPKFYDLQKXXXXXXXXXXXXLSPEHFIPVKVICDDRQLELIVDVRSTVSEAKKLFCQKFGISDPYNFVLKYW-DHVMTEIQGPELMKSGNRNLYAYRVSKND 1352
            R  LPS L LDG  I     ++        V  L L++N +  W  +  +L+NIP L+ LNLS NP      S ++      +  L+ L+LN T V W+MV +L   +P LE L L  N     + +  +S P PS+  L    N   D  E+  +G ++P L +LIL  N+L S+     EDS    LH  FP L S+N+  + L++W+ V+ +     + ++R+   PL +     E    +VA++ +++ LNGS +TD  R DA+R F+RY+LD   D  P +++ L   +G +  +A ++L P   + V+V   D+   L + +  TV++ KK    K  +  P N +  Y+ D  +     P+ MK G R L++Y +   D
Sbjct:   48 RLNLPSILVLDGCGITEAGDEEEVATFCAHVVELDLSHNQLKDWGEISKILSNIPNLDFLNLSMNP---LHGSSLEPCLAEAFSGLRRLVLNNTHVTWDMVHTLTREIPDLEELFLCLNEY---ESVNASSMPCPSLRLLHITDNQLQDWVEVRKLGLMYPGLVSLILSNNSLSSIH--EPEDS----LHRLFPNLRSINLHNSGLSRWEDVEKLNFFPKLQEVRVMGIPLLQPYTDQERRCLMVAQLPHVTVLNGSVVTDGEREDAERFFIRYHLDCPEDELPQRYHTLVARYGRLAPLAEVDLRPLSHVQVQVRFGDQAKSLELRLDQTVADLKKQL--KTVVQLPPNKIRVYYIDRQLGYALEPQEMKYGARALHSYSIRDGD 419          
BLAST of Tubulin-specific chaperone cofactor E-like protein vs. Ensembl Zebrafish
Match: tbcelb (tubulin folding cofactor E-like b [Source:ZFIN;Acc:ZDB-GENE-100921-13])

HSP 1 Score: 122.094 bits (305), Expect = 8.011e-30
Identity = 121/386 (31.35%), Postives = 195/386 (50.52%), Query Frame = 3
Query:  204 RRRLPSSLSLDGKEIELIDFDDSSLEMVEAVKSLHLNNNLINSWEYVINLLNNIPGLEXXXXXXXXXXQFQDSFVKLMPDIVYPKLKVLILNETGVPWEMVLSLLPRLPSLETLHLSKNIQPLSKEIAINSSPFPSVTQLFYNYNCCSDLQEICLMGDLFPCXXXXXXXXXXXXXXQPENQEDSEMNWLHYHFPRLTSLNVSENKLNKWDSVDYVESLQNVTDLRISNQPLFESLKADEIWNQLVARMGNISKLNGSTITDENRIDAQRAFMRYYLD--SDAKPPKFYDLQKXXXXXXXXXXXXLSPEHFIPVKVICDDRQLELIVDVRSTVSEAKKLFCQKFGISDPYNFVLKYW-DHVMTEIQGPELMKSGNRNLYAYRVSKND 1352
            R  LPS L LDG  I     ++        V  L L++N +  W  +  +L+NIP L+ LNLS NP      S ++      +  L+ L+LN T V W+MV +L   +P LE L L  N     + +  +S P PS+  L    N   D  E+  +G ++P L +LIL  N+L S+     EDS    LH  FP L S+N+  + L++W+ V+ +     + ++R+   PL +     E    +VA++ +++ LNGS +TD  R DA+R F+RY+LD   D  P +++ L   +G +  +A ++L P   + V+V   D+   L + +  TV++ KK    K  +  P N +  Y+ D  +     P+ MK G R L++Y +   D
Sbjct:   48 RLNLPSILVLDGCGITEAGDEEEVATFCAHVVELDLSHNQLKDWGEISKILSNIPNLDFLNLSMNP---LHGSSLEPCLAEAFSGLRRLVLNNTHVTWDMVHTLTREIPDLEELFLCLNEY---ESVNASSMPCPSLRLLHITDNQLQDWVEVRKLGLMYPGLVSLILSNNSLSSIH--EPEDS----LHRLFPNLRSINLHNSGLSRWEDVEKLNFFPKLQEVRVMGIPLLQPYTDQERRCLMVAQLPHVTVLNGSVVTDGEREDAERFFIRYHLDCPEDELPQRYHTLVARYGRLAPLAEVDLRPLSHVQVQVRFGDQAKSLELRLDQTVADLKKQL--KTVVQLPPNKIRVYYIDRQLGYALEPQEMKYGARALHSYSIRDGD 419          
BLAST of Tubulin-specific chaperone cofactor E-like protein vs. Ensembl Zebrafish
Match: tbcela (tubulin folding cofactor E-like a [Source:ZFIN;Acc:ZDB-GENE-040426-1719])

HSP 1 Score: 122.479 bits (306), Expect = 8.448e-30
Identity = 115/387 (29.72%), Postives = 197/387 (50.90%), Query Frame = 3
Query:  204 RRRLPSSLSLDGKEIELIDFDDSSLEMVEAVKSLHLNNNLINSWEYVINLLNNIPGLEXXXXXXXXXXQFQDSFVKLMPDIV--YPKLKVLILNETGVPWEMVLSLLPRLPSLETLHLSKNIQPLSKEIAINSSPFPSVTQLFYNYNCCSDLQEICLMGDLFPCXXXXXXXXXXXXXXQPENQEDSEMNWLHYHFPRLTSLNVSENKLNKWDSVDYVESLQNVTDLRISNQPLFESLKADEIWNQLVARMGNISKLNGSTITDENRIDAQRAFMRYYLDSDAK--PPKFYDLQKXXXXXXXXXXXXLSPEHFIPVKVICDDRQLELIVDVRSTVSEAKKLFCQKFGISDPYNFVLKYWDHVMTEIQGPELMKSGNRNLYAYRVSKND 1352
            R  LPS L L+G  I               V  L L++N +  W  +  +++N+P LE LNLSSN   Q  D+   L PD    +  ++  +LN T V W+ V +    +P LE L L  N       + + + P P++  L    N   +  E+  +G +FP L+ L++  NNL S+Q    E  E+  LH  FP L S+N+  + LN+W+ ++ +  L  + ++R+   PL ++  + E  + ++A++ +++ LNGS +TD  R DA+R F+RY+LD   +  P +++ L   +G +  +A I+L P     V+V  +D+  ++ + +  TV+E KK    K  +  P N +  Y+    T   GP+ +K   R L++Y +   D
Sbjct:   70 RLNLPSVLVLNGCGISHAGDQGEIAAFCAHVVELDLSHNKLQDWHEISKIVSNVPNLEFLNLSSN---QLSDAV--LDPDCAKAFSSIRRFVLNNTQVSWDTVHTFTQEMPELEELFLCLNEY---TTVTLAAMPCPTLRLLHITDNNLHEWNEVRKIGSMFPALDTLVMANNNLNSIQ----ESGEI--LHRLFPNLRSINLHNSGLNRWEDIEKLTFLPKLEEVRLQGIPLLQTYTSTERRSLMIAQLPSVTSLNGSVVTDGEREDAERFFIRYHLDHSEEELPHRYHCLVTKYGKLAPLAEIDLRPRFHAKVEVRFEDKVEQVSIRLDQTVAELKKQL--KTVVQLPTNNMRLYYIDKGTAY-GPDELKYSARALHSYSIQDGD 439          
BLAST of Tubulin-specific chaperone cofactor E-like protein vs. Ensembl Zebrafish
Match: tbcela (tubulin folding cofactor E-like a [Source:ZFIN;Acc:ZDB-GENE-040426-1719])

HSP 1 Score: 91.6633 bits (226), Expect = 2.201e-20
Identity = 75/253 (29.64%), Postives = 137/253 (54.15%), Query Frame = 3
Query:  600 PFPSVTQLFYNYNCCSDLQEICLMGDLFPCXXXXXXXXXXXXXXQPENQEDSEMNWLHYHFPRLTSLNVSENKLNKWDSVDYVESLQNVTDLRISNQPLFESLKADEIWNQLVARMGNISKLNGSTITDENRIDAQRAFMRYYLDSDAK--PPKFYDLQKXXXXXXXXXXXXLSPEHFIPVKVICDDRQLELIVDVRSTVSEAKKLFCQKFGISDPYNFVLKYWDHVMTEIQGPELMKSGNRNLYAYRVSKND 1352
            P P++  L    N   +  E+  +G +FP L+ L++  NNL S+Q    E  E+  LH  FP L S+N+  + LN+W+ ++ +  L  + ++R+   PL ++  + E  + ++A++ +++ LNGS +TD  R DA+R F+RY+LD   +  P +++ L   +G +  +A I+L P     V+V  +D+  ++ + +  TV+E KK    K  +  P N +  Y+    T   GP+ +K   R L++Y +   D
Sbjct:    2 PCPTLRLLHITDNNLHEWNEVRKIGSMFPALDTLVMANNNLNSIQ----ESGEI--LHRLFPNLRSINLHNSGLNRWEDIEKLTFLPKLEEVRLQGIPLLQTYTSTERRSLMIAQLPSVTSLNGSVVTDGEREDAERFFIRYHLDHSEEELPHRYHCLVTKYGKLAPLAEIDLRPRFHAKVEVRFEDKVEQVSIRLDQTVAELKKQL--KTVVQLPTNNMRLYYIDKGTAY-GPDELKYSARALHSYSIQDGD 245          
BLAST of Tubulin-specific chaperone cofactor E-like protein vs. Ensembl Xenopus
Match: ptch2 (patched 2 [Source:Xenbase;Acc:XB-GENE-1033868])

HSP 1 Score: 100.138 bits (248), Expect = 4.820e-22
Identity = 118/392 (30.10%), Postives = 193/392 (49.23%), Query Frame = 3
Query:  204 RRRLPSSLSLDGKEIELIDFDDSSLEMVEAVKSLHLNNNLINSWEYVINLLNNIPGLEXXXXXXXXXXQFQDSFVKLMPDIVYPKLKVLILNETGVPWEMVLSLLPRLPSLETLHLSKNIQPLSKEIAINSSPFPSVTQLFYNYNCCSDLQEICLMGDLFPCXXXXXXXXXXXXXXQPENQEDSEMNWLHYHFPRLTSLNVSENKLNKWDSVDYVESLQNVTDLRISNQPLFESLKADEIWNQLVARMGNISKLNGSTITDENRIDAQRAFMRYYLD--SDAKPPKFYDLQKXXXXXXXXXXXXLSPEHFIPVKVICDDRQLELIVDVRSTVSEAKKLFCQKFGISDPYNFVLKYWDHVMTEIQGPELMKSGNRNLYAYRVSKNDWFTLDKK 1373
            R  LPS L L+   I     +         V  L L++N ++ WE V  +++++P L+ LNLSSN       S +       +  ++ L+LN     WE V +LL  LP LE L L  N       +  +   F S+  L    N   D  +I  +G +FPCL+ L+L  NNL  +     EDSE + L   FP L S+++ +  LN W  ++ + +L  + ++R+   PL E    +E    ++AR+ ++SKLNGS +TD  R D++R F+RYY++   +  P ++ +L   +G +  +  ++L P+    V +  +++   + + +  TV+E KK       +S   N  L Y DH      GPE MK   R L++Y V   D F ++ K
Sbjct:   60 RLNLPSILVLNSCGINCAGDESEIAAFCSHVSELDLSDNKLDDWEEVSKIVSSVPQLQFLNLSSN---PLHLSVLGRSCAGTFSSIRKLVLNNCKASWETVHTLLMELPELEELFLCLNDY---NTVLCSPVCFRSLKLLHITDNNLQDWSDIRKLGTMFPCLDTLVLANNNLSKI-----EDSEES-LARLFPNLRSISLHKAGLNSWRDIEKLNALPKLEEVRLLGIPLVEPYSTEERRKLVIARLPSVSKLNGSVVTDGEREDSERFFLRYYMNLPKEDVPLRYQELVTKYGKLEPLVEVDLRPQSKANVDIHFEEKVETISIRLDQTVAEFKKQLKNLVQLST-NNMRLYYLDHEAP--FGPEEMKFSTRFLHSYNVHDGDKFYVEPK 436          
BLAST of Tubulin-specific chaperone cofactor E-like protein vs. Ensembl Xenopus
Match: ptch2 (patched 2 [Source:Xenbase;Acc:XB-GENE-1033868])

HSP 1 Score: 99.7525 bits (247), Expect = 5.539e-22
Identity = 118/392 (30.10%), Postives = 193/392 (49.23%), Query Frame = 3
Query:  204 RRRLPSSLSLDGKEIELIDFDDSSLEMVEAVKSLHLNNNLINSWEYVINLLNNIPGLEXXXXXXXXXXQFQDSFVKLMPDIVYPKLKVLILNETGVPWEMVLSLLPRLPSLETLHLSKNIQPLSKEIAINSSPFPSVTQLFYNYNCCSDLQEICLMGDLFPCXXXXXXXXXXXXXXQPENQEDSEMNWLHYHFPRLTSLNVSENKLNKWDSVDYVESLQNVTDLRISNQPLFESLKADEIWNQLVARMGNISKLNGSTITDENRIDAQRAFMRYYLD--SDAKPPKFYDLQKXXXXXXXXXXXXLSPEHFIPVKVICDDRQLELIVDVRSTVSEAKKLFCQKFGISDPYNFVLKYWDHVMTEIQGPELMKSGNRNLYAYRVSKNDWFTLDKK 1373
            R  LPS L L+   I     +         V  L L++N ++ WE V  +++++P L+ LNLSSN       S +       +  ++ L+LN     WE V +LL  LP LE L L  N       +  +   F S+  L    N   D  +I  +G +FPCL+ L+L  NNL  +     EDSE + L   FP L S+++ +  LN W  ++ + +L  + ++R+   PL E    +E    ++AR+ ++SKLNGS +TD  R D++R F+RYY++   +  P ++ +L   +G +  +  ++L P+    V +  +++   + + +  TV+E KK       +S   N  L Y DH      GPE MK   R L++Y V   D F ++ K
Sbjct:   46 RLNLPSILVLNSCGINCAGDESEIAAFCSHVSELDLSDNKLDDWEEVSKIVSSVPQLQFLNLSSN---PLHLSVLGRSCAGTFSSIRKLVLNNCKASWETVHTLLMELPELEELFLCLNDY---NTVLCSPVCFRSLKLLHITDNNLQDWSDIRKLGTMFPCLDTLVLANNNLSKI-----EDSEES-LARLFPNLRSISLHKAGLNSWRDIEKLNALPKLEEVRLLGIPLVEPYSTEERRKLVIARLPSVSKLNGSVVTDGEREDSERFFLRYYMNLPKEDVPLRYQELVTKYGKLEPLVEVDLRPQSKANVDIHFEEKVETISIRLDQTVAEFKKQLKNLVQLST-NNMRLYYLDHEAP--FGPEEMKFSTRFLHSYNVHDGDKFYVEPK 422          
BLAST of Tubulin-specific chaperone cofactor E-like protein vs. Ensembl Mouse
Match: Tbcel (tubulin folding cofactor E-like [Source:MGI Symbol;Acc:MGI:1925543])

HSP 1 Score: 100.523 bits (249), Expect = 2.188e-22
Identity = 122/421 (28.98%), Postives = 206/421 (48.93%), Query Frame = 3
Query:  120 DFVKRQYEEINTIVPDIVTFGMPKDNGTRRRLPSSLSLDGKEIELIDFDDSSLEMVEAVKSLHLNNNLINSWEYVINLLNNIPGLEXXXXXXXXXXQFQDSFVKLMPDIVYPKLKVLILNETGVPWEMVLSLLPRLPSLETLHLSKNIQPLSKEIAINSSPFPSVTQLFYNYNCCSDLQEICLMGDLFPCXXXXXXXXXXXXXXQPENQEDSEMNWLHYHFPRLTSLNVSENKLNKWDSVDYVESLQNVTDLRISNQPLFESLKADEIWNQLVARMGNISKLNGSTITDENRIDAQRAFMRYYLD--SDAKPPKFYDLQKXXXXXXXXXXXXLSPEHFIPVKVICDDRQLELIVDVRSTVSEAKKLFCQKFGISDPY-NFVLKYWDHVMTEIQGPELMKSGNRNLYAYRVSKNDWFTLDKK 1373
            +F  R+   +   VP        KD   R  LPS L L+   I     +         V  L L++N +  W  V  +++N+P LE LNLSSN       S ++      +  ++ L+LN +   WE V ++L  LP LE L L  N     + ++  S    S+  L    N   D  EI  +G +FP L+ L+L  N+L      N  +   + L   FP L S+++ ++ L  W+ +D + S   + ++R+   PL +    +E    +VAR+ ++SKLNGS +TD  R D++R F+RYY+D   +  P ++++L   +G +  +A ++L P+    V+V  +D+  E+ + +  TV+E KK    K  +  P  + +L Y+DH      GPE MK  +R L+++ +   D   ++ K
Sbjct:   21 NFPYRRGPGVGVHVPATPQGSPMKD---RLNLPSVLVLNSCGITCAGDEREIAAFCAHVSELDLSDNKLQDWHEVSKIVSNVPQLEFLNLSSN---PLSLSVLERTCAGSFSGVRKLVLNNSKASWETVHTILQELPELEELFLCLNDY---ETVSCPSVCCHSLKLLHITDNNLQDWTEIRKLGVMFPSLDTLVLANNHL------NAIEEPADSLARLFPNLRSISLHKSGLQSWEDIDKLNSFPKLEEVRLLGIPLLQPYTTEERRKLVVARLPSVSKLNGSVVTDGEREDSERFFIRYYVDVPQEEVPFRYHELITKYGKLEPLAEVDLRPQSSAKVEVHFNDQVEEMSIRLDQTVAELKKQL--KTLVQLPTSSMLLYYFDHEAP--FGPEEMKYSSRALHSFGIRDGDKIFVESK 422          
BLAST of Tubulin-specific chaperone cofactor E-like protein vs. Ensembl Mouse
Match: Tbcel (tubulin folding cofactor E-like [Source:MGI Symbol;Acc:MGI:1925543])

HSP 1 Score: 100.523 bits (249), Expect = 2.188e-22
Identity = 122/421 (28.98%), Postives = 206/421 (48.93%), Query Frame = 3
Query:  120 DFVKRQYEEINTIVPDIVTFGMPKDNGTRRRLPSSLSLDGKEIELIDFDDSSLEMVEAVKSLHLNNNLINSWEYVINLLNNIPGLEXXXXXXXXXXQFQDSFVKLMPDIVYPKLKVLILNETGVPWEMVLSLLPRLPSLETLHLSKNIQPLSKEIAINSSPFPSVTQLFYNYNCCSDLQEICLMGDLFPCXXXXXXXXXXXXXXQPENQEDSEMNWLHYHFPRLTSLNVSENKLNKWDSVDYVESLQNVTDLRISNQPLFESLKADEIWNQLVARMGNISKLNGSTITDENRIDAQRAFMRYYLD--SDAKPPKFYDLQKXXXXXXXXXXXXLSPEHFIPVKVICDDRQLELIVDVRSTVSEAKKLFCQKFGISDPY-NFVLKYWDHVMTEIQGPELMKSGNRNLYAYRVSKNDWFTLDKK 1373
            +F  R+   +   VP        KD   R  LPS L L+   I     +         V  L L++N +  W  V  +++N+P LE LNLSSN       S ++      +  ++ L+LN +   WE V ++L  LP LE L L  N     + ++  S    S+  L    N   D  EI  +G +FP L+ L+L  N+L      N  +   + L   FP L S+++ ++ L  W+ +D + S   + ++R+   PL +    +E    +VAR+ ++SKLNGS +TD  R D++R F+RYY+D   +  P ++++L   +G +  +A ++L P+    V+V  +D+  E+ + +  TV+E KK    K  +  P  + +L Y+DH      GPE MK  +R L+++ +   D   ++ K
Sbjct:   21 NFPYRRGPGVGVHVPATPQGSPMKD---RLNLPSVLVLNSCGITCAGDEREIAAFCAHVSELDLSDNKLQDWHEVSKIVSNVPQLEFLNLSSN---PLSLSVLERTCAGSFSGVRKLVLNNSKASWETVHTILQELPELEELFLCLNDY---ETVSCPSVCCHSLKLLHITDNNLQDWTEIRKLGVMFPSLDTLVLANNHL------NAIEEPADSLARLFPNLRSISLHKSGLQSWEDIDKLNSFPKLEEVRLLGIPLLQPYTTEERRKLVVARLPSVSKLNGSVVTDGEREDSERFFIRYYVDVPQEEVPFRYHELITKYGKLEPLAEVDLRPQSSAKVEVHFNDQVEEMSIRLDQTVAELKKQL--KTLVQLPTSSMLLYYFDHEAP--FGPEEMKYSSRALHSFGIRDGDKIFVESK 422          
BLAST of Tubulin-specific chaperone cofactor E-like protein vs. Ensembl Mouse
Match: Tbcel (tubulin folding cofactor E-like [Source:MGI Symbol;Acc:MGI:1925543])

HSP 1 Score: 100.523 bits (249), Expect = 2.188e-22
Identity = 122/421 (28.98%), Postives = 206/421 (48.93%), Query Frame = 3
Query:  120 DFVKRQYEEINTIVPDIVTFGMPKDNGTRRRLPSSLSLDGKEIELIDFDDSSLEMVEAVKSLHLNNNLINSWEYVINLLNNIPGLEXXXXXXXXXXQFQDSFVKLMPDIVYPKLKVLILNETGVPWEMVLSLLPRLPSLETLHLSKNIQPLSKEIAINSSPFPSVTQLFYNYNCCSDLQEICLMGDLFPCXXXXXXXXXXXXXXQPENQEDSEMNWLHYHFPRLTSLNVSENKLNKWDSVDYVESLQNVTDLRISNQPLFESLKADEIWNQLVARMGNISKLNGSTITDENRIDAQRAFMRYYLD--SDAKPPKFYDLQKXXXXXXXXXXXXLSPEHFIPVKVICDDRQLELIVDVRSTVSEAKKLFCQKFGISDPY-NFVLKYWDHVMTEIQGPELMKSGNRNLYAYRVSKNDWFTLDKK 1373
            +F  R+   +   VP        KD   R  LPS L L+   I     +         V  L L++N +  W  V  +++N+P LE LNLSSN       S ++      +  ++ L+LN +   WE V ++L  LP LE L L  N     + ++  S    S+  L    N   D  EI  +G +FP L+ L+L  N+L      N  +   + L   FP L S+++ ++ L  W+ +D + S   + ++R+   PL +    +E    +VAR+ ++SKLNGS +TD  R D++R F+RYY+D   +  P ++++L   +G +  +A ++L P+    V+V  +D+  E+ + +  TV+E KK    K  +  P  + +L Y+DH      GPE MK  +R L+++ +   D   ++ K
Sbjct:   21 NFPYRRGPGVGVHVPATPQGSPMKD---RLNLPSVLVLNSCGITCAGDEREIAAFCAHVSELDLSDNKLQDWHEVSKIVSNVPQLEFLNLSSN---PLSLSVLERTCAGSFSGVRKLVLNNSKASWETVHTILQELPELEELFLCLNDY---ETVSCPSVCCHSLKLLHITDNNLQDWTEIRKLGVMFPSLDTLVLANNHL------NAIEEPADSLARLFPNLRSISLHKSGLQSWEDIDKLNSFPKLEEVRLLGIPLLQPYTTEERRKLVVARLPSVSKLNGSVVTDGEREDSERFFIRYYVDVPQEEVPFRYHELITKYGKLEPLAEVDLRPQSSAKVEVHFNDQVEEMSIRLDQTVAELKKQL--KTLVQLPTSSMLLYYFDHEAP--FGPEEMKYSSRALHSFGIRDGDKIFVESK 422          
BLAST of Tubulin-specific chaperone cofactor E-like protein vs. Ensembl Mouse
Match: Tbcel (tubulin folding cofactor E-like [Source:MGI Symbol;Acc:MGI:1925543])

HSP 1 Score: 100.523 bits (249), Expect = 2.188e-22
Identity = 122/421 (28.98%), Postives = 206/421 (48.93%), Query Frame = 3
Query:  120 DFVKRQYEEINTIVPDIVTFGMPKDNGTRRRLPSSLSLDGKEIELIDFDDSSLEMVEAVKSLHLNNNLINSWEYVINLLNNIPGLEXXXXXXXXXXQFQDSFVKLMPDIVYPKLKVLILNETGVPWEMVLSLLPRLPSLETLHLSKNIQPLSKEIAINSSPFPSVTQLFYNYNCCSDLQEICLMGDLFPCXXXXXXXXXXXXXXQPENQEDSEMNWLHYHFPRLTSLNVSENKLNKWDSVDYVESLQNVTDLRISNQPLFESLKADEIWNQLVARMGNISKLNGSTITDENRIDAQRAFMRYYLD--SDAKPPKFYDLQKXXXXXXXXXXXXLSPEHFIPVKVICDDRQLELIVDVRSTVSEAKKLFCQKFGISDPY-NFVLKYWDHVMTEIQGPELMKSGNRNLYAYRVSKNDWFTLDKK 1373
            +F  R+   +   VP        KD   R  LPS L L+   I     +         V  L L++N +  W  V  +++N+P LE LNLSSN       S ++      +  ++ L+LN +   WE V ++L  LP LE L L  N     + ++  S    S+  L    N   D  EI  +G +FP L+ L+L  N+L      N  +   + L   FP L S+++ ++ L  W+ +D + S   + ++R+   PL +    +E    +VAR+ ++SKLNGS +TD  R D++R F+RYY+D   +  P ++++L   +G +  +A ++L P+    V+V  +D+  E+ + +  TV+E KK    K  +  P  + +L Y+DH      GPE MK  +R L+++ +   D   ++ K
Sbjct:   21 NFPYRRGPGVGVHVPATPQGSPMKD---RLNLPSVLVLNSCGITCAGDEREIAAFCAHVSELDLSDNKLQDWHEVSKIVSNVPQLEFLNLSSN---PLSLSVLERTCAGSFSGVRKLVLNNSKASWETVHTILQELPELEELFLCLNDY---ETVSCPSVCCHSLKLLHITDNNLQDWTEIRKLGVMFPSLDTLVLANNHL------NAIEEPADSLARLFPNLRSISLHKSGLQSWEDIDKLNSFPKLEEVRLLGIPLLQPYTTEERRKLVVARLPSVSKLNGSVVTDGEREDSERFFIRYYVDVPQEEVPFRYHELITKYGKLEPLAEVDLRPQSSAKVEVHFNDQVEEMSIRLDQTVAELKKQL--KTLVQLPTSSMLLYYFDHEAP--FGPEEMKYSSRALHSFGIRDGDKIFVESK 422          
BLAST of Tubulin-specific chaperone cofactor E-like protein vs. Ensembl Mouse
Match: Tbcel (tubulin folding cofactor E-like [Source:MGI Symbol;Acc:MGI:1925543])

HSP 1 Score: 100.523 bits (249), Expect = 2.805e-22
Identity = 122/421 (28.98%), Postives = 206/421 (48.93%), Query Frame = 3
Query:  120 DFVKRQYEEINTIVPDIVTFGMPKDNGTRRRLPSSLSLDGKEIELIDFDDSSLEMVEAVKSLHLNNNLINSWEYVINLLNNIPGLEXXXXXXXXXXQFQDSFVKLMPDIVYPKLKVLILNETGVPWEMVLSLLPRLPSLETLHLSKNIQPLSKEIAINSSPFPSVTQLFYNYNCCSDLQEICLMGDLFPCXXXXXXXXXXXXXXQPENQEDSEMNWLHYHFPRLTSLNVSENKLNKWDSVDYVESLQNVTDLRISNQPLFESLKADEIWNQLVARMGNISKLNGSTITDENRIDAQRAFMRYYLD--SDAKPPKFYDLQKXXXXXXXXXXXXLSPEHFIPVKVICDDRQLELIVDVRSTVSEAKKLFCQKFGISDPY-NFVLKYWDHVMTEIQGPELMKSGNRNLYAYRVSKNDWFTLDKK 1373
            +F  R+   +   VP        KD   R  LPS L L+   I     +         V  L L++N +  W  V  +++N+P LE LNLSSN       S ++      +  ++ L+LN +   WE V ++L  LP LE L L  N     + ++  S    S+  L    N   D  EI  +G +FP L+ L+L  N+L      N  +   + L   FP L S+++ ++ L  W+ +D + S   + ++R+   PL +    +E    +VAR+ ++SKLNGS +TD  R D++R F+RYY+D   +  P ++++L   +G +  +A ++L P+    V+V  +D+  E+ + +  TV+E KK    K  +  P  + +L Y+DH      GPE MK  +R L+++ +   D   ++ K
Sbjct:   39 NFPYRRGPGVGVHVPATPQGSPMKD---RLNLPSVLVLNSCGITCAGDEREIAAFCAHVSELDLSDNKLQDWHEVSKIVSNVPQLEFLNLSSN---PLSLSVLERTCAGSFSGVRKLVLNNSKASWETVHTILQELPELEELFLCLNDY---ETVSCPSVCCHSLKLLHITDNNLQDWTEIRKLGVMFPSLDTLVLANNHL------NAIEEPADSLARLFPNLRSISLHKSGLQSWEDIDKLNSFPKLEEVRLLGIPLLQPYTTEERRKLVVARLPSVSKLNGSVVTDGEREDSERFFIRYYVDVPQEEVPFRYHELITKYGKLEPLAEVDLRPQSSAKVEVHFNDQVEEMSIRLDQTVAELKKQL--KTLVQLPTSSMLLYYFDHEAP--FGPEEMKYSSRALHSFGIRDGDKIFVESK 440          
BLAST of Tubulin-specific chaperone cofactor E-like protein vs. UniProt/SwissProt
Match: sp|Q5QJ74|TBCEL_HUMAN (Tubulin-specific chaperone cofactor E-like protein OS=Homo sapiens OX=9606 GN=TBCEL PE=1 SV=2)

HSP 1 Score: 114.775 bits (286), Expect = 1.978e-26
Identity = 118/393 (30.03%), Postives = 199/393 (50.64%), Query Frame = 3
Query:  204 RRRLPSSLSLDGKEIELIDFDDSSLEMVEAVKSLHLNNNLINSWEYVINLLNNIPGLEXXXXXXXXXXQFQDSFVKLMPDIVYPKLKVLILNETGVPWEMVLSLLPRLPSLETLHLSKNIQPLSKEIAINSSPFPSVTQLFYNYNCCSDLQEICLMGDLFPCXXXXXXXXXXXXXXQPENQEDSEMNWLHYHFPRLTSLNVSENKLNKWDSVDYVESLQNVTDLRISNQPLFESLKADEIWNQLVARMGNISKLNGSTITDENRIDAQRAFMRYYLD--SDAKPPKFYDLQKXXXXXXXXXXXXLSPEHFIPVKVICDDRQLELIVDVRSTVSEAKKLFCQKFGISDPY-NFVLKYWDHVMTEIQGPELMKSGNRNLYAYRVSKNDWFTLDKK 1373
            R  LPS L L+   I     +         V  L L++N +  W  V  +++N+P LE LNLSSN       S ++      +  ++ L+LN +   WE V  +L  LP LE L L  N     + ++  S    S+  L    N   D  EI  +G +FP L+ L+L  N+L ++  E  +DS    L   FP L S+++ ++ L  W+ +D + S   + ++R+   PL +    +E    ++AR+ ++SKLNGS +TD  R D++R F+RYY+D   +  P ++++L   +G +  +A ++L P+    V+V  +D+  E+ + +  TV+E KK    K  +  P  N +L Y+DH      GPE MK  +R L+++ +   D   ++ K
Sbjct:   46 RLNLPSVLVLNSCGITCAGDEKEIAAFCAHVSELDLSDNKLEDWHEVSKIVSNVPQLEFLNLSSN---PLNLSVLERTCAGSFSGVRKLVLNNSKASWETVHMILQELPDLEELFLCLNDY---ETVSCPSICCHSLKLLHITDNNLQDWTEIRKLGVMFPSLDTLVLANNHLNAI--EEPDDS----LARLFPNLRSISLHKSGLQSWEDIDKLNSFPKLEEVRLLGIPLLQPYTTEERRKLVIARLPSVSKLNGSVVTDGEREDSERFFIRYYVDVPQEEVPFRYHELITKYGKLEPLAEVDLRPQSSAKVEVHFNDQVEEMSIRLDQTVAELKKQL--KTLVQLPTSNMLLYYFDHEAP--FGPEEMKYSSRALHSFGIRDGDKIYVESK 422          
BLAST of Tubulin-specific chaperone cofactor E-like protein vs. UniProt/SwissProt
Match: sp|Q5PQJ7|TBCEL_RAT (Tubulin-specific chaperone cofactor E-like protein OS=Rattus norvegicus OX=10116 GN=Tbcel PE=1 SV=1)

HSP 1 Score: 112.079 bits (279), Expect = 1.598e-25
Identity = 113/393 (28.75%), Postives = 197/393 (50.13%), Query Frame = 3
Query:  204 RRRLPSSLSLDGKEIELIDFDDSSLEMVEAVKSLHLNNNLINSWEYVINLLNNIPGLEXXXXXXXXXXQFQDSFVKLMPDIVYPKLKVLILNETGVPWEMVLSLLPRLPSLETLHLSKNIQPLSKEIAINSSPFPSVTQLFYNYNCCSDLQEICLMGDLFPCXXXXXXXXXXXXXXQPENQEDSEMNWLHYHFPRLTSLNVSENKLNKWDSVDYVESLQNVTDLRISNQPLFESLKADEIWNQLVARMGNISKLNGSTITDENRIDAQRAFMRYYLD--SDAKPPKFYDLQKXXXXXXXXXXXXLSPEHFIPVKVICDDRQLELIVDVRSTVSEAKKLFCQKFGISDPY-NFVLKYWDHVMTEIQGPELMKSGNRNLYAYRVSKNDWFTLDKK 1373
            R  LPS L L+   I     +         V  L L++N +  W  V  +++N+P LE LNLSSN       S ++      +  ++ L+LN +   WE V ++L  LP LE L L  N     + ++  S    S+  L    N   +  EI  +G +FP L+ L+L  N++      N  +   + L   FP L S+++ ++ L  W+ +D + S   + ++R+   PL +    +E    +VAR+ ++SKLNGS +TD  R D++R F+RYY+D   +  P ++++L   +G +  +A ++L P+    V+V  +D+  E+ + +  TV+E K+    K  +  P  + +L Y+DH      GPE MK  +R L+++ +   D   ++ K
Sbjct:   46 RLNLPSVLVLNSCGITCAGDEREIAAFCAHVSELDLSDNKLQDWHEVSKIVSNVPQLEFLNLSSN---PLSLSVLERTCAGSFSGVRKLVLNNSKASWETVHTILQELPDLEELFLCLNDY---ETVSCPSVCCHSLKLLHITDNNLQEWTEIRKLGVMFPSLDTLVLANNHV------NAIEEPADSLARLFPNLRSISLHKSGLQSWEDIDKLNSFPKLEEVRLLGIPLLQPYTTEERRKLVVARLPSVSKLNGSVVTDGEREDSERFFIRYYVDVPQEEVPFRYHELITKYGKLEPLAEVDLRPQSSAKVEVHFNDQVEEVSIRLDQTVAELKRQL--KTLVQLPTSSMLLYYFDHEAP--FGPEEMKYSSRALHSFGIRDGDKIFVESK 422          
BLAST of Tubulin-specific chaperone cofactor E-like protein vs. UniProt/SwissProt
Match: sp|Q8C5W3|TBCEL_MOUSE (Tubulin-specific chaperone cofactor E-like protein OS=Mus musculus OX=10090 GN=Tbcel PE=1 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 1.531e-21
Identity = 122/421 (28.98%), Postives = 206/421 (48.93%), Query Frame = 3
Query:  120 DFVKRQYEEINTIVPDIVTFGMPKDNGTRRRLPSSLSLDGKEIELIDFDDSSLEMVEAVKSLHLNNNLINSWEYVINLLNNIPGLEXXXXXXXXXXQFQDSFVKLMPDIVYPKLKVLILNETGVPWEMVLSLLPRLPSLETLHLSKNIQPLSKEIAINSSPFPSVTQLFYNYNCCSDLQEICLMGDLFPCXXXXXXXXXXXXXXQPENQEDSEMNWLHYHFPRLTSLNVSENKLNKWDSVDYVESLQNVTDLRISNQPLFESLKADEIWNQLVARMGNISKLNGSTITDENRIDAQRAFMRYYLD--SDAKPPKFYDLQKXXXXXXXXXXXXLSPEHFIPVKVICDDRQLELIVDVRSTVSEAKKLFCQKFGISDPY-NFVLKYWDHVMTEIQGPELMKSGNRNLYAYRVSKNDWFTLDKK 1373
            +F  R+   +   VP        KD   R  LPS L L+   I     +         V  L L++N +  W  V  +++N+P LE LNLSSN       S ++      +  ++ L+LN +   WE V ++L  LP LE L L  N     + ++  S    S+  L    N   D  EI  +G +FP L+ L+L  N+L      N  +   + L   FP L S+++ ++ L  W+ +D + S   + ++R+   PL +    +E    +VAR+ ++SKLNGS +TD  R D++R F+RYY+D   +  P ++++L   +G +  +A ++L P+    V+V  +D+  E+ + +  TV+E KK    K  +  P  + +L Y+DH      GPE MK  +R L+++ +   D   ++ K
Sbjct:   21 NFPYRRGPGVGVHVPATPQGSPMKD---RLNLPSVLVLNSCGITCAGDEREIAAFCAHVSELDLSDNKLQDWHEVSKIVSNVPQLEFLNLSSN---PLSLSVLERTCAGSFSGVRKLVLNNSKASWETVHTILQELPELEELFLCLNDY---ETVSCPSVCCHSLKLLHITDNNLQDWTEIRKLGVMFPSLDTLVLANNHL------NAIEEPADSLARLFPNLRSISLHKSGLQSWEDIDKLNSFPKLEEVRLLGIPLLQPYTTEERRKLVVARLPSVSKLNGSVVTDGEREDSERFFIRYYVDVPQEEVPFRYHELITKYGKLEPLAEVDLRPQSSAKVEVHFNDQVEEMSIRLDQTVAELKKQL--KTLVQLPTSSMLLYYFDHEAP--FGPEEMKYSSRALHSFGIRDGDKIFVESK 422          
BLAST of Tubulin-specific chaperone cofactor E-like protein vs. UniProt/SwissProt
Match: sp|Q5FVQ9|TBCE_RAT (Tubulin-specific chaperone E OS=Rattus norvegicus OX=10116 GN=Tbce PE=2 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 8.910e-14
Identity = 74/264 (28.03%), Postives = 129/264 (48.86%), Query Frame = 3
Query:  279 EMVEAVKSLHLNNNLINSWEYVINLLNNIPGLEXXXXXXXXXXQFQDSFVKLMPDIVYPKLKVLILNETGVPWEMVLSLLPRLPSLETLHLSKNIQPLSKEIAINSSPFPSVTQLFY---NYNCCSDLQEICLMGDLFPCXXXXXXXXXXXXXXQPENQEDSEMNWLHYHFPRLTSLNVSENKLNKWDSVDYVESLQNVTDLRISNQPLFESLKADEIWNQLVARMGNISKLNGSTITDENR----IDAQRAFMRYYLDSDAKP 1049
            E    ++ + L+ NL+++W+ VI +   +  LE+L+LS N L QF      L     +  LK L+LN+TG+ W  VL   P  P L+ L+L  N       I+I+  P  ++  L     + N   D  ++CL+  L      L+          P    D+E+      FP LT L V++N++++W  ++ ++ LQ++  L  +  PL +  KA+EI   ++A++G +  LN   I  E R    +D ++AF + +  +   P
Sbjct:  150 EACPNIRVVDLSKNLLSTWDEVILIAEQLKDLEALDLSENKL-QFPSDSPTLTR--TFSTLKTLVLNKTGITWTEVLHCAPSWPVLQELYLKSN------GISISERPVNALQNLRLLDLSSNPSIDESQLCLIAYLPRLEHLLLSDIGLSSIHFP----DAEIGCKTSMFPALTYLIVNDNQISEWSFINELDKLQSLQALSCARNPLTKGDKAEEI---IIAKIGQLKTLNRCQILPEERRGAELDYRKAFGKEWRKAGGHP 397          
BLAST of Tubulin-specific chaperone cofactor E-like protein vs. UniProt/SwissProt
Match: sp|Q8GRL7|TBCE_ARATH (Tubulin-folding cofactor E OS=Arabidopsis thaliana OX=3702 GN=TFCE PE=2 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 1.213e-13
Identity = 83/271 (30.63%), Postives = 128/271 (47.23%), Query Frame = 3
Query:  294 VKSLHLNNNLINSWEYVINLLNNIPGLEXXXXXXXXXXQFQDSFVKLMPDIVYPKLKVLILNETGVPWEMVLSLLPRLPSLETLHLSKNIQPLSKEIAI-NSSPFPSVTQLFYNYNCCSDLQEICLMGDLFPCXXXXXXXXXXXXX--XQPENQEDSEMNWLHYHFPRLTSLNVSENKLNKWDSVDYVESLQNVTDLRISNQPLFESLKADEIWNQLVARMGNISKLNGSTITDENRIDAQRAFMRYYL----DSDAK----PPKFYDLQK 1073
            +K L L  NLI+ WE +  L   +P L +LNLS N L     S +K +P +    ++VL+LN +G+ W  V  L   LP +E LHL  N+       +  +   F S+  L  + NC SD  E+  +  L PCLE L L  N L          E SE       FP L+ L +  N +    SVD +     + D+R+S  P+ + ++       LVAR+  +  LNGS +    + D++  ++R  +    D   +     P+FY+L+K
Sbjct:  162 LKLLDLTGNLISDWEEIGALCEQLPALTTLNLSCNSL----SSDIKSLPQL--KNIRVLVLNNSGLSWTQVEILRRSLPGIEELHLMGNMISTITSTSSSDDQAFNSLRLLNLDDNCISDWSEVLKLSQL-PCLEQLYLNKNKLSRIFQSVNGTESSEKG--SDPFPSLSCLLLGANNIGDLASVDALNGFPQLVDIRLSENPISDPVRGGVPRFVLVARLTKVQVLNGSEVRAREKKDSEIRYVRMVMSKLNDKSGEIELLHPRFYELKK 423          
BLAST of Tubulin-specific chaperone cofactor E-like protein vs. TrEMBL
Match: V4AFH6 (Ubiquitin-like domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_104573 PE=4 SV=1)

HSP 1 Score: 155.221 bits (391), Expect = 1.279e-38
Identity = 128/396 (32.32%), Postives = 205/396 (51.77%), Query Frame = 3
Query:  192 DNGTRRRLPSSLSLDGKEIELIDFDDSSLEMVEAVKSLHLNNNLINSWEYVINLLNNIPGLEXXXXXXXXXXQFQDSFVKLMPDIVYPKLKVLILNETGVPWEMVLSLLPRLPSLETLHLSKNIQPLSKEIAINSSPFPSVTQLFYNYNCCSDLQEICLMGDLFPCXXXXXXXXXXXXXXQPENQEDSEMNWLHYHFPRLTSLNVSENKLNKWDSVDYVESLQNVTDLRISNQPLFESLKADEIWNQL-VARMGNISKLNGSTITDENRIDAQRAFMRYYLDSD--AKPPKFYDLQKXXXXXXXXXXXXLSPEHFIPVKVICDDRQLELIVDVRSTVSEAKKLFCQKFGISDPYNFVLKY----WDHVMTEIQGPELMKSGNRNLYAYRVSKNDWF 1358
            ++G    LP  LSL    I      +    M   V  L L  N + +WE ++ +L  IPGL  LNL+SN     Q +      D+ +P +  L++N TGV W  V SLL   P L  LHLS N    + + +++  P+ ++  L +N N      EIC +G  FP +E  ++  NN+ S+QPE+        L   FP L  LN+++  L  W  +D +     + D+R+   P FE+L  D +  QL +AR+ N++ LNGS I +  R DA+RAF+R+Y+D D   KP ++Y+L++++G ++ +  ++L P+    V V  +  + ++ VD   TV++ KK   +  G+  P  F L Y    + +  +   G E MK G R LY Y ++  D+F
Sbjct:    8 ESGDLLSLPKVLSLTDSHIAAAGNVEEIERMCHDVCELDLTKNALTNWEEILKILERIPGLNFLNLTSN---DLQSTLQLGSDDLCFPTVNHLVVNNTGVTWSTVDSLLQLFPELTELHLSLN-NYTNIDFSLDE-PYSALKTLHFNGNNVHSYHEICKIGYNFPNMERFVMTENNISSIQPED-------VLPDAFPSLQCLNLNKTPLQDWQELDKLRKFPKLKDVRLLKIPCFETLD-DNLRRQLQIARLPNLTHLNGSRIAETEREDAERAFIRHYMDKDDNHKPQRYYELERVYGKLDPLVELDLKPKTHFSVTVQFESEEKKIKVDTNKTVAQLKKSLEEFVGVP-PSKFRLFYVAEEYYNSDSSGYGSEEMKYGTRQLYRYNINNGDYF 389          
BLAST of Tubulin-specific chaperone cofactor E-like protein vs. TrEMBL
Match: A0A2T7P2Z4 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_12950 PE=4 SV=1)

HSP 1 Score: 156.762 bits (395), Expect = 1.045e-37
Identity = 106/324 (32.72%), Postives = 181/324 (55.86%), Query Frame = 3
Query:  411 FQDSFVKLMPDIVYPKLKVLILNETGVPWEMVLSLLPRLPSLETLHLSKNIQPLSKEIAINSSP---FPSVTQLFYNYNCCSDLQEICLMGDLFPCXXXXXXXXXXXXXXQPENQEDSEMNWLHYHFPRLTSLNVSENKLNKWDSVDYVESLQNVTDLRISNQPLFESLKADEIWNQLVARMGNISKLNGSTITDENRIDAQRAFMRYYLDSDAKPPKFYDLQKXXXXXXXXXXXXLSPEHFIPVKVICDDRQLELIVDVRSTVSEAKKLFCQKFGISDPYNFVLKYWDHVMTEIQGPELMKSGNRNLYAYRVSKNDWFTLDKK 1373
            F  S  +L   + +P L+ L+LN+T V W+ ++ LL   P+LE LHLS     L+   +++  P   +PS+ ++F+N N      EI  +G  FP           L   + E +   E + +   FP L+ L++++ +L  WD ++ +  L ++ D+R+   P  ES++A E    LVAR+ N+++LNGS +TDE R DA+RAF+R ++DS+ KP ++Y+L+KI+G ++ +A +NL P+    VKV+ +DR  EL V+   +V E KK      G+     F + Y D  +    G E ++  ++ LY Y+++  D F ++ K
Sbjct:  300 FSCSPTELPTSLCFPNLRQLVLNDTQVDWQSIVQLLKIFPNLEELHLS-----LNHYTSVDLLPDLLYPSLVRIFFNGNKVCAWSEINKLGRAFP-------SLQQLFLAETELRTLDETDCMAESFPCLSLLSLNKTQLEGWDILERLRLLPSLIDVRLQGIPFLESMEAKERRQLLVARLPNVTRLNGSPVTDEEREDAERAFIRLFMDSEQKPARYYELEKIYGKLDPLAKVNLKPQRVFRVKVVFNDRCEELEVNANQSVRELKKTLQNLVGLP-ASRFSVFYVDKQID--MGAERLRFPDKKLYTYKLTDGDEFIVEPK 608          
BLAST of Tubulin-specific chaperone cofactor E-like protein vs. TrEMBL
Match: A0A1S3JK88 (tubulin-specific chaperone cofactor E-like protein isoform X3 OS=Lingula unguis OX=7574 GN=LOC106173981 PE=4 SV=1)

HSP 1 Score: 152.525 bits (384), Expect = 1.937e-37
Identity = 115/345 (33.33%), Postives = 189/345 (54.78%), Query Frame = 3
Query:  213 LPSSLSLDGKEIELIDFDDSSLEMVEAVKSLHLNNNLINSWEYVINLLNNIPGLEXXXXXXXXXXQFQDSFVKLMPDIVYPKLKVLILNETGVPWEMVLSLLPRLPSLETLHLSKNIQPLSKEIAINSSPFPSVTQLFYNYNCCSDLQEICLMGDLFP--CXXXXXXXXXXXXXXQPENQEDSEMNWLHYHFPRLTSLNVSENKLNKWDSVDYVESLQNVTDLRISNQPLFESLKADEIWNQLVARMGNISKLNGSTITDENRIDAQRAFMRYYLDSDAKPPKFYDLQKXXXXXXXXXXXXLS-PEHFIPVKVICDDRQLELIVDVRSTVSEAKKLFCQKFGISD 1238
            LP  L+++   I     ++    + + V  L + NN I+ W+ +  +++ +P +ES+N S NPL    D  V    +  +P +K LILN+TG  W  V  LL  +PS+E LHLS N      E+ +    +P+V  L +N N   D  EIC +G  FP  C   +     +L        +DSE   +   FP++ SLN ++  +  W+ +D + S   +TD+R+   PL E +K ++    L+AR+  I++LNGS I +E R  A+RAF+R+++DS+ KP ++ +L+K HG ++ +A++NL  P H + V+V  D +   + ++V  TV E K L  + F ISD
Sbjct:   57 LPRQLAMNYHSITHAGNEEEIANLCDKVTELDIANNCISDWKEIFKMMSVMPKIESINFSCNPLMAEIDDEVG---NQSFPNIKRLILNKTGAAWRTVEVLLKIMPSVEELHLSLNDY---TEVDLKEK-YPNVVNLHFNANKLRDWGEICKLGRAFPNLCNLVMAESEVSLC-------DDSE---VEASFPKVVSLNANKIGITSWEEIDRLNSFPALTDVRLQGVPLLEDMKEEQRRQFLIARLPRINRLNGSKIQEEERDKAERAFLRHFMDSEEKPERYMELEKTHGQLDPLADVNLGPPTHTVTVRVTYDTKVKMMQLNVNQTVQELKVLLKKTFDISD 384          
BLAST of Tubulin-specific chaperone cofactor E-like protein vs. TrEMBL
Match: A0A1S3JPI2 (tubulin-specific chaperone cofactor E-like protein isoform X3 OS=Lingula unguis OX=7574 GN=LOC106174768 PE=4 SV=1)

HSP 1 Score: 151.369 bits (381), Expect = 6.128e-37
Identity = 115/343 (33.53%), Postives = 190/343 (55.39%), Query Frame = 3
Query:  213 LPSSLSLDGKEIELIDFDDSSLEMVEAVKSLHLNNNLINSWEYVINLLNNIPGLEXXXXXXXXXXQFQDSFVKLMPDIVYPKLKVLILNETGVPWEMVLSLLPRLPSLETLHLSKNIQPLSKEIAINSSPFPSVTQLFYNYNCCSDLQEICLMGDLFPCXXXXXXXXXXXXXXQPENQEDSEMNWLHYHFPRLTSLNVSENKLNKWDSVDYVESLQNVTDLRISNQPLFESLKADEIWNQLVARMGNISKLNGSTITDENRIDAQRAFMRYYLDSDAKPPKFYDLQKXXXXXXXXXXXXLS-PEHFIPVKVICDDRQLELIVDVRSTVSEAKKLFCQKFGISD 1238
            LP  L+++   I     ++    + + V  L + NN I+ W+ +  +++ +P +ES+N S NPL    D  V    +  +P +K LILN+TG  W  V  LL  +PS+E LHLS N      E+ +    +P+V  L +N N   D  EIC +G  FP L NL++  + +        E+S        FP++ SLN ++  +  W+ +D + S   +TD+R+   PL E +K ++    L+AR+  I++LNGS I +E R  A+RAF+R+++DS+ KP ++ +L+K HG ++ +A++NL  P H + V+V  D +   + ++V  TV E K L  + F ISD
Sbjct:   57 LPRQLAMNYHSITHAGNEEEIANLCDKVTELDIANNCISDWKEIFKMMSVMPKIESINFSCNPLMAEIDDEVG---NQSFPNIKRLILNKTGAAWSTVEVLLKIMPSVEELHLSLNDY---TEVDLKEK-YPNVVNLHFNANKLRDWGEICKLGRAFPNLCNLVMAESEMSLCDDLEIEES--------FPKVVSLNANKIGITSWEEIDRLNSFPALTDVRLQGVPLLEDMKEEQRRQFLIARLPRINRLNGSKIQEEERDKAERAFLRHFMDSEEKPERYMELEKTHGQLDPLADVNLGPPTHTVTVRVTYDTKVKMMQLNVNQTVQELKVLLKKTFDISD 384          
BLAST of Tubulin-specific chaperone cofactor E-like protein vs. TrEMBL
Match: R7USN7 (Uncharacterized protein (Fragment) OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_44184 PE=4 SV=1)

HSP 1 Score: 146.747 bits (369), Expect = 1.571e-35
Identity = 122/381 (32.02%), Postives = 204/381 (53.54%), Query Frame = 3
Query:  213 LPSSLSLDGKEIELIDFDDSSLEMVEAVKSLHLNNNLINSWEYVINLLNNIPGLEXXXXXXXXXXQFQDSFVKLMPDIVYPKLKVLILNETGVPWEMVLSLLPRLPSLETLHLS----KNIQPLSKEIAINSSPFPSVTQLFYNYNCCSDLQE-ICLMGDLFPCXXXXXXXXXXXXXXQPENQEDSEMNWLHYHFPRLTSLNVSENKLNKWDSVDYVESLQNVTDLRISNQPLFESLKADEIWNQLVARMGNISKLNGSTITDENRIDAQRAFMRYYLDSDAKPPKFYDLQKXXXXXXXXXXXXLSPEHFIPVKVICDDRQLELIVDVRSTVSEAKKLFCQKFGISDPYNFVLKYWDHVMTEIQGPELMKSGNRNLYAYRV 1340
            LP  L+++G  + +   + S   M   +  L L +N + +W  V NLL+ +P +  LNL +NPL    DS   +     +P L  LILN T + WE +  LL  LP+L  LHLS      ++PL  +       FPSV +L+ N     + ++ +C++G +FPCLENL++L N + SL    +E  E       FP L SLN+SE +L +W  V+ ++    ++ +R+      + +        L+A + N+ +LN S I +  R DA+RA +RYY+D   KPP++Y+L++IHG ++ +  ++ + +  + V V  +DR     +DV  T+ +A+ L  ++ G+  P +F L + D +    QGP+ M   +R+L  Y V
Sbjct:    8 LPKQLAVNGCHVSVAGDEQSLCNMCAGIMELDLTDNRLKNWSEVFNLLHCMPRVHFLNLCNNPL--LADSLDDITNLPSFPLLTKLILNSTLLTWEAIFKLLGLLPNLGELHLSLIELNELRPLESDFR-----FPSVKELYINRIGIDNSEKTLCVLGRIFPCLENLVMLNNAVTSLASTQKEIRE------SFPCLKSLNISETELQEWSEVEKIKFFPVLSSVRLQGIQFLQEIDEKLRRQLLIAYLPNVQRLNASLINETERNDAERACIRYYMDRPEKPPRYYELEEIHGRLDPLVTVDFTAQSSVTVMVKYEDRSFLKALDVHMTMKQARNLLTKELGLR-PKDFTLLHNDILCP--QGPDRMSYPDRHLRRYGV 372          
BLAST of Tubulin-specific chaperone cofactor E-like protein vs. Ensembl Cavefish
Match: tbcela (tubulin-specific chaperone cofactor E-like protein [Source:NCBI gene;Acc:103024414])

HSP 1 Score: 125.946 bits (315), Expect = 2.834e-31
Identity = 123/413 (29.78%), Postives = 204/413 (49.39%), Query Frame = 3
Query:  120 DFVKRQYEEINTIVPDIVTFGMPKDNGTRRRLPSSLSLDGKEIELIDFDDSSLEMVEAVKSLHLNNNLINSWEYVINLLNNIPGLEXXXXXXXXXXQFQDSFVKLMPDIVYPKLKVLILNETGVPWEMVLSLLPRLPSLETLHLSKNIQPLSKEIAINSSPFPSVTQLFYNYNCCSDLQEICLMGDLFPCXXXXXXXXXXXXXXQPENQEDSEMNWLHYHFPRLTSLNVSENKLNKWDSVDYVESLQNVTDLRISNQPLFESLKADEIWNQLVARMGNISKLNGSTITDENRIDAQRAFMRYYLD--SDAKPPKFYDLQKXXXXXXXXXXXXLSPEHFIPVKVICDDRQLELIVDVRSTVSEAKKLFCQKFGISDPYNFVLKYWDHVMTEIQGPELMKSGNRNLYAYRVSKND 1352
            +F  R+   +  +VP        KD   R  LPS L L+G  I     +         V  L L++N +  W  +  ++ NIP L+ LNLSSN      D+ ++      + +L+ L+LN T V W++V +L+  +P LE L L  N       +  +++  PS+  L    N   D  E+   G +FP L+  +L  NNL S+      DS  N L   FP L S+N+  + L++W+ ++ +  L  + ++R+   PL ++    E  + ++A++ +++ LNGS +T   R DA+R F+RY+LD   +  P +++ L   +G +  +A I+L P     V+V C+DR  ++ + +  TV+E KK       +S   N  L Y D  M    GPE MK   R L++Y +   D
Sbjct:   23 NFPYRRGPGMGVVVPTGHQGSPMKD---RLNLPSMLVLNGCGISNAGDEAEIAAFCAHVVELDLSHNKLQDWHEISKIVANIPNLDFLNLSSN---PLSDAVLEPESAEAFSRLRRLVLNNTQVSWDIVHTLMREMPELEELFLCLNEY---NTVTASTTACPSLRLLHITDNNLQDWSEVRKFGSMFPSLDTFVLANNNLGSIL-----DSGDN-LRRLFPNLRSVNLHNSGLSRWEDIENLNFLPKLKEVRLQGIPLLQTYTNTERRSLMIAQLPSVTCLNGSVVTGGEREDAERFFIRYHLDYPKEELPHRYHCLVTKYGKLAPLAEIDLRPRCHAKVEVHCEDRVEQVSIRLDQTVAELKKQLRTVVQLSTS-NMRLYYIDKDMCSAFGPEEMKYSTRALHSYSIRDGD 419          
BLAST of Tubulin-specific chaperone cofactor E-like protein vs. Ensembl Cavefish
Match: tbcela (tubulin-specific chaperone cofactor E-like protein [Source:NCBI gene;Acc:103024414])

HSP 1 Score: 119.398 bits (298), Expect = 4.833e-29
Identity = 109/355 (30.70%), Postives = 184/355 (51.83%), Query Frame = 3
Query:  294 VKSLHLNNNLINSWEYVINLLNNIPGLEXXXXXXXXXXQFQDSFVKLMPDIVYPKLKVLILNETGVPWEMVLSLLPRLPSLETLHLSKNIQPLSKEIAINSSPFPSVTQLFYNYNCCSDLQEICLMGDLFPCXXXXXXXXXXXXXXQPENQEDSEMNWLHYHFPRLTSLNVSENKLNKWDSVDYVESLQNVTDLRISNQPLFESLKADEIWNQLVARMGNISKLNGSTITDENRIDAQRAFMRYYLD--SDAKPPKFYDLQKXXXXXXXXXXXXLSPEHFIPVKVICDDRQLELIVDVRSTVSEAKKLFCQKFGISDPYNFVLKYWDHVMTEIQGPELMKSGNRNLYAYRVSKND 1352
            V  L L++N +  W  +  ++ NIP L+ LNLSSN      D+ ++      + +L+ L+LN T V W++V +L+  +P LE L L  N       +  +++  PS+  L    N   D  E+   G +FP L+  +L  NNL S+      DS  N L   FP L S+N+  + L++W+ ++ +  L  + ++R+   PL ++    E  + ++A++ +++ LNGS +T   R DA+R F+RY+LD   +  P +++ L   +G +  +A I+L P     V+V C+DR  ++ + +  TV+E KK       +S   N  L Y D  M    GPE MK   R L++Y +   D
Sbjct:   65 VVELDLSHNKLQDWHEISKIVANIPNLDFLNLSSN---PLSDAVLEPESAEAFSRLRRLVLNNTQVSWDIVHTLMREMPELEELFLCLNEY---NTVTASTTACPSLRLLHITDNNLQDWSEVRKFGSMFPSLDTFVLANNNLGSIL-----DSGDN-LRRLFPNLRSVNLHNSGLSRWEDIENLNFLPKLKEVRLQGIPLLQTYTNTERRSLMIAQLPSVTCLNGSVVTGGEREDAERFFIRYHLDYPKEELPHRYHCLVTKYGKLAPLAEIDLRPRCHAKVEVHCEDRVEQVSIRLDQTVAELKKQLRTVVQLSTS-NMRLYYIDKDMCSAFGPEEMKYSTRALHSYSIRDGD 406          
BLAST of Tubulin-specific chaperone cofactor E-like protein vs. Ensembl Cavefish
Match: tbcelb (tubulin-specific chaperone cofactor E-like protein [Source:NCBI gene;Acc:103043446])

HSP 1 Score: 115.931 bits (289), Expect = 1.014e-27
Identity = 111/387 (28.68%), Postives = 187/387 (48.32%), Query Frame = 3
Query:  204 RRRLPSSLSLDGKEIELIDFDDSSLEMVEAVKSLHLNNNLINSWEYVINLLNNIPGLEXXXXXXXXXXQFQDSFVKLMPDIVYPKLKVLILNETGVPWEMVLSLLPRLPSLETLHLSKNIQPLSKEIAINSSPFPSVTQLFYNYNCCSDLQEICLMGDLFP-CXXXXXXXXXXXXXXQPENQEDSEMNWLHYHFPRLTSLNVSENKLNKWDSVDYVESLQNVTDLRISNQPLFESLKADEIWNQLVARMGNISKLNGSTITDENRIDAQRAFMRYYLD--SDAKPPKFYDLQKXXXXXXXXXXXXLSPEHFIPVKVICDDRQLELIVDVRSTVSEAKKLFCQKFGISDPYNFVLKYW-DHVMTEIQGPELMKSGNRNLYAYRVSKND 1352
            R  LPS L LDG  I     ++        V  L L+NN    W  +  +L+NIP L+ LNLS NP    Q S +  +    +  L+ L+LN T VPW+MV  L   +P LE L L  N     + ++++     S+  L    N   D  E+  +G L+P     ++   +     +PE+        +   FP LTS+N+  + LN W+ ++ + S   + ++R+   PL +     E    +VA + ++S LNGS +TD  R DA+R ++RY+LD   D  P +F++L   +G +  +A ++L P     V++   D   +L + +  TV++ KK    +  +  P N +  Y+ D  +     P+ ++ G R L++Y +   D
Sbjct:   48 RLNLPSVLVLDGCGITHAGDEEEVATFCSHVVELDLSNNQFKDWGEISKILSNIPHLDFLNLSMNP---LQGSSLDSVSAENFSGLRRLVLNNTHVPWDMVHILTQEIPELEELFLCLNEY---ERVSLSPVACSSLRLLHITDNQLQDWGEVRKLGLLYPGLASLILANNSLSSIHEPEDA-------VQRLFPNLTSINLHNSGLNSWEDIEKLNSFPKLQEVRLMGIPLLQPYTDQERRYLIVANLPSVSVLNGSVVTDGEREDAERFYIRYHLDCPEDELPQRFHNLVARYGRLEPLAEVDLRPLSSAQVELRFADHSEQLELRLDQTVADFKKQL--RPLVQLPANKMRVYYIDRQLGYALAPQELRYGARALHSYSIRDGD 419          
BLAST of Tubulin-specific chaperone cofactor E-like protein vs. Ensembl Sea Lamprey
Match: tbcelb (tubulin folding cofactor E-like b [Source:ZFIN;Acc:ZDB-GENE-100921-13])

HSP 1 Score: 97.4413 bits (241), Expect = 2.431e-22
Identity = 107/391 (27.37%), Postives = 186/391 (47.57%), Query Frame = 3
Query:  213 LPSSLSLDGKEIELIDFDDSSLEMVEAVKSLHLNNNLINSWEYVINLLNNIPGLEXXXXXXXXXXQFQDSFVKLMPDIVYPKLKVLILNETGVPWEMVLSLLPRLPSLETLHLSKNIQPLSKEIAINSSPFPSVTQLFYNYNCCSDLQEICLMGDLFPCXXXXXXXXXXXXXXQPENQEDSEMNWLHYHFPRLTSLNVSENKLNKWDSVDYVESLQNVTDLRISNQPLFESLKADEIWNQLVARMGNISKLNGSTITDENRIDAQRAFMRYYLD--SDAKPPKFYDLQKXXXXXXXXXXXXLSPEHFIPVKVICDDRQLELIVDVRSTVSEAKKLFCQKFGISDPYNFVLKYWDHVMTEI--QGPELMKSGNRNLYAYRVSKNDWFTLDKK 1373
            +P  L L+  +I     +   LE+   V  L L++N    WE +  ++  +P ++ LNLS+NPL           P +  P L+ L+LN T   WE V +LL  +P LE L L  N       + ++   + ++  L    N   + Q++ ++G +FP LE ++L  N + SL  E  E      L   F  L  LN+    L+ W  V+ +    ++ +LR+   PL      ++     VAR+  +  LNGS ++D  R DA+R F+RYY+D  ++ +P +  +LQ+ HG +  +A ++L+P+    V+V  D     L + +  TV++ K+   +     +    +  +  HV   +  Q  E M+   RN++ Y V   D   + +K
Sbjct:    5 VPPILVLNMCDIAAAGDESQILELCSHVTELDLSHNSFKDWEEIGKIVGQMPRMQFLNLSANPLGTCPSP-----PSLRLPSLRKLVLNNTKTSWETVHTLLRNMPQLEELFLCLNDY---TTVVVSPDVYHNMKLLHITDNQLREWQDVLMLGLIFPSLETMVLSNNRVGSLSSEPAE------LTQAFTNLKHLNLHNWGLSDWSDVEKLNHFPSLEELRLLGIPLLSEYNDEQRRKLTVARLPAVQVLNGSWVSDSEREDAERFFIRYYMDFPTNQQPSRLAELQERHGQLEPLAEVDLTPKDVAQVQVHFDGCCRALAIRLDQTVAQLKRELREALESREGTCRIRIF--HVAENMGAQIVEEMRFPRRNVHTYGVRDGDEIHVMRK 379          
BLAST of Tubulin-specific chaperone cofactor E-like protein vs. Ensembl Nematostella
Match: EDO32674 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUE6])

HSP 1 Score: 112.079 bits (279), Expect = 7.069e-27
Identity = 120/398 (30.15%), Postives = 204/398 (51.26%), Query Frame = 3
Query:  195 NGTRRRLPSSLSLDGKEIELIDFDDSSLEMVEAVKSLHLNNNLINSWEYVINLLNNIPGLEXXXXXXXXXXQFQDSFVKLMPDIV---YPKLKVLILNETGVPWEMVLSLLPRLPSLETLHLSKNIQPLSKEIAINSSPFPSVTQLFYNYNCCSDLQEICLMGDLFPCXXXXXXXXXXXXXXQPENQEDSEMNWLHYHFPRLTSLNVSENKLNKWDSVDYVESLQNVTDLRISNQPLFESLKADEIWNQLVARMGNISKLNGSTITDENRIDAQRAFMRYYLDSDAKPPKFYDLQKXXXXXXXXXXXXLSPEHFIPVKVICDDRQ-LELIVDVRSTVSEAKKLFCQKFGISDPYN-FVLKYWDHVMTEIQGPELMKSGNRNLYAYRVSKNDWFTLDKK 1373
            N ++RR   ++SLD  ++    F     E+   V+ L L+ N I+ W  V ++L+ +  LE LNLS+NPL      F +L+ +      P ++ LILN+T V       LL  LP ++ L +S N       I      +PS+  LF N +   D  EI  +G +FP LE L++  + +E++ P  +           FP L +L +++  + +W  +D + +  ++ D+R+   PL E+    E    L+AR+ NI+KLNG+ + +E R DA+R F+R+++D    P ++ DL + HG ++ +A+++L P+    V V  +++    + +D+  TV E KK    + GI  P N  VL ++D V     G   MK  N  LY Y+V   +   + +K
Sbjct:   47 NFSKRR---TISLDNCDVTCAGFPGEIRELCPNVEELDLHTNKISDWREVFSILSQLQRLECLNLSNNPLPTEDTDFTELLTESCPSGVPPVRQLILNDTAVSLATTYKLLDCLPGVQVLFVSLNDY---DTIPNTDKTYPSIKHLFMNNHAIQDWAEITNIGRIFPKLEELVMSESPIENISPTGE----------LFPNLHTLKLNKTAIGRWADIDALNTFPSLRDIRLLGIPLIENYSDKEQRQLLIARLPNITKLNGTKVDEEEREDAERLFIRHHMDDTDPPQRYRDLVQQHGVLDKLADVDLDPKTVANVIVRYEEQSPFRVDLDLTQTVKELKKYLSNELGI--PSNKMVLLHFDPVAP--FGAVEMKYLNNPLYYYKVYDGNELLVHRK 424          
BLAST of Tubulin-specific chaperone cofactor E-like protein vs. Ensembl Medaka
Match: tbcela (tubulin-specific chaperone cofactor E-like protein [Source:NCBI gene;Acc:101167062])

HSP 1 Score: 122.094 bits (305), Expect = 6.147e-30
Identity = 123/404 (30.45%), Postives = 200/404 (49.50%), Query Frame = 3
Query:  153 TIVPDIVTFGMPKDNGTRRRLPSSLSLDGKEIELIDFDDSSLEMVEAVKSLHLNNNLINSWEYVINLLNNIPGLEXXXXXXXXXXQFQDSFVKLMPDIV--YPKLKVLILNETGVPWEMVLSLLPRLPSLETLHLSKNIQPLSKEIAINSSPFPSVTQLFYNYNCCSDLQEICLMGDLFPCXXXXXXXXXXXXXXQPENQEDSEMNWLHYHFPRLTSLNVSENKLNKWDSVDYVESLQNVTDLRISNQPLFESLKADEIWNQLVARMGNISKLNGSTITDENRIDAQRAFMRYYLDSDAK--PPKFYDLQKXXXXXXXXXXXXLSPEHFIPVKVICDDRQLELIVDVRSTVSEAKKLFCQKFGISDPYNFVLKYWDHVMTEIQGPELMKSGNRNLYAYRVSKND 1352
             ++P     G P  +  R  LPS L L    I               V  + L++N +  W  +  ++ NIP LE +NLSSNPL +      +L P +   + +++ L+LN T + W+ VL L  ++P LE L L  N       +  +S   P++  L    N   D  E+   G +FP LE L++  NNL S+Q     DS+ + L   FP L S+N+  + LN+W+ V+ +     + ++R+   PL ++    E  + +VAR+ ++S LNGS +TD  R DA+R F+RYYLD   +  P +++ L   +G +  +A INL P     V+V C+++   L + +  TV+E +K   +   +S   +  L Y +       GPE MK   R L++Y +   D
Sbjct:   36 VVIPTAGVQGSPMKD--RLNLPSILVLHSCGISRAGDQAEIAAFCSHVMEVDLSHNKLQDWNEISKIVVNIPNLEFINLSSNPLAE-----SRLEPHVAQAFSRVRRLVLNNTQISWDAVLQLTQQIPELEELFLCLNEY---SSVRTSSPACPTLRLLHITDNRLHDWAEVRKFGSMFPSLETLVMANNNLASIQ-----DSK-DVLQRLFPNLRSINLHNSGLNRWEDVEKLNFFPKLEEVRLRGIPLLQAYTNAECRSLMVARLPSVSMLNGSVVTDSEREDAERFFIRYYLDCPERDLPYRYHSLVTKYGKLEPLAEINLKPRCRARVEVHCEEKVEHLSIRLDQTVAELRKQLTKVVQLSTK-SMRLYYINK--DSAFGPEEMKYNTRALHSYSIQDGD 420          
BLAST of Tubulin-specific chaperone cofactor E-like protein vs. Ensembl Medaka
Match: tbcela (tubulin-specific chaperone cofactor E-like protein [Source:NCBI gene;Acc:101167062])

HSP 1 Score: 122.094 bits (305), Expect = 6.147e-30
Identity = 123/404 (30.45%), Postives = 200/404 (49.50%), Query Frame = 3
Query:  153 TIVPDIVTFGMPKDNGTRRRLPSSLSLDGKEIELIDFDDSSLEMVEAVKSLHLNNNLINSWEYVINLLNNIPGLEXXXXXXXXXXQFQDSFVKLMPDIV--YPKLKVLILNETGVPWEMVLSLLPRLPSLETLHLSKNIQPLSKEIAINSSPFPSVTQLFYNYNCCSDLQEICLMGDLFPCXXXXXXXXXXXXXXQPENQEDSEMNWLHYHFPRLTSLNVSENKLNKWDSVDYVESLQNVTDLRISNQPLFESLKADEIWNQLVARMGNISKLNGSTITDENRIDAQRAFMRYYLDSDAK--PPKFYDLQKXXXXXXXXXXXXLSPEHFIPVKVICDDRQLELIVDVRSTVSEAKKLFCQKFGISDPYNFVLKYWDHVMTEIQGPELMKSGNRNLYAYRVSKND 1352
             ++P     G P  +  R  LPS L L    I               V  + L++N +  W  +  ++ NIP LE +NLSSNPL +      +L P +   + +++ L+LN T + W+ VL L  ++P LE L L  N       +  +S   P++  L    N   D  E+   G +FP LE L++  NNL S+Q     DS+ + L   FP L S+N+  + LN+W+ V+ +     + ++R+   PL ++    E  + +VAR+ ++S LNGS +TD  R DA+R F+RYYLD   +  P +++ L   +G +  +A INL P     V+V C+++   L + +  TV+E +K   +   +S   +  L Y +       GPE MK   R L++Y +   D
Sbjct:   36 VVIPTAGVQGSPMKD--RLNLPSILVLHSCGISRAGDQAEIAAFCSHVMEVDLSHNKLQDWNEISKIVVNIPNLEFINLSSNPLAE-----SRLEPHVAQAFSRVRRLVLNNTQISWDAVLQLTQQIPELEELFLCLNEY---SSVRTSSPACPTLRLLHITDNRLHDWAEVRKFGSMFPSLETLVMANNNLASIQ-----DSK-DVLQRLFPNLRSINLHNSGLNRWEDVEKLNFFPKLEEVRLRGIPLLQAYTNAECRSLMVARLPSVSMLNGSVVTDSEREDAERFFIRYYLDCPERDLPYRYHSLVTKYGKLEPLAEINLKPRCRARVEVHCEEKVEHLSIRLDQTVAELRKQLTKVVQLSTK-SMRLYYINK--DSAFGPEEMKYNTRALHSYSIQDGD 420          
BLAST of Tubulin-specific chaperone cofactor E-like protein vs. Ensembl Medaka
Match: tbcela (tubulin-specific chaperone cofactor E-like protein [Source:NCBI gene;Acc:101167062])

HSP 1 Score: 122.094 bits (305), Expect = 6.147e-30
Identity = 123/404 (30.45%), Postives = 200/404 (49.50%), Query Frame = 3
Query:  153 TIVPDIVTFGMPKDNGTRRRLPSSLSLDGKEIELIDFDDSSLEMVEAVKSLHLNNNLINSWEYVINLLNNIPGLEXXXXXXXXXXQFQDSFVKLMPDIV--YPKLKVLILNETGVPWEMVLSLLPRLPSLETLHLSKNIQPLSKEIAINSSPFPSVTQLFYNYNCCSDLQEICLMGDLFPCXXXXXXXXXXXXXXQPENQEDSEMNWLHYHFPRLTSLNVSENKLNKWDSVDYVESLQNVTDLRISNQPLFESLKADEIWNQLVARMGNISKLNGSTITDENRIDAQRAFMRYYLDSDAK--PPKFYDLQKXXXXXXXXXXXXLSPEHFIPVKVICDDRQLELIVDVRSTVSEAKKLFCQKFGISDPYNFVLKYWDHVMTEIQGPELMKSGNRNLYAYRVSKND 1352
             ++P     G P  +  R  LPS L L    I               V  + L++N +  W  +  ++ NIP LE +NLSSNPL +      +L P +   + +++ L+LN T + W+ VL L  ++P LE L L  N       +  +S   P++  L    N   D  E+   G +FP LE L++  NNL S+Q     DS+ + L   FP L S+N+  + LN+W+ V+ +     + ++R+   PL ++    E  + +VAR+ ++S LNGS +TD  R DA+R F+RYYLD   +  P +++ L   +G +  +A INL P     V+V C+++   L + +  TV+E +K   +   +S   +  L Y +       GPE MK   R L++Y +   D
Sbjct:   36 VVIPTAGVQGSPMKD--RLNLPSILVLHSCGISRAGDQAEIAAFCSHVMEVDLSHNKLQDWNEISKIVVNIPNLEFINLSSNPLAE-----SRLEPHVAQAFSRVRRLVLNNTQISWDAVLQLTQQIPELEELFLCLNEY---SSVRTSSPACPTLRLLHITDNRLHDWAEVRKFGSMFPSLETLVMANNNLASIQ-----DSK-DVLQRLFPNLRSINLHNSGLNRWEDVEKLNFFPKLEEVRLRGIPLLQAYTNAECRSLMVARLPSVSMLNGSVVTDSEREDAERFFIRYYLDCPERDLPYRYHSLVTKYGKLEPLAEINLKPRCRARVEVHCEEKVEHLSIRLDQTVAELRKQLTKVVQLSTK-SMRLYYINK--DSAFGPEEMKYNTRALHSYSIQDGD 420          
BLAST of Tubulin-specific chaperone cofactor E-like protein vs. Ensembl Medaka
Match: tbcela (tubulin-specific chaperone cofactor E-like protein [Source:NCBI gene;Acc:101167062])

HSP 1 Score: 104.76 bits (260), Expect = 5.729e-24
Identity = 112/419 (26.73%), Postives = 187/419 (44.63%), Query Frame = 3
Query:  153 TIVPDIVTFGMPKDNGTRRRLPSSLSLDGKEIELIDFDDSSLEMVEAVKSLHLNNNLINSWEYVINLLNNIPGLEXXXXXXXXXXQFQDSFVKLMPDIV--YPKLKVLILNETGVPWEM---------------VLSLLPRLPSLETLHLSKNIQPLSKEIAINSSPFPSVTQLFYNYNCCSDLQEICLMGDLFPCXXXXXXXXXXXXXXQPENQEDSEMNWLHYHFPRLTSLNVSENKLNKWDSVDYVESLQNVTDLRISNQPLFESLKADEIWNQLVARMGNISKLNGSTITDENRIDAQRAFMRYYLDSDAK--PPKFYDLQKXXXXXXXXXXXXLSPEHFIPVKVICDDRQLELIVDVRSTVSEAKKLFCQKFGISDPYNFVLKYWDHVMTEIQGPELMKSGNRNLYAYRVSKND 1352
             ++P     G P  +  R  LPS L L    I               V  + L++N +  W  +  ++ NIP LE +NLSSNPL +      +L P +   + +++ L+LN T + W++               V +  P  P+L  LH++ N      E+    S FPS+  L    N  + +Q                               DS+ + L   FP L S+N+  + LN+W+ V+ +     + ++R+   PL ++    E  + +VAR+ ++S LNGS +TD  R DA+R F+RYYLD   +  P +++ L   +G +  +A INL P     V+V C+++   L + +  TV+E +K   +   +S   +  L Y +       GPE MK   R L++Y +   D
Sbjct:   36 VVIPTAGVQGSPMKD--RLNLPSILVLHSCGISRAGDQAEIAAFCSHVMEVDLSHNKLQDWNEISKIVVNIPNLEFINLSSNPLAE-----SRLEPHVAQAFSRVRRLVLNNTQISWDIHPKTELFLCLNEYSSVRTSSPACPTLRLLHITDNRLHDWAEVRKFGSMFPSLETLVMANNNLASIQ-------------------------------DSK-DVLQRLFPNLRSINLHNSGLNRWEDVEKLNFFPKLEEVRLRGIPLLQAYTNAECRSLMVARLPSVSMLNGSVVTDSEREDAERFFIRYYLDCPERDLPYRYHSLVTKYGKLEPLAEINLKPRCRARVEVHCEEKVEHLSIRLDQTVAELRKQLTKVVQLSTK-SMRLYYINK--DSAFGPEEMKYNTRALHSYSIQDGD 412          
BLAST of Tubulin-specific chaperone cofactor E-like protein vs. Ensembl Medaka
Match: tbcelb (tubulin-specific chaperone cofactor E-like protein [Source:NCBI gene;Acc:101174124])

HSP 1 Score: 93.2041 bits (230), Expect = 4.869e-20
Identity = 113/400 (28.25%), Postives = 193/400 (48.25%), Query Frame = 3
Query:  180 GMPKDNGTRRRLPSSLSLDGKEIELIDFDDSSLEMVEAVKSLHLNNNLINSWEYVINLLNNIPGLEXXXXXXXXXXQFQDSFVKLMPDI--VYPKLKVLILNETGVPWEMVLSLLPRLPSLETLHLSKNIQPLSKEIAINSSPFPSVTQLFYNYNCCSDLQEICLMGDLFPCXXXXXXXXXXXXXXQPENQEDSEMNWLHYHFPRLTSLNVSENKLNKWDSVDYVESLQNVTDLRISNQPLFESLKADEIWNQLVARMGNISKLNGSTITDENRIDAQRAFMRYYLDSDAK--PPKFYDLQKXXXXXXXXXXXXLSPEHFIPVKVICDDRQLELIVDVRSTVSEAKK-----LFCQKFGISDPYNFVLKYWDHVMTEIQGPELMKSGNRNLYAYRVSKND 1352
            G P   G    LPS+L L    I           +   V  L L+ N ++ W+ +  ++++IP L+ LNLS NPL     S V+L P +  V+ K++ L+L  T V W+ V +L    P L+ L L  N       ++ + +  PS+  L    N   D  E+   G L+P L  L+L  N++ S+      DS+   L   FP+L S+N++ + L+KW  ++ +     + +++    PL +S    E  + L+A++ ++  LNGS +++  R DA+R F+R+Y D  A+    +++ L   +G +  +A ++L P     V V C DR   + + +  TV +  K     L  Q  GI       L Y    M+ + GPE +K  +R L+++ +   D
Sbjct:   40 GSPDKGGLF--LPSALVLSDSGIRKAGAGSDIAAVCAHVLELDLSFNQLSDWDEIGTIVSSIPHLDFLNLSMNPL-----SGVQLNPSMADVFSKVRRLVLINTQVSWDTVHTLTQHTPELKELFLCLNG---FNSVSESPAACPSLRLLQITDNQLQDWSEVRKFGLLYPSLSTLVLANNSVGSV-----SDSKKT-LEGLFPKLRSINLNNSGLSKWMDIERLNFFPKLEEVKAKGIPLLQSYSTQERRSLLLAQLPSVMFLNGSKVSEGEREDAERFFIRFYQDCPAQELSDRYHILVSKYGQLAPLAEVDLRP-RCTTVNVRCGDRVETVDLRLEQTVGDLTKQLRALLQLQTSGIR------LIYISQEMSSVFGPEELKGSSRALHSFNIQDGD 416          
BLAST of Tubulin-specific chaperone cofactor E-like protein vs. Planmine SMEST
Match: SMESG000068159.1 (SMESG000068159.1)

HSP 1 Score: 758.444 bits (1957), Expect = 0.000e+0
Identity = 422/422 (100.00%), Postives = 422/422 (100.00%), Query Frame = 3
Query:  111 MFSDFVKRQYEEINTIVPDIVTFGMPKDNGTRRRLPSSLSLDGKEIELIDFDDSSLEMVEAVKSLHLNNNLINSWEYVINLLNNIPGLEXXXXXXXXXXQFQDSFVKLMPDIVYPKLKVLILNETGVPWEMVLSLLPRLPSLETLHLSKNIQPLSKEIAINSSPFPSVTQLFYNYNCCSDLQEICLMGDLFPCXXXXXXXXXXXXXXQPENQEDSEMNWLHYHFPRLTSLNVSENKLNKWDSVDYVESLQNVTDLRISNQPLFESLKADEIWNQLVARMGNISKLNGSTITDENRIDAQRAFMRYYLDSDAKPPKFYDLQKXXXXXXXXXXXXLSPEHFIPVKVICDDRQLELIVDVRSTVSEAKKLFCQKFGISDPYNFVLKYWDHVMTEIQGPELMKSGNRNLYAYRVSKNDWFTLDKKY 1376
            MFSDFVKRQYEEINTIVPDIVTFGMPKDNGTRRRLPSSLSLDGKEIELIDFDDSSLEMVEAVKSLHLNNNLINSWEYVINLLNNIPGLESLNLSSNPLNQFQDSFVKLMPDIVYPKLKVLILNETGVPWEMVLSLLPRLPSLETLHLSKNIQPLSKEIAINSSPFPSVTQLFYNYNCCSDLQEICLMGDLFPCLENLILLGNNLESLQPENQEDSEMNWLHYHFPRLTSLNVSENKLNKWDSVDYVESLQNVTDLRISNQPLFESLKADEIWNQLVARMGNISKLNGSTITDENRIDAQRAFMRYYLDSDAKPPKFYDLQKIHGNINHIANINLSPEHFIPVKVICDDRQLELIVDVRSTVSEAKKLFCQKFGISDPYNFVLKYWDHVMTEIQGPELMKSGNRNLYAYRVSKNDWFTLDKKY
Sbjct:    1 MFSDFVKRQYEEINTIVPDIVTFGMPKDNGTRRRLPSSLSLDGKEIELIDFDDSSLEMVEAVKSLHLNNNLINSWEYVINLLNNIPGLESLNLSSNPLNQFQDSFVKLMPDIVYPKLKVLILNETGVPWEMVLSLLPRLPSLETLHLSKNIQPLSKEIAINSSPFPSVTQLFYNYNCCSDLQEICLMGDLFPCLENLILLGNNLESLQPENQEDSEMNWLHYHFPRLTSLNVSENKLNKWDSVDYVESLQNVTDLRISNQPLFESLKADEIWNQLVARMGNISKLNGSTITDENRIDAQRAFMRYYLDSDAKPPKFYDLQKIHGNINHIANINLSPEHFIPVKVICDDRQLELIVDVRSTVSEAKKLFCQKFGISDPYNFVLKYWDHVMTEIQGPELMKSGNRNLYAYRVSKNDWFTLDKKY 422          
The following BLAST results are available for this feature:
BLAST of Tubulin-specific chaperone cofactor E-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TBCEL4.119e-2730.03tubulin folding cofactor E like [Source:HGNC Symbo... [more]
TBCEL4.119e-2730.03tubulin folding cofactor E like [Source:HGNC Symbo... [more]
AP000646.12.621e-1931.41novel protein[more]
TBCEL3.309e-1133.77tubulin folding cofactor E like [Source:HGNC Symbo... [more]
TBCE1.844e-827.17tubulin folding cofactor E [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of Tubulin-specific chaperone cofactor E-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
coel-11.805e-2026.27Tubulin folding COfactor E-Like protein [Source:U... [more]
coel-16.999e-1730.57Tubulin folding COfactor E-Like protein [Source:U... [more]
back to top
BLAST of Tubulin-specific chaperone cofactor E-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
mlt1.479e-3631.71gene:FBgn0265512 transcript:FBtr0088370[more]
mlt1.479e-3631.71gene:FBgn0265512 transcript:FBtr0331945[more]
mlt1.479e-3631.71gene:FBgn0265512 transcript:FBtr0088369[more]
back to top
BLAST of Tubulin-specific chaperone cofactor E-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
tbcelb8.011e-3031.35tubulin folding cofactor E-like b [Source:ZFIN;Acc... [more]
tbcelb8.011e-3031.35tubulin folding cofactor E-like b [Source:ZFIN;Acc... [more]
tbcela8.448e-3029.72tubulin folding cofactor E-like a [Source:ZFIN;Acc... [more]
tbcela2.201e-2029.64tubulin folding cofactor E-like a [Source:ZFIN;Acc... [more]
back to top
BLAST of Tubulin-specific chaperone cofactor E-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ptch24.820e-2230.10patched 2 [Source:Xenbase;Acc:XB-GENE-1033868][more]
ptch25.539e-2230.10patched 2 [Source:Xenbase;Acc:XB-GENE-1033868][more]
back to top
BLAST of Tubulin-specific chaperone cofactor E-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tbcel2.188e-2228.98tubulin folding cofactor E-like [Source:MGI Symbol... [more]
Tbcel2.188e-2228.98tubulin folding cofactor E-like [Source:MGI Symbol... [more]
Tbcel2.188e-2228.98tubulin folding cofactor E-like [Source:MGI Symbol... [more]
Tbcel2.188e-2228.98tubulin folding cofactor E-like [Source:MGI Symbol... [more]
Tbcel2.805e-2228.98tubulin folding cofactor E-like [Source:MGI Symbol... [more]
back to top
BLAST of Tubulin-specific chaperone cofactor E-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5QJ74|TBCEL_HUMAN1.978e-2630.03Tubulin-specific chaperone cofactor E-like protein... [more]
sp|Q5PQJ7|TBCEL_RAT1.598e-2528.75Tubulin-specific chaperone cofactor E-like protein... [more]
sp|Q8C5W3|TBCEL_MOUSE1.531e-2128.98Tubulin-specific chaperone cofactor E-like protein... [more]
sp|Q5FVQ9|TBCE_RAT8.910e-1428.03Tubulin-specific chaperone E OS=Rattus norvegicus ... [more]
sp|Q8GRL7|TBCE_ARATH1.213e-1330.63Tubulin-folding cofactor E OS=Arabidopsis thaliana... [more]
back to top
BLAST of Tubulin-specific chaperone cofactor E-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V4AFH61.279e-3832.32Ubiquitin-like domain-containing protein OS=Lottia... [more]
A0A2T7P2Z41.045e-3732.72Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A1S3JK881.937e-3733.33tubulin-specific chaperone cofactor E-like protein... [more]
A0A1S3JPI26.128e-3733.53tubulin-specific chaperone cofactor E-like protein... [more]
R7USN71.571e-3532.02Uncharacterized protein (Fragment) OS=Capitella te... [more]
back to top
BLAST of Tubulin-specific chaperone cofactor E-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
tbcela2.834e-3129.78tubulin-specific chaperone cofactor E-like protein... [more]
tbcela4.833e-2930.70tubulin-specific chaperone cofactor E-like protein... [more]
tbcelb1.014e-2728.68tubulin-specific chaperone cofactor E-like protein... [more]
back to top
BLAST of Tubulin-specific chaperone cofactor E-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tbcelb2.431e-2227.37tubulin folding cofactor E-like b [Source:ZFIN;Acc... [more]
back to top
BLAST of Tubulin-specific chaperone cofactor E-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tubulin-specific chaperone cofactor E-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO326747.069e-2730.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tubulin-specific chaperone cofactor E-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tbcela6.147e-3030.45tubulin-specific chaperone cofactor E-like protein... [more]
tbcela6.147e-3030.45tubulin-specific chaperone cofactor E-like protein... [more]
tbcela6.147e-3030.45tubulin-specific chaperone cofactor E-like protein... [more]
tbcela5.729e-2426.73tubulin-specific chaperone cofactor E-like protein... [more]
tbcelb4.869e-2028.25tubulin-specific chaperone cofactor E-like protein... [more]
back to top
BLAST of Tubulin-specific chaperone cofactor E-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000068159.10.000e+0100.00SMESG000068159.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011922 ID=SMED30011922|Name=Tubulin-specific chaperone cofactor E-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1513bp
ATCAAATGTACACTAATTAGTTATCATATGATTATATGATAATATGATGA
TTTACCACTTACCAATAAATAACTGATTATTAAAATAATTCTCTTCTTAA
TCGTACTAAAATGTTTTCGGATTTCGTCAAACGTCAATATGAAGAAATAA
ATACGATTGTTCCAGATATTGTTACATTTGGAATGCCTAAAGATAACGGT
ACTCGAAGAAGACTTCCAAGCTCCTTGAGTCTTGATGGAAAAGAGATTGA
ATTGATAGATTTTGATGACTCTTCATTAGAAATGGTGGAAGCTGTCAAAT
CGTTACACCTTAACAACAATCTGATCAATTCTTGGGAATATGTAATTAAT
CTTCTTAATAATATTCCTGGACTTGAATCGTTAAATTTGTCTTCTAATCC
ACTCAACCAATTCCAAGATTCTTTTGTGAAATTGATGCCAGATATTGTCT
ATCCGAAACTCAAGGTGCTTATACTCAACGAAACCGGTGTTCCTTGGGAA
ATGGTTTTGTCGCTCTTGCCACGATTGCCAAGTTTGGAGACACTTCATCT
TTCAAAAAATATTCAACCTCTTTCCAAAGAGATAGCGATCAATAGTTCTC
CTTTTCCATCTGTTACACAACTATTCTACAATTACAATTGTTGTTCGGAT
CTCCAAGAGATCTGCTTAATGGGTGACCTATTTCCTTGTCTTGAGAATTT
AATTTTGCTCGGTAATAATTTGGAGTCGTTGCAACCAGAAAATCAAGAAG
ATTCAGAAATGAATTGGCTTCATTATCATTTCCCAAGATTGACATCGTTA
AATGTTTCGGAAAACAAACTCAATAAATGGGACTCAGTGGACTATGTAGA
AAGTTTACAAAACGTTACCGATTTGAGAATTTCAAATCAGCCACTATTTG
AGAGTTTGAAGGCTGATGAAATATGGAATCAGTTGGTAGCAAGAATGGGT
AATATTTCCAAATTGAATGGAAGCACGATTACTGATGAAAATAGAATAGA
TGCGCAACGAGCATTTATGAGATATTATTTGGACTCTGATGCTAAACCAC
CAAAATTCTACGACTTGCAGAAAATTCACGGAAACATTAATCACATTGCG
AACATCAATTTATCTCCAGAACATTTTATTCCTGTCAAAGTGATTTGCGA
TGACCGGCAACTGGAATTGATAGTTGATGTCCGTAGTACTGTAAGCGAGG
CGAAAAAATTATTTTGTCAAAAGTTCGGTATTTCTGATCCATACAATTTC
GTCCTCAAGTACTGGGATCATGTTATGACAGAGATTCAAGGCCCAGAACT
TATGAAATCTGGAAATCGAAATTTGTACGCGTATAGAGTCAGTAAAAATG
ACTGGTTCACTTTGGATAAAAAATATTAAATTGTAAATTGAGAAAATTCA
GTCGATAAATAGCAATAATGACGCTGCCATTCGGAAACGATTTTGTAGTT
TATTGAATTTATTGTATTTAATCGGAAAACATTTTATTCTTTCACCCTCA
TAATAAATATTCG
back to top

protein sequence of SMED30011922-orf-1

>SMED30011922-orf-1 ID=SMED30011922-orf-1|Name=SMED30011922-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=423bp
MFSDFVKRQYEEINTIVPDIVTFGMPKDNGTRRRLPSSLSLDGKEIELID
FDDSSLEMVEAVKSLHLNNNLINSWEYVINLLNNIPGLESLNLSSNPLNQ
FQDSFVKLMPDIVYPKLKVLILNETGVPWEMVLSLLPRLPSLETLHLSKN
IQPLSKEIAINSSPFPSVTQLFYNYNCCSDLQEICLMGDLFPCLENLILL
GNNLESLQPENQEDSEMNWLHYHFPRLTSLNVSENKLNKWDSVDYVESLQ
NVTDLRISNQPLFESLKADEIWNQLVARMGNISKLNGSTITDENRIDAQR
AFMRYYLDSDAKPPKFYDLQKIHGNINHIANINLSPEHFIPVKVICDDRQ
LELIVDVRSTVSEAKKLFCQKFGISDPYNFVLKYWDHVMTEIQGPELMKS
GNRNLYAYRVSKNDWFTLDKKY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0003001lateral region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR032675LRR_dom_sf
IPR029071Ubiquitin-like_domsf
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005856cytoskeleton
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 37..159
e-value: 2.2E-9
score: 38.7
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 160..307
e-value: 4.6E-14
score: 53.7
NoneNo IPR availablePANTHERPTHR15140TUBULIN-SPECIFIC CHAPERONE Ecoord: 30..417
NoneNo IPR availablePANTHERPTHR15140:SF11TUBULIN-SPECIFIC CHAPERONE COFACTOR E-LIKE PROTEINcoord: 30..417
NoneNo IPR availableCDDcd17045Ubl_TBCELcoord: 333..421
e-value: 1.0878E-12
score: 61.4932
NoneNo IPR availableSUPERFAMILYSSF52058L domain-likecoord: 39..264
IPR029071Ubiquitin-like domain superfamilySUPERFAMILYSSF54236Ubiquitin-likecoord: 332..419