CTF/NF-I domain-containing protein

Overview
NameCTF/NF-I domain-containing protein
Smed IDSMED30011875
Length (bp)3911
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of CTF/NF-I domain-containing protein (SMED30011875) t-SNE clustered cells

Violin plots show distribution of expression levels for CTF/NF-I domain-containing protein (SMED30011875) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of CTF/NF-I domain-containing protein (SMED30011875) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for CTF/NF-I domain-containing protein (SMED30011875) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011875

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30011875SMESG000028598.1 SmedASXL_016828SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30011875SMESG000028598.1 dd_Smed_v4_12312_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30011875SMESG000028598.1 dd_Smed_v4_12312_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30011875SMESG000028598.1 dd_Smed_v4_12312_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30011875SMESG000028598.1 dd_Smed_v4_12312_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30011875SMESG000028598.1 dd_Smed_v6_12312_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Human
Match: NFIC (nuclear factor I C [Source:HGNC Symbol;Acc:HGNC:7786])

HSP 1 Score: 86.2705 bits (212), Expect = 9.123e-17
Identity = 73/277 (26.35%), Postives = 123/277 (44.40%), Query Frame = 3
Query:  396 FIHALLSRCKRLAPLWFKGALSMREKNRKEHKRGYTVSGVQTSSSWSAVLDKITEMSCRAETEMVMNLLKKLYKELASDSIIWFIKCWLRLPETRGENYYSCVLSRGDARGRMRRIDGGKGSDKVWRLDTIVSMLYHGMPMSSTDTNIIVHT--CDQE-LCVRPQHLRFRXXXXXXXXXXXXXQQGGYQLIPPKK-ITKDKDNEKPESADTENGQQPXXXXXXXXXXXXXXXQNQDEVENSVEISGP-FNIEQIQQYLIQDLKPCVQSLEKMVLSAT 1211
            FI ALL   +  A  WF      R+  +K  KR        +     AV D++       + +    LL KL K++  +    F+          G+    CVLS  D +G+MRRID  + +DKVWRLD ++ +L+ G+P+ STD   +V    C    LCV+P H+      + L +     ++   Q   P+  +  D+++ KP + DT + Q+        + + +        V      +GP F++ ++Q +L  DL P    L + + S +
Sbjct:   16 FIEALLPHVRAFAYTWFNLQARKRKYFKKHEKR-------MSKDEERAVKDELLGEKPEVKQKWASRLLAKLRKDIRPECREDFVL------SITGKKAPGCVLSNPDQKGKMRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLVKAAQCGHPVLCVQPHHIGVAVKELDLYLAYFVRERDAEQSGSPRTGMGSDQEDSKPITLDTTDFQESFVTSGVFSVTELIQVSRTPVVTG----TGPNFSLGELQGHLAYDLNPASTGLRRTLPSTS 275          
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Human
Match: NFIC (nuclear factor I C [Source:HGNC Symbol;Acc:HGNC:7786])

HSP 1 Score: 85.8853 bits (211), Expect = 1.064e-16
Identity = 73/277 (26.35%), Postives = 123/277 (44.40%), Query Frame = 3
Query:  396 FIHALLSRCKRLAPLWFKGALSMREKNRKEHKRGYTVSGVQTSSSWSAVLDKITEMSCRAETEMVMNLLKKLYKELASDSIIWFIKCWLRLPETRGENYYSCVLSRGDARGRMRRIDGGKGSDKVWRLDTIVSMLYHGMPMSSTDTNIIVHT--CDQE-LCVRPQHLRFRXXXXXXXXXXXXXQQGGYQLIPPKK-ITKDKDNEKPESADTENGQQPXXXXXXXXXXXXXXXQNQDEVENSVEISGP-FNIEQIQQYLIQDLKPCVQSLEKMVLSAT 1211
            FI ALL   +  A  WF      R+  +K  KR        +     AV D++       + +    LL KL K++  +    F+          G+    CVLS  D +G+MRRID  + +DKVWRLD ++ +L+ G+P+ STD   +V    C    LCV+P H+      + L +     ++   Q   P+  +  D+++ KP + DT + Q+        + + +        V      +GP F++ ++Q +L  DL P    L + + S +
Sbjct:   16 FIEALLPHVRAFAYTWFNLQARKRKYFKKHEKR-------MSKDEERAVKDELLGEKPEVKQKWASRLLAKLRKDIRPECREDFVL------SITGKKAPGCVLSNPDQKGKMRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLVKAAQCGHPVLCVQPHHIGVAVKELDLYLAYFVRERDAEQSGSPRTGMGSDQEDSKPITLDTTDFQESFVTSGVFSVTELIQVSRTPVVTG----TGPNFSLGELQGHLAYDLNPASTGLRRTLPSTS 275          
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Human
Match: NFIC (nuclear factor I C [Source:HGNC Symbol;Acc:HGNC:7786])

HSP 1 Score: 85.8853 bits (211), Expect = 1.079e-16
Identity = 72/277 (25.99%), Postives = 122/277 (44.04%), Query Frame = 3
Query:  396 FIHALLSRCKRLAPLWFKGALSMREKNRKEHKRGYTVSGVQTSSSWSAVLDKITEMSCRAETEMVMNLLKKLYKELASDSIIWFIKCWLRLPETRGENYYSCVLSRGDARGRMRRIDGGKGSDKVWRLDTIVSMLYHGMPMSSTDTNIIVHTCD---QELCVRPQHLRFRXXXXXXXXXXXXXQQGGYQLIPPKK-ITKDKDNEKPESADTENGQQPXXXXXXXXXXXXXXXQNQDEVENSVEISGP-FNIEQIQQYLIQDLKPCVQSLEKMVLSAT 1211
            FI ALL   +  A  WF      R+  +K  KR        +     AV D++       + +    LL KL K++  +    F+          G+    CVLS  D +G+MRRID  + +DKVWRLD ++ +L+ G+P+ STD   +V         LCV+P H+      + L +     ++   Q   P+  +  D+++ KP + DT + Q+        + + +        V      +GP F++ ++Q +L  DL P    L + + S +
Sbjct:    7 FIEALLPHVRAFAYTWFNLQARKRKYFKKHEKR-------MSKDEERAVKDELLGEKPEVKQKWASRLLAKLRKDIRPECREDFVLS------ITGKKAPGCVLSNPDQKGKMRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLVKAAQCGHPVLCVQPHHIGVAVKELDLYLAYFVRERDAEQSGSPRTGMGSDQEDSKPITLDTTDFQESFVTSGVFSVTELIQVSRTPVVTG----TGPNFSLGELQGHLAYDLNPASTGLRRTLPSTS 266          
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Human
Match: NFIC (nuclear factor I C [Source:HGNC Symbol;Acc:HGNC:7786])

HSP 1 Score: 85.8853 bits (211), Expect = 1.535e-16
Identity = 73/277 (26.35%), Postives = 123/277 (44.40%), Query Frame = 3
Query:  396 FIHALLSRCKRLAPLWFKGALSMREKNRKEHKRGYTVSGVQTSSSWSAVLDKITEMSCRAETEMVMNLLKKLYKELASDSIIWFIKCWLRLPETRGENYYSCVLSRGDARGRMRRIDGGKGSDKVWRLDTIVSMLYHGMPMSSTDTNIIVHT--CDQE-LCVRPQHLRFRXXXXXXXXXXXXXQQGGYQLIPPKK-ITKDKDNEKPESADTENGQQPXXXXXXXXXXXXXXXQNQDEVENSVEISGP-FNIEQIQQYLIQDLKPCVQSLEKMVLSAT 1211
            FI ALL   +  A  WF      R+  +K  KR        +     AV D++       + +    LL KL K++  +    F+          G+    CVLS  D +G+MRRID  + +DKVWRLD ++ +L+ G+P+ STD   +V    C    LCV+P H+      + L +     ++   Q   P+  +  D+++ KP + DT + Q+        + + +        V      +GP F++ ++Q +L  DL P    L + + S +
Sbjct:    7 FIEALLPHVRAFAYTWFNLQARKRKYFKKHEKR-------MSKDEERAVKDELLGEKPEVKQKWASRLLAKLRKDIRPECREDFVLS------ITGKKAPGCVLSNPDQKGKMRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLVKAAQCGHPVLCVQPHHIGVAVKELDLYLAYFVRERDAEQSGSPRTGMGSDQEDSKPITLDTTDFQESFVTSGVFSVTELIQVSRTPVVTG----TGPNFSLGELQGHLAYDLNPASTGLRRTLPSTS 266          
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Human
Match: NFIC (nuclear factor I C [Source:HGNC Symbol;Acc:HGNC:7786])

HSP 1 Score: 85.8853 bits (211), Expect = 1.659e-16
Identity = 73/277 (26.35%), Postives = 123/277 (44.40%), Query Frame = 3
Query:  396 FIHALLSRCKRLAPLWFKGALSMREKNRKEHKRGYTVSGVQTSSSWSAVLDKITEMSCRAETEMVMNLLKKLYKELASDSIIWFIKCWLRLPETRGENYYSCVLSRGDARGRMRRIDGGKGSDKVWRLDTIVSMLYHGMPMSSTDTNIIVHT--CDQE-LCVRPQHLRFRXXXXXXXXXXXXXQQGGYQLIPPKK-ITKDKDNEKPESADTENGQQPXXXXXXXXXXXXXXXQNQDEVENSVEISGP-FNIEQIQQYLIQDLKPCVQSLEKMVLSAT 1211
            FI ALL   +  A  WF      R+  +K  KR        +     AV D++       + +    LL KL K++  +    F+          G+    CVLS  D +G+MRRID  + +DKVWRLD ++ +L+ G+P+ STD   +V    C    LCV+P H+      + L +     ++   Q   P+  +  D+++ KP + DT + Q+        + + +        V      +GP F++ ++Q +L  DL P    L + + S +
Sbjct:   16 FIEALLPHVRAFAYTWFNLQARKRKYFKKHEKR-------MSKDEERAVKDELLGEKPEVKQKWASRLLAKLRKDIRPECREDFVL------SITGKKAPGCVLSNPDQKGKMRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLVKAAQCGHPVLCVQPHHIGVAVKELDLYLAYFVRERDAEQSGSPRTGMGSDQEDSKPITLDTTDFQESFVTSGVFSVTELIQVSRTPVVTG----TGPNFSLGELQGHLAYDLNPASTGLRRTLPSTS 275          
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Celegans
Match: nfi-1 (NFI (Nuclear Factor I) family [Source:UniProtKB/TrEMBL;Acc:Q5H9N3])

HSP 1 Score: 68.9366 bits (167), Expect = 2.163e-11
Identity = 35/99 (35.35%), Postives = 53/99 (53.54%), Query Frame = 3
Query:  597 LLKKLYKELASDSIIWFIKCWLRLPETRGENYYSCVLSRGDARGRMRRIDGGKGSDKVWRLDTIVSMLYHGMPMSSTDTNII--VHTCDQELCVRPQHL 887
            LL K+ K++ +D    FI          G     C++S  D +G+MRRID  + +DKVWRLD +  +L+ G+P+ STD   +     C   LC+ P H+
Sbjct:  135 LLGKIKKDIQNDDKEAFISA------INGSEPNKCIISVADQKGKMRRIDCLRQADKVWRLDLVTIILFKGIPLESTDGERLERSEACVHPLCINPFHM 227          
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Celegans
Match: nfi-1 (NFI (Nuclear Factor I) family [Source:UniProtKB/TrEMBL;Acc:Q5H9N3])

HSP 1 Score: 68.9366 bits (167), Expect = 2.196e-11
Identity = 35/99 (35.35%), Postives = 53/99 (53.54%), Query Frame = 3
Query:  597 LLKKLYKELASDSIIWFIKCWLRLPETRGENYYSCVLSRGDARGRMRRIDGGKGSDKVWRLDTIVSMLYHGMPMSSTDTNII--VHTCDQELCVRPQHL 887
            LL K+ K++ +D    FI          G     C++S  D +G+MRRID  + +DKVWRLD +  +L+ G+P+ STD   +     C   LC+ P H+
Sbjct:  119 LLGKIKKDIQNDDKEAFISA------INGSEPNKCIISVADQKGKMRRIDCLRQADKVWRLDLVTIILFKGIPLESTDGERLERSEACVHPLCINPFHM 211          
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Celegans
Match: nfi-1 (NFI (Nuclear Factor I) family [Source:UniProtKB/TrEMBL;Acc:Q5H9N3])

HSP 1 Score: 68.5514 bits (166), Expect = 2.524e-11
Identity = 35/99 (35.35%), Postives = 53/99 (53.54%), Query Frame = 3
Query:  597 LLKKLYKELASDSIIWFIKCWLRLPETRGENYYSCVLSRGDARGRMRRIDGGKGSDKVWRLDTIVSMLYHGMPMSSTDTNII--VHTCDQELCVRPQHL 887
            LL K+ K++ +D    FI          G     C++S  D +G+MRRID  + +DKVWRLD +  +L+ G+P+ STD   +     C   LC+ P H+
Sbjct:   99 LLGKIKKDIQNDDKEAFISA------INGSEPNKCIISVADQKGKMRRIDCLRQADKVWRLDLVTIILFKGIPLESTDGERLERSEACVHPLCINPFHM 191          
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Fly
Match: NfI (gene:FBgn0042696 transcript:FBtr0333678)

HSP 1 Score: 72.4034 bits (176), Expect = 2.276e-12
Identity = 49/167 (29.34%), Postives = 78/167 (46.71%), Query Frame = 3
Query:  396 FIHALLSRCKRLAPLWFKGALSMREKNRKEHKRGYTVSGVQTSSSWSAVLDKITEMSCRAETEMVMNLLKKLYKELASDSIIWFIKCWLRLPETRGENYYSCVLSRGDARGRMRRIDGGKGSDKVWRLDTIVSMLYHGMPMSSTDTNIIVHTCD---QELCVRPQHL 887
            FI ALL   K  +  WF    + R+  +K  KR        +        D++       + +    LL KL K++  +S   F++  +      G+    CVLS  D +G+MRRID  + +DKVWRLD ++ +L+  +P+ STD   +    +     LCV P H+
Sbjct:   33 FIEALLPYVKSFSYSWFNLQAAKRKYYKKHEKR-------MSLEEERHCKDELQNEKTEVKQKWASRLLGKLRKDITQESREDFVQSII------GKRKSICVLSNPDQKGKMRRIDCLRQADKVWRLDLVMVILFKAIPLESTDGERLEKNPECLHPGLCVNPYHI 186          
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Fly
Match: NfI (gene:FBgn0042696 transcript:FBtr0089141)

HSP 1 Score: 72.4034 bits (176), Expect = 2.283e-12
Identity = 49/167 (29.34%), Postives = 78/167 (46.71%), Query Frame = 3
Query:  396 FIHALLSRCKRLAPLWFKGALSMREKNRKEHKRGYTVSGVQTSSSWSAVLDKITEMSCRAETEMVMNLLKKLYKELASDSIIWFIKCWLRLPETRGENYYSCVLSRGDARGRMRRIDGGKGSDKVWRLDTIVSMLYHGMPMSSTDTNIIVHTCD---QELCVRPQHL 887
            FI ALL   K  +  WF    + R+  +K  KR        +        D++       + +    LL KL K++  +S   F++  +      G+    CVLS  D +G+MRRID  + +DKVWRLD ++ +L+  +P+ STD   +    +     LCV P H+
Sbjct:   33 FIEALLPYVKSFSYSWFNLQAAKRKYYKKHEKR-------MSLEEERHCKDELQNEKTEVKQKWASRLLGKLRKDITQESREDFVQSII------GKRKSICVLSNPDQKGKMRRIDCLRQADKVWRLDLVMVILFKAIPLESTDGERLEKNPECLHPGLCVNPYHI 186          
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Zebrafish
Match: nfia (nuclear factor I/A [Source:ZFIN;Acc:ZDB-GENE-050208-501])

HSP 1 Score: 78.1814 bits (191), Expect = 3.266e-15
Identity = 50/167 (29.94%), Postives = 82/167 (49.10%), Query Frame = 3
Query:  396 FIHALLSRCKRLAPLWFKGALSMREKNRKEHKRGYTVSGVQTSSSWSAVLDKITEMSCRAETEMVMNLLKKLYKELASDSIIWFIKCWLRLPETRGENYYSCVLSRGDARGRMRRIDGGKGSDKVWRLDTIVSMLYHGMPMSSTDTNIIVHT---CDQELCVRPQHL 887
            FI ALL   +  A  WF      R+  +K  KR   +S  +  +    +L +  E+  +  + ++  L K +  E   D ++             G+    CVLS  D +G+MRRID  + +DKVWRLD ++ +L+ G+P+ STD   +V +    +  LCV+P H+
Sbjct:   38 FIEALLPHVRAFAYTWFNLQARKRKYFKKHEKR---MSKEEERAVKDELLSEKPEVKQKWASRLLAKLRKDIRPEFREDFVL----------TVTGKKPPCCVLSNPDQKGKMRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLVKSPQCSNPGLCVQPHHI 191          
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Zebrafish
Match: nfic (nuclear factor I/C [Source:ZFIN;Acc:ZDB-GENE-080305-2])

HSP 1 Score: 80.1073 bits (196), Expect = 7.236e-15
Identity = 53/167 (31.74%), Postives = 79/167 (47.31%), Query Frame = 3
Query:  396 FIHALLSRCKRLAPLWFKGALSMREKNRKEHKRGYTVSGVQTSSSWSAVLDKITEMSCRAETEMVMNLLKKLYKELASDSIIWFIKCWLRLPETRGENYYSCVLSRGDARGRMRRIDGGKGSDKVWRLDTIVSMLYHGMPMSSTDTNIIV---HTCDQELCVRPQHL 887
            FI ALL   +  A  WF      R+  +K  KR        T     AV D++       + +    LL KL K++  +    F+          G+    CVLS  D +G+MRRID  + +DKVWRLD ++ +L+ G+P+ STD   +V      +  LCV+P H+
Sbjct:   15 FIEALLPHVRAFAYTWFNLQARKRKYFKKHEKR-------MTKDEERAVKDELLGEKPEVKQKWASRLLAKLRKDIRPECREDFVL------SITGKKPPCCVLSNPDQKGKMRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLVKGGQCSNPILCVQPHHI 168          
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Zebrafish
Match: nfia (nuclear factor I/A [Source:ZFIN;Acc:ZDB-GENE-050208-501])

HSP 1 Score: 79.7221 bits (195), Expect = 7.850e-15
Identity = 50/167 (29.94%), Postives = 82/167 (49.10%), Query Frame = 3
Query:  396 FIHALLSRCKRLAPLWFKGALSMREKNRKEHKRGYTVSGVQTSSSWSAVLDKITEMSCRAETEMVMNLLKKLYKELASDSIIWFIKCWLRLPETRGENYYSCVLSRGDARGRMRRIDGGKGSDKVWRLDTIVSMLYHGMPMSSTDTNIIVHT---CDQELCVRPQHL 887
            FI ALL   +  A  WF      R+  +K  KR   +S  +  +    +L +  E+  +  + ++  L K +  E   D ++             G+    CVLS  D +G+MRRID  + +DKVWRLD ++ +L+ G+P+ STD   +V +    +  LCV+P H+
Sbjct:   15 FIEALLPHVRAFAYTWFNLQARKRKYFKKHEKR---MSKEEERAVKDELLSEKPEVKQKWASRLLAKLRKDIRPEFREDFVL----------TVTGKKPPCCVLSNPDQKGKMRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLVKSPQCSNPGLCVQPHHI 168          
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Zebrafish
Match: nfic (nuclear factor I/C [Source:ZFIN;Acc:ZDB-GENE-080305-2])

HSP 1 Score: 79.7221 bits (195), Expect = 8.776e-15
Identity = 53/167 (31.74%), Postives = 79/167 (47.31%), Query Frame = 3
Query:  396 FIHALLSRCKRLAPLWFKGALSMREKNRKEHKRGYTVSGVQTSSSWSAVLDKITEMSCRAETEMVMNLLKKLYKELASDSIIWFIKCWLRLPETRGENYYSCVLSRGDARGRMRRIDGGKGSDKVWRLDTIVSMLYHGMPMSSTDTNIIV---HTCDQELCVRPQHL 887
            FI ALL   +  A  WF      R+  +K  KR        T     AV D++       + +    LL KL K++  +    F+          G+    CVLS  D +G+MRRID  + +DKVWRLD ++ +L+ G+P+ STD   +V      +  LCV+P H+
Sbjct:   16 FIEALLPHVRAFAYTWFNLQARKRKYFKKHEKR-------MTKDEERAVKDELLGEKPEVKQKWASRLLAKLRKDIRPECREDFVL------SITGKKPPCCVLSNPDQKGKMRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLVKGGQCSNPILCVQPHHI 169          
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Zebrafish
Match: nfia (nuclear factor I/A [Source:ZFIN;Acc:ZDB-GENE-050208-501])

HSP 1 Score: 79.7221 bits (195), Expect = 1.005e-14
Identity = 50/167 (29.94%), Postives = 82/167 (49.10%), Query Frame = 3
Query:  396 FIHALLSRCKRLAPLWFKGALSMREKNRKEHKRGYTVSGVQTSSSWSAVLDKITEMSCRAETEMVMNLLKKLYKELASDSIIWFIKCWLRLPETRGENYYSCVLSRGDARGRMRRIDGGKGSDKVWRLDTIVSMLYHGMPMSSTDTNIIVHT---CDQELCVRPQHL 887
            FI ALL   +  A  WF      R+  +K  KR   +S  +  +    +L +  E+  +  + ++  L K +  E   D ++             G+    CVLS  D +G+MRRID  + +DKVWRLD ++ +L+ G+P+ STD   +V +    +  LCV+P H+
Sbjct:   15 FIEALLPHVRAFAYTWFNLQARKRKYFKKHEKR---MSKEEERAVKDELLSEKPEVKQKWASRLLAKLRKDIRPEFREDFVL----------TVTGKKPPCCVLSNPDQKGKMRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLVKSPQCSNPGLCVQPHHI 168          
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Xenopus
Match: kif2c (kinesin family member 2C [Source:Xenbase;Acc:XB-GENE-961445])

HSP 1 Score: 88.9669 bits (219), Expect = 1.078e-17
Identity = 72/277 (25.99%), Postives = 123/277 (44.40%), Query Frame = 3
Query:  396 FIHALLSRCKRLAPLWFKGALSMREKNRKEHKRGYTVSGVQTSSSWSAVLDKITEMSCRAETEMVMNLLKKLYKELASDSIIWFIKCWLRLPETRGENYYSCVLSRGDARGRMRRIDGGKGSDKVWRLDTIVSMLYHGMPMSSTDTNIIV---HTCDQELCVRPQHLRFRXXXXXXXXXXXXXQQGGYQLIPPK-KITKDKDNEKPESADTENGQQPXXXXXXXXXXXXXXXQNQDEVENSVEISGP-FNIEQIQQYLIQDLKPCVQSLEKMVLSAT 1211
            FI ALL   +  A  WF      R+  +K  K+        T      V D++       + +    LL KL K++  +    F+          G+   SCVLS  D +G+MRRID  + +DKVWRLD ++ +L+ G+P+ STD   +V   H  + +LCV+P H+      + L +     ++   Q   P+  I  D ++ KP + D  + Q+        + + +        V      +GP F++ ++Q +L  DL P    + + + S +
Sbjct:    7 FIEALLPHVRAFAYTWFNLQARKRKYYKKHEKK-------MTKEEERGVKDELLNEKAEVKQKWASRLLAKLRKDIRPEFREDFVLS------ITGKKAASCVLSNPDQKGKMRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLVKASHCSNHQLCVQPHHISVSVKELDLYLAYFIRERDSEQNSSPRTTIGSDLEDTKPINLDITDFQESFVTSGVFSVTELIQVSRTPVVSG----TGPNFSLGELQGHLAYDLNPTGTGMRRTLPSTS 266          
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Xenopus
Match: kif2c (kinesin family member 2C [Source:Xenbase;Acc:XB-GENE-961445])

HSP 1 Score: 88.9669 bits (219), Expect = 1.736e-17
Identity = 72/277 (25.99%), Postives = 123/277 (44.40%), Query Frame = 3
Query:  396 FIHALLSRCKRLAPLWFKGALSMREKNRKEHKRGYTVSGVQTSSSWSAVLDKITEMSCRAETEMVMNLLKKLYKELASDSIIWFIKCWLRLPETRGENYYSCVLSRGDARGRMRRIDGGKGSDKVWRLDTIVSMLYHGMPMSSTDTNIIV---HTCDQELCVRPQHLRFRXXXXXXXXXXXXXQQGGYQLIPPK-KITKDKDNEKPESADTENGQQPXXXXXXXXXXXXXXXQNQDEVENSVEISGP-FNIEQIQQYLIQDLKPCVQSLEKMVLSAT 1211
            FI ALL   +  A  WF      R+  +K  K+        T      V D++       + +    LL KL K++  +    F+          G+   SCVLS  D +G+MRRID  + +DKVWRLD ++ +L+ G+P+ STD   +V   H  + +LCV+P H+      + L +     ++   Q   P+  I  D ++ KP + D  + Q+        + + +        V      +GP F++ ++Q +L  DL P    + + + S +
Sbjct:    7 FIEALLPHVRAFAYTWFNLQARKRKYYKKHEKK-------MTKEEERGVKDELLNEKAEVKQKWASRLLAKLRKDIRPEFREDFVLS------ITGKKAASCVLSNPDQKGKMRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLVKASHCSNHQLCVQPHHISVSVKELDLYLAYFIRERDSEQNSSPRTTIGSDLEDTKPINLDITDFQESFVTSGVFSVTELIQVSRTPVVSG----TGPNFSLGELQGHLAYDLNPTGTGMRRTLPSTS 266          
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Xenopus
Match: kif2c (kinesin family member 2C [Source:Xenbase;Acc:XB-GENE-961445])

HSP 1 Score: 88.5817 bits (218), Expect = 2.148e-17
Identity = 72/277 (25.99%), Postives = 123/277 (44.40%), Query Frame = 3
Query:  396 FIHALLSRCKRLAPLWFKGALSMREKNRKEHKRGYTVSGVQTSSSWSAVLDKITEMSCRAETEMVMNLLKKLYKELASDSIIWFIKCWLRLPETRGENYYSCVLSRGDARGRMRRIDGGKGSDKVWRLDTIVSMLYHGMPMSSTDTNIIV---HTCDQELCVRPQHLRFRXXXXXXXXXXXXXQQGGYQLIPPK-KITKDKDNEKPESADTENGQQPXXXXXXXXXXXXXXXQNQDEVENSVEISGP-FNIEQIQQYLIQDLKPCVQSLEKMVLSAT 1211
            FI ALL   +  A  WF      R+  +K  K+        T      V D++       + +    LL KL K++  +    F+          G+   SCVLS  D +G+MRRID  + +DKVWRLD ++ +L+ G+P+ STD   +V   H  + +LCV+P H+      + L +     ++   Q   P+  I  D ++ KP + D  + Q+        + + +        V      +GP F++ ++Q +L  DL P    + + + S +
Sbjct:   16 FIEALLPHVRAFAYTWFNLQARKRKYYKKHEKK-------MTKEEERGVKDELLNEKAEVKQKWASRLLAKLRKDIRPEFREDFVLS------ITGKKAASCVLSNPDQKGKMRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLVKASHCSNHQLCVQPHHISVSVKELDLYLAYFIRERDSEQNSSPRTTIGSDLEDTKPINLDITDFQESFVTSGVFSVTELIQVSRTPVVSG----TGPNFSLGELQGHLAYDLNPTGTGMRRTLPSTS 275          
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Xenopus
Match: nfib (nuclear factor I B [Source:NCBI gene;Acc:100036601])

HSP 1 Score: 83.5741 bits (205), Expect = 7.541e-16
Identity = 50/167 (29.94%), Postives = 85/167 (50.90%), Query Frame = 3
Query:  396 FIHALLSRCKRLAPLWFKGALSMREKNRKEHKRGYTVSGVQTSSSWSAVLDKITEMSCRAETEMVMNLLKKLYKELASDSIIWFIKCWLRLPETRGENYYSCVLSRGDARGRMRRIDGGKGSDKVWRLDTIVSMLYHGMPMSSTDTNIIV---HTCDQELCVRPQHL 887
            FI ALL   + +A  WF      R+  +K  KR   +S  +  +    +L +  E+  +  + ++  L K + +E   D ++             G+ +  CVLS  D +G++RRID  + +DKVWRLD ++ +L+ G+P+ STD   +V   H  +  LCV+P H+
Sbjct:   15 FIEALLPHVRAIAYTWFNLQARKRKYFKKHEKR---MSKDEERAVKDELLSEKPEIKQKWASRLLAKLRKDIRQEYREDFVL----------TVTGKKHPCCVLSNPDQKGKIRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLVKSPHCTNPALCVQPHHI 168          
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Xenopus
Match: nfib (nuclear factor I B [Source:NCBI gene;Acc:100036601])

HSP 1 Score: 83.1889 bits (204), Expect = 1.204e-15
Identity = 50/167 (29.94%), Postives = 85/167 (50.90%), Query Frame = 3
Query:  396 FIHALLSRCKRLAPLWFKGALSMREKNRKEHKRGYTVSGVQTSSSWSAVLDKITEMSCRAETEMVMNLLKKLYKELASDSIIWFIKCWLRLPETRGENYYSCVLSRGDARGRMRRIDGGKGSDKVWRLDTIVSMLYHGMPMSSTDTNIIV---HTCDQELCVRPQHL 887
            FI ALL   + +A  WF      R+  +K  KR   +S  +  +    +L +  E+  +  + ++  L K + +E   D ++             G+ +  CVLS  D +G++RRID  + +DKVWRLD ++ +L+ G+P+ STD   +V   H  +  LCV+P H+
Sbjct:   61 FIEALLPHVRAIAYTWFNLQARKRKYFKKHEKR---MSKDEERAVKDELLSEKPEIKQKWASRLLAKLRKDIRQEYREDFVL----------TVTGKKHPCCVLSNPDQKGKIRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLVKSPHCTNPALCVQPHHI 214          
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Mouse
Match: Nfic (nuclear factor I/C [Source:MGI Symbol;Acc:MGI:109591])

HSP 1 Score: 88.1965 bits (217), Expect = 1.302e-17
Identity = 72/277 (25.99%), Postives = 123/277 (44.40%), Query Frame = 3
Query:  396 FIHALLSRCKRLAPLWFKGALSMREKNRKEHKRGYTVSGVQTSSSWSAVLDKITEMSCRAETEMVMNLLKKLYKELASDSIIWFIKCWLRLPETRGENYYSCVLSRGDARGRMRRIDGGKGSDKVWRLDTIVSMLYHGMPMSSTDTNIIVH--TCDQE-LCVRPQHLRFRXXXXXXXXXXXXXQQGGYQLIPPKK-ITKDKDNEKPESADTENGQQPXXXXXXXXXXXXXXXQNQDEVENSVEISGP-FNIEQIQQYLIQDLKPCVQSLEKMVLSAT 1211
            FI ALL   +  A  WF      R+  +K  KR        +     AV D++       + +    LL KL K++  +    F+          G+    CVLS  D +G+MRRID  + +DKVWRLD ++ +L+ G+P+ STD   +V    C    LCV+P H+      + L +     ++   Q   P+  +  D+++ KP + DT + Q+        + + +        V      +GP F++ ++Q +L  DL P    + + + S +
Sbjct:    7 FIEALLPHVRAFAYTWFNLQARKRKYFKKHEKR-------MSKDEERAVKDELLGEKAEVKQKWASRLLAKLRKDIRPECREDFVLA------VTGKKAPGCVLSNPDQKGKMRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLVKAAACAHPVLCVQPHHIGVAVKELDLYLAYFVRERDAEQSSSPRTGVGSDQEDSKPITLDTTDFQESFVTSGVFSVTELIQVSRTPVVTG----TGPNFSLGELQGHLAYDLNPASAGMRRTLPSTS 266          
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Mouse
Match: Nfic (nuclear factor I/C [Source:MGI Symbol;Acc:MGI:109591])

HSP 1 Score: 88.1965 bits (217), Expect = 1.328e-17
Identity = 72/277 (25.99%), Postives = 123/277 (44.40%), Query Frame = 3
Query:  396 FIHALLSRCKRLAPLWFKGALSMREKNRKEHKRGYTVSGVQTSSSWSAVLDKITEMSCRAETEMVMNLLKKLYKELASDSIIWFIKCWLRLPETRGENYYSCVLSRGDARGRMRRIDGGKGSDKVWRLDTIVSMLYHGMPMSSTDTNIIVH--TCDQE-LCVRPQHLRFRXXXXXXXXXXXXXQQGGYQLIPPKK-ITKDKDNEKPESADTENGQQPXXXXXXXXXXXXXXXQNQDEVENSVEISGP-FNIEQIQQYLIQDLKPCVQSLEKMVLSAT 1211
            FI ALL   +  A  WF      R+  +K  KR        +     AV D++       + +    LL KL K++  +    F+          G+    CVLS  D +G+MRRID  + +DKVWRLD ++ +L+ G+P+ STD   +V    C    LCV+P H+      + L +     ++   Q   P+  +  D+++ KP + DT + Q+        + + +        V      +GP F++ ++Q +L  DL P    + + + S +
Sbjct:   16 FIEALLPHVRAFAYTWFNLQARKRKYFKKHEKR-------MSKDEERAVKDELLGEKAEVKQKWASRLLAKLRKDIRPECREDFVLA------VTGKKAPGCVLSNPDQKGKMRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLVKAAACAHPVLCVQPHHIGVAVKELDLYLAYFVRERDAEQSSSPRTGVGSDQEDSKPITLDTTDFQESFVTSGVFSVTELIQVSRTPVVTG----TGPNFSLGELQGHLAYDLNPASAGMRRTLPSTS 275          
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Mouse
Match: Nfic (nuclear factor I/C [Source:MGI Symbol;Acc:MGI:109591])

HSP 1 Score: 87.4261 bits (215), Expect = 1.712e-17
Identity = 72/277 (25.99%), Postives = 123/277 (44.40%), Query Frame = 3
Query:  396 FIHALLSRCKRLAPLWFKGALSMREKNRKEHKRGYTVSGVQTSSSWSAVLDKITEMSCRAETEMVMNLLKKLYKELASDSIIWFIKCWLRLPETRGENYYSCVLSRGDARGRMRRIDGGKGSDKVWRLDTIVSMLYHGMPMSSTDTNIIVH--TCDQE-LCVRPQHLRFRXXXXXXXXXXXXXQQGGYQLIPPKK-ITKDKDNEKPESADTENGQQPXXXXXXXXXXXXXXXQNQDEVENSVEISGP-FNIEQIQQYLIQDLKPCVQSLEKMVLSAT 1211
            FI ALL   +  A  WF      R+  +K  KR        +     AV D++       + +    LL KL K++  +    F+          G+    CVLS  D +G+MRRID  + +DKVWRLD ++ +L+ G+P+ STD   +V    C    LCV+P H+      + L +     ++   Q   P+  +  D+++ KP + DT + Q+        + + +        V      +GP F++ ++Q +L  DL P    + + + S +
Sbjct:   16 FIEALLPHVRAFAYTWFNLQARKRKYFKKHEKR-------MSKDEERAVKDELLGEKAEVKQKWASRLLAKLRKDIRPECREDFVLA------VTGKKAPGCVLSNPDQKGKMRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLVKAAACAHPVLCVQPHHIGVAVKELDLYLAYFVRERDAEQSSSPRTGVGSDQEDSKPITLDTTDFQESFVTSGVFSVTELIQVSRTPVVTG----TGPNFSLGELQGHLAYDLNPASAGMRRTLPSTS 275          
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Mouse
Match: Nfic (nuclear factor I/C [Source:MGI Symbol;Acc:MGI:109591])

HSP 1 Score: 87.8113 bits (216), Expect = 1.780e-17
Identity = 72/277 (25.99%), Postives = 123/277 (44.40%), Query Frame = 3
Query:  396 FIHALLSRCKRLAPLWFKGALSMREKNRKEHKRGYTVSGVQTSSSWSAVLDKITEMSCRAETEMVMNLLKKLYKELASDSIIWFIKCWLRLPETRGENYYSCVLSRGDARGRMRRIDGGKGSDKVWRLDTIVSMLYHGMPMSSTDTNIIVH--TCDQE-LCVRPQHLRFRXXXXXXXXXXXXXQQGGYQLIPPKK-ITKDKDNEKPESADTENGQQPXXXXXXXXXXXXXXXQNQDEVENSVEISGP-FNIEQIQQYLIQDLKPCVQSLEKMVLSAT 1211
            FI ALL   +  A  WF      R+  +K  KR        +     AV D++       + +    LL KL K++  +    F+          G+    CVLS  D +G+MRRID  + +DKVWRLD ++ +L+ G+P+ STD   +V    C    LCV+P H+      + L +     ++   Q   P+  +  D+++ KP + DT + Q+        + + +        V      +GP F++ ++Q +L  DL P    + + + S +
Sbjct:   16 FIEALLPHVRAFAYTWFNLQARKRKYFKKHEKR-------MSKDEERAVKDELLGEKAEVKQKWASRLLAKLRKDIRPECREDFVLA------VTGKKAPGCVLSNPDQKGKMRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLVKAAACAHPVLCVQPHHIGVAVKELDLYLAYFVRERDAEQSSSPRTGVGSDQEDSKPITLDTTDFQESFVTSGVFSVTELIQVSRTPVVTG----TGPNFSLGELQGHLAYDLNPASAGMRRTLPSTS 275          
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Mouse
Match: Nfic (nuclear factor I/C [Source:MGI Symbol;Acc:MGI:109591])

HSP 1 Score: 87.0409 bits (214), Expect = 4.390e-17
Identity = 72/277 (25.99%), Postives = 123/277 (44.40%), Query Frame = 3
Query:  396 FIHALLSRCKRLAPLWFKGALSMREKNRKEHKRGYTVSGVQTSSSWSAVLDKITEMSCRAETEMVMNLLKKLYKELASDSIIWFIKCWLRLPETRGENYYSCVLSRGDARGRMRRIDGGKGSDKVWRLDTIVSMLYHGMPMSSTDTNIIVH--TCDQE-LCVRPQHLRFRXXXXXXXXXXXXXQQGGYQLIPPKK-ITKDKDNEKPESADTENGQQPXXXXXXXXXXXXXXXQNQDEVENSVEISGP-FNIEQIQQYLIQDLKPCVQSLEKMVLSAT 1211
            FI ALL   +  A  WF      R+  +K  KR        +     AV D++       + +    LL KL K++  +    F+          G+    CVLS  D +G+MRRID  + +DKVWRLD ++ +L+ G+P+ STD   +V    C    LCV+P H+      + L +     ++   Q   P+  +  D+++ KP + DT + Q+        + + +        V      +GP F++ ++Q +L  DL P    + + + S +
Sbjct:   38 FIEALLPHVRAFAYTWFNLQARKRKYFKKHEKR-------MSKDEERAVKDELLGEKAEVKQKWASRLLAKLRKDIRPECREDFVLA------VTGKKAPGCVLSNPDQKGKMRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLVKAAACAHPVLCVQPHHIGVAVKELDLYLAYFVRERDAEQSSSPRTGVGSDQEDSKPITLDTTDFQESFVTSGVFSVTELIQVSRTPVVTG----TGPNFSLGELQGHLAYDLNPASAGMRRTLPSTS 297          
BLAST of CTF/NF-I domain-containing protein vs. UniProt/SwissProt
Match: sp|P70255|NFIC_MOUSE (Nuclear factor 1 C-type OS=Mus musculus OX=10090 GN=Nfic PE=1 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 1.245e-16
Identity = 72/277 (25.99%), Postives = 123/277 (44.40%), Query Frame = 3
Query:  396 FIHALLSRCKRLAPLWFKGALSMREKNRKEHKRGYTVSGVQTSSSWSAVLDKITEMSCRAETEMVMNLLKKLYKELASDSIIWFIKCWLRLPETRGENYYSCVLSRGDARGRMRRIDGGKGSDKVWRLDTIVSMLYHGMPMSSTDTNIIVH--TCDQE-LCVRPQHLRFRXXXXXXXXXXXXXQQGGYQLIPPKK-ITKDKDNEKPESADTENGQQPXXXXXXXXXXXXXXXQNQDEVENSVEISGP-FNIEQIQQYLIQDLKPCVQSLEKMVLSAT 1211
            FI ALL   +  A  WF      R+  +K  KR        +     AV D++       + +    LL KL K++  +    F+          G+    CVLS  D +G+MRRID  + +DKVWRLD ++ +L+ G+P+ STD   +V    C    LCV+P H+      + L +     ++   Q   P+  +  D+++ KP + DT + Q+        + + +        V      +GP F++ ++Q +L  DL P    + + + S +
Sbjct:   16 FIEALLPHVRAFAYTWFNLQARKRKYFKKHEKR-------MSKDEERAVKDELLGEKAEVKQKWASRLLAKLRKDIRPECREDFVLA------VTGKKAPGCVLSNPDQKGKMRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLVKAAACAHPVLCVQPHHIGVAVKELDLYLAYFVRERDAEQSSSPRTGVGSDQEDSKPITLDTTDFQESFVTSGVFSVTELIQVSRTPVVTG----TGPNFSLGELQGHLAYDLNPASAGMRRTLPSTS 275          
BLAST of CTF/NF-I domain-containing protein vs. UniProt/SwissProt
Match: sp|P17926|NFIC_CHICK (Nuclear factor 1 C-type OS=Gallus gallus OX=9031 GN=NFIC PE=1 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 1.781e-16
Identity = 71/277 (25.63%), Postives = 123/277 (44.40%), Query Frame = 3
Query:  396 FIHALLSRCKRLAPLWFKGALSMREKNRKEHKRGYTVSGVQTSSSWSAVLDKITEMSCRAETEMVMNLLKKLYKELASDSIIWFIKCWLRLPETRGENYYSCVLSRGDARGRMRRIDGGKGSDKVWRLDTIVSMLYHGMPMSSTDTNIIV---HTCDQELCVRPQHLRFRXXXXXXXXXXXXXQQGGYQLIPPKK-ITKDKDNEKPESADTENGQQPXXXXXXXXXXXXXXXQNQDEVENSVEISGP-FNIEQIQQYLIQDLKPCVQSLEKMVLSAT 1211
            FI ALL   +  A  WF      R+  +K  KR        T     AV D++       + +    LL KL K++  +    F+          G+    CVLS  D +G+MRRID  + +DKVWRLD ++ +L+ G+P+ STD   +V      +  LC++P H+      + L +     ++   Q   P+  I  D+++ KP + D+ + Q+        + + +        V      +GP F++ ++Q +L  DL P    + + + S +
Sbjct:   16 FIEALLPHVRAFAYTWFNLQARKRKYFKKHEKR-------MTKDEERAVKDELLSEKPEVKQKWASRLLAKLRKDIRPECREDFVL------SITGKKPSCCVLSNPDQKGKMRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLVKAGQCTNPILCIQPHHISVSVKELDLYLAYFVRERDSEQSSSPRTGIASDQEDTKPNTLDSTDFQESFVTSGVFSVTELIQVSRTPVVTG----TGPNFSLGELQGHLAYDLNPSSTGMRRTLPSTS 275          
BLAST of CTF/NF-I domain-containing protein vs. UniProt/SwissProt
Match: sp|P21999|NFIC_PIG (Nuclear factor 1 C-type OS=Sus scrofa OX=9823 GN=NFIC PE=3 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 7.423e-16
Identity = 71/277 (25.63%), Postives = 123/277 (44.40%), Query Frame = 3
Query:  396 FIHALLSRCKRLAPLWFKGALSMREKNRKEHKRGYTVSGVQTSSSWSAVLDKITEMSCRAETEMVMNLLKKLYKELASDSIIWFIKCWLRLPETRGENYYSCVLSRGDARGRMRRIDGGKGSDKVWRLDTIVSMLYHGMPMSSTDTNIIVHT--CDQE-LCVRPQHLRFRXXXXXXXXXXXXXQQGGYQLIPPKK-ITKDKDNEKPESADTENGQQPXXXXXXXXXXXXXXXQNQDEVENSVEISGP-FNIEQIQQYLIQDLKPCVQSLEKMVLSAT 1211
            FI ALL   +  A  WF      R+  +K  KR        +     AV D++       + +    LL KL K++  +    F+          G+    CVLS  D +G+MRRID  + +DKVWRLD ++ +L+ G+P+ STD   +V    C    LCV+P H+      + L +     ++   Q   P+  +  D+++ KP + DT + Q+        + + +        V      +GP F++ ++Q ++  DL P    + + + S +
Sbjct:   16 FIEALLPHVRAFAYTWFNLQARKRKYFKKHEKR-------MSKDEERAVKDELLGEKAEVKQKWASRLLAKLRKDIRPECREDFVLA------ITGKKAPGCVLSNPDQKGKMRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLVKAAQCGHPVLCVQPHHIGVAVKELDLYLAYFVRERDAEQSGSPRAGMGSDQEDSKPITLDTTDFQESFVTSGVFSVTELIQVSRTPVVTG----TGPNFSLGELQGHMAYDLNPASTGMRRTLPSTS 275          
BLAST of CTF/NF-I domain-containing protein vs. UniProt/SwissProt
Match: sp|P08651|NFIC_HUMAN (Nuclear factor 1 C-type OS=Homo sapiens OX=9606 GN=NFIC PE=1 SV=2)

HSP 1 Score: 85.8853 bits (211), Expect = 7.967e-16
Identity = 73/277 (26.35%), Postives = 123/277 (44.40%), Query Frame = 3
Query:  396 FIHALLSRCKRLAPLWFKGALSMREKNRKEHKRGYTVSGVQTSSSWSAVLDKITEMSCRAETEMVMNLLKKLYKELASDSIIWFIKCWLRLPETRGENYYSCVLSRGDARGRMRRIDGGKGSDKVWRLDTIVSMLYHGMPMSSTDTNIIVHT--CDQE-LCVRPQHLRFRXXXXXXXXXXXXXQQGGYQLIPPKK-ITKDKDNEKPESADTENGQQPXXXXXXXXXXXXXXXQNQDEVENSVEISGP-FNIEQIQQYLIQDLKPCVQSLEKMVLSAT 1211
            FI ALL   +  A  WF      R+  +K  KR        +     AV D++       + +    LL KL K++  +    F+          G+    CVLS  D +G+MRRID  + +DKVWRLD ++ +L+ G+P+ STD   +V    C    LCV+P H+      + L +     ++   Q   P+  +  D+++ KP + DT + Q+        + + +        V      +GP F++ ++Q +L  DL P    L + + S +
Sbjct:   16 FIEALLPHVRAFAYTWFNLQARKRKYFKKHEKR-------MSKDEERAVKDELLGEKPEVKQKWASRLLAKLRKDIRPECREDFVL------SITGKKAPGCVLSNPDQKGKMRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLVKAAQCGHPVLCVQPHHIGVAVKELDLYLAYFVRERDAEQSGSPRTGMGSDQEDSKPITLDTTDFQESFVTSGVFSVTELIQVSRTPVVTG----TGPNFSLGELQGHLAYDLNPASTGLRRTLPSTS 275          
BLAST of CTF/NF-I domain-containing protein vs. UniProt/SwissProt
Match: sp|Q0VCL6|NFIB_BOVIN (Nuclear factor 1 B-type OS=Bos taurus OX=9913 GN=NFIB PE=2 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 7.289e-15
Identity = 49/167 (29.34%), Postives = 85/167 (50.90%), Query Frame = 3
Query:  396 FIHALLSRCKRLAPLWFKGALSMREKNRKEHKRGYTVSGVQTSSSWSAVLDKITEMSCRAETEMVMNLLKKLYKELASDSIIWFIKCWLRLPETRGENYYSCVLSRGDARGRMRRIDGGKGSDKVWRLDTIVSMLYHGMPMSSTDTNIIV---HTCDQELCVRPQHL 887
            FI ALL   + +A  WF      R+  +K  KR   +S  +  +    +L +  E+  +  + ++  L K + +E   D ++             G+ +  CVLS  D +G++RRID  + +DKVWRLD ++ +L+ G+P+ STD   ++   H  +  LCV+P H+
Sbjct:   16 FIEALLPHVRAIAYTWFNLQARKRKYFKKHEKR---MSKDEERAVKDELLSEKPEIKQKWASRLLAKLRKDIRQEYREDFVL----------TVTGKKHPCCVLSNPDQKGKIRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLMKSPHCTNPALCVQPHHI 169          
BLAST of CTF/NF-I domain-containing protein vs. TrEMBL
Match: G7YHM3 (Nuclear factor 1 A-type OS=Clonorchis sinensis OX=79923 GN=CLF_108118 PE=4 SV=1)

HSP 1 Score: 272.707 bits (696), Expect = 1.090e-76
Identity = 162/301 (53.82%), Postives = 200/301 (66.45%), Query Frame = 3
Query:  387 EALFIHALLSRCKRLAPLWFKGALSMREKNRKEHKRGYTVSGVQTSSSWSAVLDKITEMSCRAETEMVMNLLKKLYKELASDSIIWFIKCWLRLPETRGENYYSCVLSRGDARGRMRRIDGGKGSDKVWRLDTIVSMLYHGMPMSSTDTNIIVHTCDQELCVRPQHLRFRXXXXXXXXXXXXXQQGGYQLIPPKKITKDKDNEKPESADTENGQQPXXXXXXXXXXXXXXXQNQDEVENSVEISGPFNIEQIQQYLIQDLKPCVQSLEKMVLSATDRSILCANPDLDNINNITAISSTYDS 1289
            EALF+ AL+ RCKR+APLWF+G  SMRE+NR+E++R    SG QT   WS +  KI EM+  +ET+ V NLLKKLYKEL +DS+ WF+KCWL   E   ++  SCV+SRGDA+GRMRRIDGGKGSDKVWRLDTIV MLYHG+PMSSTDTNI+VHTCDQELCVRPQH+RFRAS+VAL VVLKAL Q GY +IPP  I    D   P ++D                              SV++ GPF I+++QQY  ++L P  +S+ K+ LSA DR      P L  I     I+ T +S
Sbjct:  164 EALFVRALIGRCKRIAPLWFRGVSSMRERNREENRRMANNSG-QTQGDWSLIGLKIAEMNATSETDAVANLLKKLYKELPADSVFWFLKCWL-CSEDSLQDPDSCVISRGDAKGRMRRIDGGKGSDKVWRLDTIVGMLYHGLPMSSTDTNIMVHTCDQELCVRPQHIRFRASSVALVVVLKALAQAGYTVIPP-PIPAGPDGVAPNASD-----------------------------ESVDVFGPFTIDELQQYRRENLNPAEESISKLSLSAADREFAETVPVLRTILQGHRIADTGES 432          
BLAST of CTF/NF-I domain-containing protein vs. TrEMBL
Match: G4LYE7 (CTF/NF-I domain-containing protein OS=Schistosoma mansoni OX=6183 GN=Smp_152430 PE=4 SV=1)

HSP 1 Score: 277.715 bits (709), Expect = 3.013e-73
Identity = 156/280 (55.71%), Postives = 195/280 (69.64%), Query Frame = 3
Query:  387 EALFIHALLSRCKRLAPLWFKGALSMREKNRKEHKRGYTVSGVQTSSSWSAVLDKITEMSCRAETEMVMNLLKKLYKELASDSIIWFIKCWLRLPETRGENYYSCVLSRGDARGRMRRIDGGKGSDKVWRLDTIVSMLYHGMPMSSTDTNIIVHTCDQELCVRPQHLRFRXXXXXXXXXXXXXQQGGYQLIPPKKITKDKDNEKPESADTENGQQPXXXXXXXXXXXXXXXQNQDEVENSVEISGPFNIEQIQQYLIQDLKPCVQSLEKMVLSATDRSIL 1226
            EALF+ AL+ RCKR+APLWF+G  SMRE+NR+E++R    SG Q+ S WS +  KI EM+  +ET+ V NLLKKLYKEL SDS+ WF+KCWL   +T  + + SCV+SRGDA+GRMRRIDGGKGSDKVWRLDTIV MLYHG+PMSSTDTNI+VHTCD ELCVRPQH+RFRAS+VAL VVLKAL Q GY +IPP  I  + +   P   D                               V++ GPF+IEQ+QQY  ++L P  +S+ K+ LSA+DR ++
Sbjct:  155 EALFVRALIGRCKRIAPLWFRGVSSMRERNREENRRMACNSG-QSQSDWSLIALKIGEMNAGSETDAVSNLLKKLYKELPSDSVFWFLKCWLGSEDTLNDPH-SCVISRGDAKGRMRRIDGGKGSDKVWRLDTIVGMLYHGLPMSSTDTNIMVHTCDHELCVRPQHIRFRASSVALVVVLKALAQAGYTIIPP-SIAANSEGIAPNVPDEY-----------------------------VDVFGPFSIEQLQQYRSENLNPANESISKLTLSASDRDLI 402          
BLAST of CTF/NF-I domain-containing protein vs. TrEMBL
Match: A0A095AVC4 (Nuclear factor 1 C-type OS=Schistosoma haematobium OX=6185 GN=MS3_06913 PE=4 SV=1)

HSP 1 Score: 279.641 bits (714), Expect = 4.186e-73
Identity = 156/280 (55.71%), Postives = 195/280 (69.64%), Query Frame = 3
Query:  387 EALFIHALLSRCKRLAPLWFKGALSMREKNRKEHKRGYTVSGVQTSSSWSAVLDKITEMSCRAETEMVMNLLKKLYKELASDSIIWFIKCWLRLPETRGENYYSCVLSRGDARGRMRRIDGGKGSDKVWRLDTIVSMLYHGMPMSSTDTNIIVHTCDQELCVRPQHLRFRXXXXXXXXXXXXXQQGGYQLIPPKKITKDKDNEKPESADTENGQQPXXXXXXXXXXXXXXXQNQDEVENSVEISGPFNIEQIQQYLIQDLKPCVQSLEKMVLSATDRSIL 1226
            EALF+ AL+ RCKR+APLWF+G  SMRE+NR+E++R    SG Q+ S WS +  KI EM+  +ET+ V NLLKKLYKEL SDS+ WF+KCWL   +T  +  +SCV+SRGDA+GRMRRIDGGKGSDKVWRLDTIV MLYHG+PMSSTDTNI+VHTCD ELCVRPQH+RFRAS+VAL VVLKAL Q GY +IPP  I  + +   P   D                               V++ GPF+IEQ+QQY  ++L P  +S+ K+ LSA+DR ++
Sbjct:  155 EALFVRALIGRCKRIAPLWFRGVSSMRERNREENRRMACNSG-QSQSDWSLIALKIGEMNAGSETDAVSNLLKKLYKELPSDSVFWFLKCWLGSEDTLND-PHSCVISRGDAKGRMRRIDGGKGSDKVWRLDTIVGMLYHGLPMSSTDTNIMVHTCDHELCVRPQHIRFRASSVALVVVLKALAQAGYTIIPP-SIAANPEGIAPNVPDEY-----------------------------VDVFGPFSIEQLQQYRSENLNPANESISKLTLSASDRDLI 402          
BLAST of CTF/NF-I domain-containing protein vs. TrEMBL
Match: A0A3Q0KQ32 (CTF/NF-I domain-containing protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 280.026 bits (715), Expect = 5.285e-73
Identity = 156/280 (55.71%), Postives = 195/280 (69.64%), Query Frame = 3
Query:  387 EALFIHALLSRCKRLAPLWFKGALSMREKNRKEHKRGYTVSGVQTSSSWSAVLDKITEMSCRAETEMVMNLLKKLYKELASDSIIWFIKCWLRLPETRGENYYSCVLSRGDARGRMRRIDGGKGSDKVWRLDTIVSMLYHGMPMSSTDTNIIVHTCDQELCVRPQHLRFRXXXXXXXXXXXXXQQGGYQLIPPKKITKDKDNEKPESADTENGQQPXXXXXXXXXXXXXXXQNQDEVENSVEISGPFNIEQIQQYLIQDLKPCVQSLEKMVLSATDRSIL 1226
            EALF+ AL+ RCKR+APLWF+G  SMRE+NR+E++R    SG Q+ S WS +  KI EM+  +ET+ V NLLKKLYKEL SDS+ WF+KCWL   +T  +  +SCV+SRGDA+GRMRRIDGGKGSDKVWRLDTIV MLYHG+PMSSTDTNI+VHTCD ELCVRPQH+RFRAS+VAL VVLKAL Q GY +IPP  I  + +   P   D                               V++ GPF+IEQ+QQY  ++L P  +S+ K+ LSA+DR ++
Sbjct:  155 EALFVRALIGRCKRIAPLWFRGVSSMRERNREENRRMACNSG-QSQSDWSLIALKIGEMNAGSETDAVSNLLKKLYKELPSDSVFWFLKCWLGSEDTLND-PHSCVISRGDAKGRMRRIDGGKGSDKVWRLDTIVGMLYHGLPMSSTDTNIMVHTCDHELCVRPQHIRFRASSVALVVVLKALAQAGYTIIPP-SIAANSEGIAPNVPDEY-----------------------------VDVFGPFSIEQLQQYRSENLNPANESISKLTLSASDRDLI 402          
BLAST of CTF/NF-I domain-containing protein vs. TrEMBL
Match: A0A4V3SD97 (CTF/NF-I domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_008887 PE=4 SV=1)

HSP 1 Score: 279.256 bits (713), Expect = 6.020e-73
Identity = 162/301 (53.82%), Postives = 200/301 (66.45%), Query Frame = 3
Query:  387 EALFIHALLSRCKRLAPLWFKGALSMREKNRKEHKRGYTVSGVQTSSSWSAVLDKITEMSCRAETEMVMNLLKKLYKELASDSIIWFIKCWLRLPETRGENYYSCVLSRGDARGRMRRIDGGKGSDKVWRLDTIVSMLYHGMPMSSTDTNIIVHTCDQELCVRPQHLRFRXXXXXXXXXXXXXQQGGYQLIPPKKITKDKDNEKPESADTENGQQPXXXXXXXXXXXXXXXQNQDEVENSVEISGPFNIEQIQQYLIQDLKPCVQSLEKMVLSATDRSILCANPDLDNINNITAISSTYDS 1289
            EALF+ AL+ RCKR+APLWF+G  SMRE+NR+E++R    SG QT   WS +  KI EM+  +ET+ V NLLKKLYKEL +DS+ WF+KCWL   E   ++  SCV+SRGDA+GRMRRIDGGKGSDKVWRLDTIV MLYHG+PMSSTDTNI+VHTCDQELCVRPQH+RFRAS+VAL VVLKAL Q GY +IPP  I    D   P ++D                              SV++ GPF I+++QQY  ++L P  +S+ K+ LSA DR      P L  I     I+ T +S
Sbjct:  164 EALFVRALIGRCKRIAPLWFRGVSSMRERNREENRRMANNSG-QTQGDWSLIGLKIAEMNATSETDAVANLLKKLYKELPADSVFWFLKCWL-CSEDSLQDPDSCVISRGDAKGRMRRIDGGKGSDKVWRLDTIVGMLYHGLPMSSTDTNIMVHTCDQELCVRPQHIRFRASSVALVVVLKALAQAGYTVIPP-PIPAGPDGVAPNASD-----------------------------ESVDVFGPFTIDELQQYRRENLNPAEESISKLSLSAADREFAETVPVLRTILQGHRIADTVES 432          
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000055156.1 (nuclear factor 1 B-type-like [Source:NCBI gene;Acc:111189355])

HSP 1 Score: 83.5741 bits (205), Expect = 2.700e-17
Identity = 51/167 (30.54%), Postives = 86/167 (51.50%), Query Frame = 3
Query:  396 FIHALLSRCKRLAPLWFKGALSMREKNRKEHKRGYTVSGVQTSSSWSAVLDKITEMSCRAETEMVMNLLKKLYKELASDSIIWFIKCWLRLPETRGENYYSCVLSRGDARGRMRRIDGGKGSDKVWRLDTIVSMLYHGMPMSSTDTNIIV---HTCDQELCVRPQHL 887
            FI ALL   + +A  WF      R+  +K  KR   +S  +  +    +L +  E+  +  + ++  L K + +E   D ++             G+ +  CVLS  D +G++RRID  + +DKVWRLD ++ +L+ G+P+ STD   +V   H  +Q LCV+P H+
Sbjct:   15 FIEALLPHVRSIAYTWFNLQARKRKYFKKHEKR---MSKDEERAVKDELLSEKPEIKQKWASRLLAKLRKDIRQEYREDFVL----------SVTGKKHPCCVLSNPDQKGKIRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLVKSPHCTNQALCVQPHHI 168          
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Cavefish
Match: nfia (nuclear factor I A [Source:NCBI gene;Acc:103027676])

HSP 1 Score: 80.1073 bits (196), Expect = 6.458e-15
Identity = 52/167 (31.14%), Postives = 80/167 (47.90%), Query Frame = 3
Query:  396 FIHALLSRCKRLAPLWFKGALSMREKNRKEHKRGYTVSGVQTSSSWSAVLDKITEMSCRAETEMVMNLLKKLYKELASDSIIWFIKCWLRLPETRGENYYSCVLSRGDARGRMRRIDGGKGSDKVWRLDTIVSMLYHGMPMSSTDTNIIVHT---CDQELCVRPQHL 887
            FI ALL   +  A  WF      R+  +K  KR        +     AV D++       + +    LL KL K++  +    F+          G+    CVLS  D +G+MRRID  + +DKVWRLD ++ +L+ G+P+ STD   +V +    +  LCV+P H+
Sbjct:   15 FIEALLPHVRAFAYTWFNLQARKRKYFKKHEKR-------MSKEEERAVKDELLAEKAEVKQKWASRLLAKLRKDIRPEFREDFVLT------VTGKKPPCCVLSNPDQKGKMRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLVKSPQCSNPGLCVQPHHI 168          
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Cavefish
Match: nfia (nuclear factor I A [Source:NCBI gene;Acc:103027676])

HSP 1 Score: 79.337 bits (194), Expect = 8.234e-15
Identity = 52/167 (31.14%), Postives = 80/167 (47.90%), Query Frame = 3
Query:  396 FIHALLSRCKRLAPLWFKGALSMREKNRKEHKRGYTVSGVQTSSSWSAVLDKITEMSCRAETEMVMNLLKKLYKELASDSIIWFIKCWLRLPETRGENYYSCVLSRGDARGRMRRIDGGKGSDKVWRLDTIVSMLYHGMPMSSTDTNIIVHT---CDQELCVRPQHL 887
            FI ALL   +  A  WF      R+  +K  KR        +     AV D++       + +    LL KL K++  +    F+          G+    CVLS  D +G+MRRID  + +DKVWRLD ++ +L+ G+P+ STD   +V +    +  LCV+P H+
Sbjct:   15 FIEALLPHVRAFAYTWFNLQARKRKYFKKHEKR-------MSKEEERAVKDELLAEKAEVKQKWASRLLAKLRKDIRPEFREDFVLT------VTGKKPPCCVLSNPDQKGKMRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLVKSPQCSNPGLCVQPHHI 168          
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Cavefish
Match: nfia (nuclear factor I A [Source:NCBI gene;Acc:103027676])

HSP 1 Score: 79.337 bits (194), Expect = 1.156e-14
Identity = 50/167 (29.94%), Postives = 82/167 (49.10%), Query Frame = 3
Query:  396 FIHALLSRCKRLAPLWFKGALSMREKNRKEHKRGYTVSGVQTSSSWSAVLDKITEMSCRAETEMVMNLLKKLYKELASDSIIWFIKCWLRLPETRGENYYSCVLSRGDARGRMRRIDGGKGSDKVWRLDTIVSMLYHGMPMSSTDTNIIVHT---CDQELCVRPQHL 887
            FI ALL   +  A  WF      R+  +K  KR   +S  +  +    +L +  E+  +  + ++  L K +  E   D ++             G+    CVLS  D +G+MRRID  + +DKVWRLD ++ +L+ G+P+ STD   +V +    +  LCV+P H+
Sbjct:   73 FIEALLPHVRAFAYTWFNLQARKRKYFKKHEKR---MSKEEERAVKDELLAEKAEVKQKWASRLLAKLRKDIRPEFREDFVL----------TVTGKKPPCCVLSNPDQKGKMRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLVKSPQCSNPGLCVQPHHI 226          
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Cavefish
Match: nfia (nuclear factor I A [Source:NCBI gene;Acc:103027676])

HSP 1 Score: 79.337 bits (194), Expect = 1.185e-14
Identity = 50/167 (29.94%), Postives = 82/167 (49.10%), Query Frame = 3
Query:  396 FIHALLSRCKRLAPLWFKGALSMREKNRKEHKRGYTVSGVQTSSSWSAVLDKITEMSCRAETEMVMNLLKKLYKELASDSIIWFIKCWLRLPETRGENYYSCVLSRGDARGRMRRIDGGKGSDKVWRLDTIVSMLYHGMPMSSTDTNIIVHT---CDQELCVRPQHL 887
            FI ALL   +  A  WF      R+  +K  KR   +S  +  +    +L +  E+  +  + ++  L K +  E   D ++             G+    CVLS  D +G+MRRID  + +DKVWRLD ++ +L+ G+P+ STD   +V +    +  LCV+P H+
Sbjct:   73 FIEALLPHVRAFAYTWFNLQARKRKYFKKHEKR---MSKEEERAVKDELLAEKAEVKQKWASRLLAKLRKDIRPEFREDFVL----------TVTGKKPPCCVLSNPDQKGKMRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLVKSPQCSNPGLCVQPHHI 226          
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Sea Lamprey
Match: nfia (nuclear factor I/A [Source:ZFIN;Acc:ZDB-GENE-050208-501])

HSP 1 Score: 78.1814 bits (191), Expect = 1.125e-16
Identity = 50/167 (29.94%), Postives = 83/167 (49.70%), Query Frame = 3
Query:  396 FIHALLSRCKRLAPLWFKGALSMREKNRKEHKRGYTVSGVQTSSSWSAVLDKITEMSCRAETEMVMNLLKKLYKELASDSIIWFIKCWLRLPETRGENYYSCVLSRGDARGRMRRIDGGKGSDKVWRLDTIVSMLYHGMPMSSTDTNIIVHT---CDQELCVRPQHL 887
            FI ALL   +  A  WF      R+  +K  KR   +S  +  +    +L + +E+  +  + ++  L K +  E   D ++             G+    CVLS  D +G+MRRID  + +DKVWRLD ++ +L+ G+P+ STD   +V +    +  LCV+P H+
Sbjct:    7 FIEALLPHVRAFAYTWFNLQARKRKYFKKHEKR---MSKDEERAVKDELLGEKSEVKQKWASRLLAKLRKDIRPEFREDFVL----------TVTGKKPPCCVLSNPDQKGKMRRIDCLRQADKVWRLDLVMVILFKGVPLESTDGERLVKSPQCANPGLCVQPHHI 160          
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Nematostella
Match: EDO45394 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RT45])

HSP 1 Score: 65.4698 bits (158), Expect = 6.084e-12
Identity = 48/167 (28.74%), Postives = 78/167 (46.71%), Query Frame = 3
Query:  396 FIHALLSRCKRLAPLWFKGALSMREKNRKEHKRGYTVSGVQTSSSWSAVLDKITEMSCRAETEMVMNLLKKLYKELASDSIIWFIKCWLRLPETRGENYYSCVLSRGDARGRMRRIDGGKGSDKVWRLDTIVSMLYHGMPMSSTDTNIIVHT--CDQE-LCVRPQHL 887
            FI +LL   K  A  WF      R+  +K   R       +      A  D++         +    LL KL K++ ++    F+   + +   +  +   CV+S  D +G+MRRID  + +DKVWRLD ++ +L+ G+P+ STD   +  +  C    LCV P H+
Sbjct:   16 FIESLLPHVKAFAYTWFNLQARKRKHYKKHDIRMTPAEERRCKEELDAEADEVKH-------KWASRLLGKLRKDILAECREEFV---MAIAGGKPGSSCRCVISNQDQKGKMRRIDCLRQADKVWRLDLVMVILFRGIPLESTDGERLGKSEYCRHPGLCVLPNHI 172          
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Medaka
Match: nfia (nuclear factor I A [Source:NCBI gene;Acc:101158842])

HSP 1 Score: 82.0333 bits (201), Expect = 1.948e-15
Identity = 50/167 (29.94%), Postives = 82/167 (49.10%), Query Frame = 3
Query:  396 FIHALLSRCKRLAPLWFKGALSMREKNRKEHKRGYTVSGVQTSSSWSAVLDKITEMSCRAETEMVMNLLKKLYKELASDSIIWFIKCWLRLPETRGENYYSCVLSRGDARGRMRRIDGGKGSDKVWRLDTIVSMLYHGMPMSSTDTNIIVHT---CDQELCVRPQHL 887
            FI ALL   +  A  WF      R+  +K  KR   +S  +  +    +L +  E+  +  + ++  L K +  E   D ++             G+    CVLS  D +G+MRRID  + +DKVWRLD ++ +L+ G+P+ STD   +V +    +  LCV+P H+
Sbjct:    6 FIEALLPHVRAFAYTWFNLQARKRKYFKKHEKR---MSKEEERAVKDELLSEKPEVKQKWASRLLAKLRKDIRPEFREDFVL----------TVTGKKPPCCVLSNPDQKGKMRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLVKSPQCSNPSLCVQPHHI 159          
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Medaka
Match: NFIB (nuclear factor I B [Source:NCBI gene;Acc:101169147])

HSP 1 Score: 81.2629 bits (199), Expect = 2.947e-15
Identity = 50/167 (29.94%), Postives = 84/167 (50.30%), Query Frame = 3
Query:  396 FIHALLSRCKRLAPLWFKGALSMREKNRKEHKRGYTVSGVQTSSSWSAVLDKITEMSCRAETEMVMNLLKKLYKELASDSIIWFIKCWLRLPETRGENYYSCVLSRGDARGRMRRIDGGKGSDKVWRLDTIVSMLYHGMPMSSTDTNIIV---HTCDQELCVRPQHL 887
            FI ALL   + +A  WF      R+  +K  KR   +S  +  +    +L +  E+  +  + ++  L K + +E   D ++             G+    CVLS  D +G++RRID  + +DKVWRLD ++ +L+ G+P+ STD   +V   H  +  LCV+P H+
Sbjct:   12 FIEALLPHVRAIAYTWFNLQARKRKYFKKHEKR---MSKDEERAVKDELLSEKPEVKQKWASRLLAKLRKDIRQEYREDFVL----------SVTGKKPPCCVLSNPDQKGKIRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLVKSPHCTNPALCVQPHHI 165          
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Medaka
Match: NFIB (nuclear factor I B [Source:NCBI gene;Acc:101169147])

HSP 1 Score: 81.2629 bits (199), Expect = 2.947e-15
Identity = 50/167 (29.94%), Postives = 84/167 (50.30%), Query Frame = 3
Query:  396 FIHALLSRCKRLAPLWFKGALSMREKNRKEHKRGYTVSGVQTSSSWSAVLDKITEMSCRAETEMVMNLLKKLYKELASDSIIWFIKCWLRLPETRGENYYSCVLSRGDARGRMRRIDGGKGSDKVWRLDTIVSMLYHGMPMSSTDTNIIV---HTCDQELCVRPQHL 887
            FI ALL   + +A  WF      R+  +K  KR   +S  +  +    +L +  E+  +  + ++  L K + +E   D ++             G+    CVLS  D +G++RRID  + +DKVWRLD ++ +L+ G+P+ STD   +V   H  +  LCV+P H+
Sbjct:   12 FIEALLPHVRAIAYTWFNLQARKRKYFKKHEKR---MSKDEERAVKDELLSEKPEVKQKWASRLLAKLRKDIRQEYREDFVL----------SVTGKKPPCCVLSNPDQKGKIRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLVKSPHCTNPALCVQPHHI 165          
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Medaka
Match: NFIB (nuclear factor I B [Source:NCBI gene;Acc:101169147])

HSP 1 Score: 81.2629 bits (199), Expect = 3.077e-15
Identity = 50/167 (29.94%), Postives = 84/167 (50.30%), Query Frame = 3
Query:  396 FIHALLSRCKRLAPLWFKGALSMREKNRKEHKRGYTVSGVQTSSSWSAVLDKITEMSCRAETEMVMNLLKKLYKELASDSIIWFIKCWLRLPETRGENYYSCVLSRGDARGRMRRIDGGKGSDKVWRLDTIVSMLYHGMPMSSTDTNIIV---HTCDQELCVRPQHL 887
            FI ALL   + +A  WF      R+  +K  KR   +S  +  +    +L +  E+  +  + ++  L K + +E   D ++             G+    CVLS  D +G++RRID  + +DKVWRLD ++ +L+ G+P+ STD   +V   H  +  LCV+P H+
Sbjct:   15 FIEALLPHVRAIAYTWFNLQARKRKYFKKHEKR---MSKDEERAVKDELLSEKPEVKQKWASRLLAKLRKDIRQEYREDFVL----------SVTGKKPPCCVLSNPDQKGKIRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLVKSPHCTNPALCVQPHHI 168          
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Medaka
Match: NFIB (nuclear factor I B [Source:NCBI gene;Acc:101169147])

HSP 1 Score: 81.2629 bits (199), Expect = 3.197e-15
Identity = 50/167 (29.94%), Postives = 84/167 (50.30%), Query Frame = 3
Query:  396 FIHALLSRCKRLAPLWFKGALSMREKNRKEHKRGYTVSGVQTSSSWSAVLDKITEMSCRAETEMVMNLLKKLYKELASDSIIWFIKCWLRLPETRGENYYSCVLSRGDARGRMRRIDGGKGSDKVWRLDTIVSMLYHGMPMSSTDTNIIV---HTCDQELCVRPQHL 887
            FI ALL   + +A  WF      R+  +K  KR   +S  +  +    +L +  E+  +  + ++  L K + +E   D ++             G+    CVLS  D +G++RRID  + +DKVWRLD ++ +L+ G+P+ STD   +V   H  +  LCV+P H+
Sbjct:   12 FIEALLPHVRAIAYTWFNLQARKRKYFKKHEKR---MSKDEERAVKDELLSEKPEVKQKWASRLLAKLRKDIRQEYREDFVL----------SVTGKKPPCCVLSNPDQKGKIRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLVKSPHCTNPALCVQPHHI 165          
BLAST of CTF/NF-I domain-containing protein vs. Planmine SMEST
Match: SMESG000028598.1 (SMESG000028598.1)

HSP 1 Score: 2260.72 bits (5857), Expect = 0.000e+0
Identity = 1214/1214 (100.00%), Postives = 1214/1214 (100.00%), Query Frame = 3
Query:   99 MDDFMHIDKRVKLEVDVSNDSSHDALHVDVNSSNSDIDPIHYHDNDFLSQKYLMSDNKEYVLTDSTNGHYNGVXXXXXXXXXXXXXXXXXXXXXXXEALFIHALLSRCKRLAPLWFKGALSMREKNRKEHKRGYTVSGVQTSSSWSAVLDKITEMSCRAETEMVMNLLKKLYKELASDSIIWFIKCWLRLPETRGENYYSCVLSRGDARGRMRRIDGGKGSDKVWRLDTIVSMLYHGMPMSSTDTNIIVHTCDQELCVRPQHLRFRXXXXXXXXXXXXXQQGGYQLIPPKKITKDKDNEKPESADTENGQQPXXXXXXXXXXXXXXXQNQDEVENSVEISGPFNIEQIQQYLIQDLKPCVQSLEKMVLSATDRSILCANPDLDNINNITAISSTYDSPRTIVNDNSLQYKAFHFEKSNNSRPMKRLNNHLASDCKSPNSIKRGRLLDRKNGSKSPPLLMTDITPVTSGYLKNASVPIPTMNTKSNSNNINPHLNGCNLNGINRSDPHSITNSFPNFYXXXXXXXXXXXXXXXXXLCSPNPNPRYMYQNLGNHKSNPFHHNLHHPFIPGTGSHTFPPLFXXXXXXXXXXXXXKHHHRFSPLSSPRHGSLDHLPLSLTPTKNNRHGHNSNIIHPVSVPYYPSSQTPSIFPFRHNPFESMPPLGFSRFQSPKKPHFNNIHRPIPEPATTCPMPKLSSSNIQPNFEEDTPLIEENLPNETFSKRSNEMEKNPSPIEEDSVNAXXXXXXXXXXXXXXXXXXXXXXXPSQTPRKPAKKRLEARTPTFDKNDESQGDSSLDFSASTGSAFRLVHKSKSISTTGNLDNATLSNITDSIKVELGTDDTELSNILTERSKVDKVLSKKVNELSGQLLLQKHQRDKANENKCSGSAALLHPRNSDSAQSGHNKEQSSHSCVCLGNEDDCPSANGYPGNCCSSAASRTSVKSYSASAPDGEMFVPFNFVFSGVSRSTPNNQTTPSEPKSCENDSVNGVCARFMGSLNQERLNSGQAHMLLNAIRNSPISANCTELLDLLSSMVQQYGIASGSNINNSVDHGSSEQTRSESRILAHIYQRLYKTSPSDRPANQLLQKNYSFSPLSTEVDLNYLRAAAVAHHNGSFNKNKSRLSTRFSDHHHIKTHLPTSRSDSCASFDTNHLDSINGNRSRYHSSDNPPTTESTQPVTVSTISATPPDNGPVSSCSAFSVTDTHFDSDNSQKKFNMV 3740
            MDDFMHIDKRVKLEVDVSNDSSHDALHVDVNSSNSDIDPIHYHDNDFLSQKYLMSDNKEYVLTDSTNGHYNGVNSFASKFNSYNNNNNNNSNPKPSEALFIHALLSRCKRLAPLWFKGALSMREKNRKEHKRGYTVSGVQTSSSWSAVLDKITEMSCRAETEMVMNLLKKLYKELASDSIIWFIKCWLRLPETRGENYYSCVLSRGDARGRMRRIDGGKGSDKVWRLDTIVSMLYHGMPMSSTDTNIIVHTCDQELCVRPQHLRFRASAVALAVVLKALQQGGYQLIPPKKITKDKDNEKPESADTENGQQPNSNRSGSASSVISGSQNQDEVENSVEISGPFNIEQIQQYLIQDLKPCVQSLEKMVLSATDRSILCANPDLDNINNITAISSTYDSPRTIVNDNSLQYKAFHFEKSNNSRPMKRLNNHLASDCKSPNSIKRGRLLDRKNGSKSPPLLMTDITPVTSGYLKNASVPIPTMNTKSNSNNINPHLNGCNLNGINRSDPHSITNSFPNFYHNHAPNHNPSNHHPSMNLCSPNPNPRYMYQNLGNHKSNPFHHNLHHPFIPGTGSHTFPPLFPSSSNIPDPSNSIKHHHRFSPLSSPRHGSLDHLPLSLTPTKNNRHGHNSNIIHPVSVPYYPSSQTPSIFPFRHNPFESMPPLGFSRFQSPKKPHFNNIHRPIPEPATTCPMPKLSSSNIQPNFEEDTPLIEENLPNETFSKRSNEMEKNPSPIEEDSVNASSSIPENSNTSTTTTSRKSNNVTPSQTPRKPAKKRLEARTPTFDKNDESQGDSSLDFSASTGSAFRLVHKSKSISTTGNLDNATLSNITDSIKVELGTDDTELSNILTERSKVDKVLSKKVNELSGQLLLQKHQRDKANENKCSGSAALLHPRNSDSAQSGHNKEQSSHSCVCLGNEDDCPSANGYPGNCCSSAASRTSVKSYSASAPDGEMFVPFNFVFSGVSRSTPNNQTTPSEPKSCENDSVNGVCARFMGSLNQERLNSGQAHMLLNAIRNSPISANCTELLDLLSSMVQQYGIASGSNINNSVDHGSSEQTRSESRILAHIYQRLYKTSPSDRPANQLLQKNYSFSPLSTEVDLNYLRAAAVAHHNGSFNKNKSRLSTRFSDHHHIKTHLPTSRSDSCASFDTNHLDSINGNRSRYHSSDNPPTTESTQPVTVSTISATPPDNGPVSSCSAFSVTDTHFDSDNSQKKFNMV
Sbjct:    1 MDDFMHIDKRVKLEVDVSNDSSHDALHVDVNSSNSDIDPIHYHDNDFLSQKYLMSDNKEYVLTDSTNGHYNGVNSFASKFNSYNNNNNNNSNPKPSEALFIHALLSRCKRLAPLWFKGALSMREKNRKEHKRGYTVSGVQTSSSWSAVLDKITEMSCRAETEMVMNLLKKLYKELASDSIIWFIKCWLRLPETRGENYYSCVLSRGDARGRMRRIDGGKGSDKVWRLDTIVSMLYHGMPMSSTDTNIIVHTCDQELCVRPQHLRFRASAVALAVVLKALQQGGYQLIPPKKITKDKDNEKPESADTENGQQPNSNRSGSASSVISGSQNQDEVENSVEISGPFNIEQIQQYLIQDLKPCVQSLEKMVLSATDRSILCANPDLDNINNITAISSTYDSPRTIVNDNSLQYKAFHFEKSNNSRPMKRLNNHLASDCKSPNSIKRGRLLDRKNGSKSPPLLMTDITPVTSGYLKNASVPIPTMNTKSNSNNINPHLNGCNLNGINRSDPHSITNSFPNFYHNHAPNHNPSNHHPSMNLCSPNPNPRYMYQNLGNHKSNPFHHNLHHPFIPGTGSHTFPPLFPSSSNIPDPSNSIKHHHRFSPLSSPRHGSLDHLPLSLTPTKNNRHGHNSNIIHPVSVPYYPSSQTPSIFPFRHNPFESMPPLGFSRFQSPKKPHFNNIHRPIPEPATTCPMPKLSSSNIQPNFEEDTPLIEENLPNETFSKRSNEMEKNPSPIEEDSVNASSSIPENSNTSTTTTSRKSNNVTPSQTPRKPAKKRLEARTPTFDKNDESQGDSSLDFSASTGSAFRLVHKSKSISTTGNLDNATLSNITDSIKVELGTDDTELSNILTERSKVDKVLSKKVNELSGQLLLQKHQRDKANENKCSGSAALLHPRNSDSAQSGHNKEQSSHSCVCLGNEDDCPSANGYPGNCCSSAASRTSVKSYSASAPDGEMFVPFNFVFSGVSRSTPNNQTTPSEPKSCENDSVNGVCARFMGSLNQERLNSGQAHMLLNAIRNSPISANCTELLDLLSSMVQQYGIASGSNINNSVDHGSSEQTRSESRILAHIYQRLYKTSPSDRPANQLLQKNYSFSPLSTEVDLNYLRAAAVAHHNGSFNKNKSRLSTRFSDHHHIKTHLPTSRSDSCASFDTNHLDSINGNRSRYHSSDNPPTTESTQPVTVSTISATPPDNGPVSSCSAFSVTDTHFDSDNSQKKFNMV 1214          
BLAST of CTF/NF-I domain-containing protein vs. Planmine SMEST
Match: SMESG000029310.1 (SMESG000029310.1)

HSP 1 Score: 311.612 bits (797), Expect = 7.066e-90
Identity = 159/288 (55.21%), Postives = 199/288 (69.10%), Query Frame = 3
Query:  387 EALFIHALLSRCKRLAPLWFKGALSMREKNRKEHKRGYTVSGVQTSSSWSAVLDKITEMSCRAETEMVMNLLKKLYKELASDSIIWFIKCWLRLPETRGENYYSCVLSRGDARGRMRRIDGGKGSDKVWRLDTIVSMLYHGMPMSSTDTNIIVHTCDQELCVRPQHLRFRXXXXXXXXXXXXXQQGGYQLIPPKKITKDKDNEKPESADTENGQQPXXXXXXXXXXXXXXXQNQDEVENSVEISGPFNIEQIQQYLIQDLKPCVQSLEKMVLSATDRSILCANPDLDN 1250
            EALF+  LL  CKRLAPLWFKG  SMR+K+R+EH+R    +  Q  + W  + + I +M+  +ETE V+NLLKKLYKEL +D+++WFIKCWL+ PET  EN   C LSRGDARGRMRRIDGGKGSDKVWRLDTIV M++HGMPMSSTDTNI+VHTCDQELC+RPQHLRF+AS+VAL VVLKALQQ GY +IPP   T    + +   +D                               V++SGPF IEQ+QQY +++L+PC QS+ K+  S+TD ++L   P L N
Sbjct:  106 EALFVRCLLPHCKRLAPLWFKGVSSMRDKSREEHRRISASTTCQNQNDWERISNLINDMTAASETETVVNLLKKLYKELPADTVLWFIKCWLKFPET-TENEEKCALSRGDARGRMRRIDGGKGSDKVWRLDTIVGMMFHGMPMSSTDTNIMVHTCDQELCIRPQHLRFKASSVALVVVLKALQQTGYSIIPPPDETYSNGDIRSSPSD-----------------------------EFVDVSGPFKIEQLQQYRLEELRPCEQSMGKLNSSSTDINLLDTYPLLKN 363          

HSP 2 Score: 80.8777 bits (198), Expect = 4.869e-15
Identity = 110/382 (28.80%), Postives = 167/382 (43.72%), Query Frame = 3
Query: 2391 TPRKPAKKRLEARTPTFDKNDE--------SQGDSSLDFSASTGSAFRLVHKSKSIST-------------TGNLDNATLSNITDSIKVELGTDDTELSNILTERSKVDKVLSKKVNELSGQLLLQKHQRDKANENKCSGSAALLHPRNSDSAQSGHNKEQSSHSCVCLGNEDDCPSANGYPGNCCSSAASRTSVKSYSASAPDGEMFVPFNFVFSGVSRSTPNNQTTPSEPKSCENDSVNGVCARFMGSLNQE---RLNSGQAHMLLNAIRNSPISANCTELLDLLSSMVQQYGIASGSNINNSVDHGSSEQT-RSESRIL-AHIYQRLYKTSPSDRPANQLLQKNYSFSPLSTEV---DLNYLRAAAV----AHHNGSFN 3437
            TPR+PAKKRLEARTPTF  +D+        S  D  L  S++  SAFR+V K   +++                LD    SNI D+   E          +L   + V+++      + S   L +  Q  K    K S    L  P   D      +++    S                PG+    + + TS  + +  +P          +F G  + TP N   P+ P +C N++     +RF  S +     R    QA ++LNA+RNSP+  +  E++D+L SM+QQYGI    N     D  + E T R +S +L  HIY +L K SP      QL  +N SF+P+S E+   D   ++++      +HH  +FN
Sbjct:  525 TPRQPAKKRLEARTPTFLSDDQLDTFSSMSSPIDHKLSSSSNNISAFRVVQKKSLMNSDIKQESKTREEPIEMELDTIFPSNINDTKDDEFQYGSCRREGLLLSEANVNEIKDPGNGKTSELGLSRGSQIYK----KMSDIDPLTTPSPLDYLLMAISRQTPGFST---------------PGDQMPVSGTTTSDTNLNIGSP----------IFCG--QKTPLN---PNFPDNCFNNA-----SRFSLSTSSTVSCRFTPEQASVMLNALRNSPLGNSNPEIIDMLYSMMQQYGINHPCN----SDGANCEHTYRPDSVVLRKHIYNQLSKASP------QL--ENLSFTPISNEMSNDDSLTIKSSPCQTPHSHHKVTFN 855          
BLAST of CTF/NF-I domain-containing protein vs. Planmine SMEST
Match: SMESG000029310.1 (SMESG000029310.1)

HSP 1 Score: 311.612 bits (797), Expect = 9.591e-90
Identity = 159/288 (55.21%), Postives = 199/288 (69.10%), Query Frame = 3
Query:  387 EALFIHALLSRCKRLAPLWFKGALSMREKNRKEHKRGYTVSGVQTSSSWSAVLDKITEMSCRAETEMVMNLLKKLYKELASDSIIWFIKCWLRLPETRGENYYSCVLSRGDARGRMRRIDGGKGSDKVWRLDTIVSMLYHGMPMSSTDTNIIVHTCDQELCVRPQHLRFRXXXXXXXXXXXXXQQGGYQLIPPKKITKDKDNEKPESADTENGQQPXXXXXXXXXXXXXXXQNQDEVENSVEISGPFNIEQIQQYLIQDLKPCVQSLEKMVLSATDRSILCANPDLDN 1250
            EALF+  LL  CKRLAPLWFKG  SMR+K+R+EH+R    +  Q  + W  + + I +M+  +ETE V+NLLKKLYKEL +D+++WFIKCWL+ PET  EN   C LSRGDARGRMRRIDGGKGSDKVWRLDTIV M++HGMPMSSTDTNI+VHTCDQELC+RPQHLRF+AS+VAL VVLKALQQ GY +IPP   T    + +   +D                               V++SGPF IEQ+QQY +++L+PC QS+ K+  S+TD ++L   P L N
Sbjct:  130 EALFVRCLLPHCKRLAPLWFKGVSSMRDKSREEHRRISASTTCQNQNDWERISNLINDMTAASETETVVNLLKKLYKELPADTVLWFIKCWLKFPET-TENEEKCALSRGDARGRMRRIDGGKGSDKVWRLDTIVGMMFHGMPMSSTDTNIMVHTCDQELCIRPQHLRFKASSVALVVVLKALQQTGYSIIPPPDETYSNGDIRSSPSD-----------------------------EFVDVSGPFKIEQLQQYRLEELRPCEQSMGKLNSSSTDINLLDTYPLLKN 387          

HSP 2 Score: 80.8777 bits (198), Expect = 5.348e-15
Identity = 110/382 (28.80%), Postives = 167/382 (43.72%), Query Frame = 3
Query: 2391 TPRKPAKKRLEARTPTFDKNDE--------SQGDSSLDFSASTGSAFRLVHKSKSIST-------------TGNLDNATLSNITDSIKVELGTDDTELSNILTERSKVDKVLSKKVNELSGQLLLQKHQRDKANENKCSGSAALLHPRNSDSAQSGHNKEQSSHSCVCLGNEDDCPSANGYPGNCCSSAASRTSVKSYSASAPDGEMFVPFNFVFSGVSRSTPNNQTTPSEPKSCENDSVNGVCARFMGSLNQE---RLNSGQAHMLLNAIRNSPISANCTELLDLLSSMVQQYGIASGSNINNSVDHGSSEQT-RSESRIL-AHIYQRLYKTSPSDRPANQLLQKNYSFSPLSTEV---DLNYLRAAAV----AHHNGSFN 3437
            TPR+PAKKRLEARTPTF  +D+        S  D  L  S++  SAFR+V K   +++                LD    SNI D+   E          +L   + V+++      + S   L +  Q  K    K S    L  P   D      +++    S                PG+    + + TS  + +  +P          +F G  + TP N   P+ P +C N++     +RF  S +     R    QA ++LNA+RNSP+  +  E++D+L SM+QQYGI    N     D  + E T R +S +L  HIY +L K SP      QL  +N SF+P+S E+   D   ++++      +HH  +FN
Sbjct:  549 TPRQPAKKRLEARTPTFLSDDQLDTFSSMSSPIDHKLSSSSNNISAFRVVQKKSLMNSDIKQESKTREEPIEMELDTIFPSNINDTKDDEFQYGSCRREGLLLSEANVNEIKDPGNGKTSELGLSRGSQIYK----KMSDIDPLTTPSPLDYLLMAISRQTPGFST---------------PGDQMPVSGTTTSDTNLNIGSP----------IFCG--QKTPLN---PNFPDNCFNNA-----SRFSLSTSSTVSCRFTPEQASVMLNALRNSPLGNSNPEIIDMLYSMMQQYGINHPCN----SDGANCEHTYRPDSVVLRKHIYNQLSKASP------QL--ENLSFTPISNEMSNDDSLTIKSSPCQTPHSHHKVTFN 879          
BLAST of CTF/NF-I domain-containing protein vs. Planmine SMEST
Match: SMESG000010567.1 (SMESG000010567.1)

HSP 1 Score: 184.111 bits (466), Expect = 2.626e-52
Identity = 92/193 (47.67%), Postives = 137/193 (70.98%), Query Frame = 3
Query:  387 EALFIHALLSRCKRLAPLWFKGALSMREKNRKEHKRGYTVSGVQTSSSWSAVLDKITEMSCRA---ETEMVMNLLKKLYKELASDSIIWFIKCWLRLPETRGENYYSCVLSRGDARGRMRRIDGGKGSDKVWRLDTIVSMLYHGMPMSSTDTNIIVHTCDQELCVRPQHLRFRXXXXXXXXXXXXXQQGGYQL 956
            E+LF+ ++L  CKR+ PLW K   ++R+K R+        +  QT    + +  K    S +    E  +V+NLL+KLY+E+   S++  IKCWL  PE + ++  SC+L++GD RGRM+RIDGGKG+DKVWRLDT++ +LYHG+P++S D+N+I HTC ++LC+RPQHLRFRA++V+L +VLKAL+Q GY +
Sbjct:    8 ESLFVRSILPHCKRIGPLWLKNITNIRQKFRE--------NSHQTCEKSNEIFLKFDSNSVKQLNEEIHIVVNLLRKLYREIQPQSVMNIIKCWLNFPEMKSDD--SCILTKGDCRGRMKRIDGGKGADKVWRLDTLIGILYHGLPLTSADSNMIYHTCQRDLCIRPQHLRFRAASVSLVLVLKALEQTGYSI 190          
BLAST of CTF/NF-I domain-containing protein vs. Planmine SMEST
Match: SMESG000010567.1 (SMESG000010567.1)

HSP 1 Score: 190.274 bits (482), Expect = 1.707e-51
Identity = 112/289 (38.75%), Postives = 168/289 (58.13%), Query Frame = 3
Query:  387 EALFIHALLSRCKRLAPLWFKGALSMREKNRKEHKRGYTVSGVQTSSSWSAVLDKITEMSCR---AETEMVMNLLKKLYKELASDSIIWFIKCWLRLPETRGENYYSCVLSRGDARGRMRRIDGGKGSDKVWRLDTIVSMLYHGMPMSSTDTNIIVHTCDQELCVRPQHLRFRXXXXXXXXXXXXXQQGGYQLIPPKKITKDKDNEKPESADTENGQQPXXXXXXXXXXXXXXXQNQDEVENSVEISGPFNIEQIQQYLIQDLKPCVQSLEKMVLSATDRSILCANPDL 1244
            E+LF+ ++L  CKR+ PLW K   ++R+K R+        +  QT    + +  K    S +    E  +V+NLL+KLY+E+   S++  IKCWL  PE + ++  SC+L++GD RGRM+RIDGGKG+DKVWRLDT++ +LYHG+P++S D+N+I HTC ++LC+RPQHLRFRA++V+L +VLKAL+Q GY +    KI    D                                 DE    V+I+GPF I +++    + ++    +  K+  S+ D  IL  NPDL
Sbjct:    8 ESLFVRSILPHCKRIGPLWLKNITNIRQKFRE--------NSHQTCEKSNEIFLKFDSNSVKQLNEEIHIVVNLLRKLYREIQPQSVMNIIKCWLNFPEMKSDD--SCILTKGDCRGRMKRIDGGKGADKVWRLDTLIGILYHGLPLTSADSNMIYHTCQRDLCIRPQHLRFRAASVSLVLVLKALEQTGYSI----KINDSHDKHL-----------------------------NDEF---VDIAGPFGILELETLRHELVQVTQLNSHKLACSSDDIYILDQNPDL 250          
The following BLAST results are available for this feature:
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NFIC9.123e-1726.35nuclear factor I C [Source:HGNC Symbol;Acc:HGNC:77... [more]
NFIC1.064e-1626.35nuclear factor I C [Source:HGNC Symbol;Acc:HGNC:77... [more]
NFIC1.079e-1625.99nuclear factor I C [Source:HGNC Symbol;Acc:HGNC:77... [more]
NFIC1.535e-1626.35nuclear factor I C [Source:HGNC Symbol;Acc:HGNC:77... [more]
NFIC1.659e-1626.35nuclear factor I C [Source:HGNC Symbol;Acc:HGNC:77... [more]
back to top
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
nfi-12.163e-1135.35NFI (Nuclear Factor I) family [Source:UniProtKB/T... [more]
nfi-12.196e-1135.35NFI (Nuclear Factor I) family [Source:UniProtKB/T... [more]
nfi-12.524e-1135.35NFI (Nuclear Factor I) family [Source:UniProtKB/T... [more]
back to top
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
NfI2.276e-1229.34gene:FBgn0042696 transcript:FBtr0333678[more]
NfI2.283e-1229.34gene:FBgn0042696 transcript:FBtr0089141[more]
back to top
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nfia3.266e-1529.94nuclear factor I/A [Source:ZFIN;Acc:ZDB-GENE-05020... [more]
nfic7.236e-1531.74nuclear factor I/C [Source:ZFIN;Acc:ZDB-GENE-08030... [more]
nfia7.850e-1529.94nuclear factor I/A [Source:ZFIN;Acc:ZDB-GENE-05020... [more]
nfic8.776e-1531.74nuclear factor I/C [Source:ZFIN;Acc:ZDB-GENE-08030... [more]
nfia1.005e-1429.94nuclear factor I/A [Source:ZFIN;Acc:ZDB-GENE-05020... [more]
back to top
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kif2c1.078e-1725.99kinesin family member 2C [Source:Xenbase;Acc:XB-GE... [more]
kif2c1.736e-1725.99kinesin family member 2C [Source:Xenbase;Acc:XB-GE... [more]
kif2c2.148e-1725.99kinesin family member 2C [Source:Xenbase;Acc:XB-GE... [more]
nfib7.541e-1629.94nuclear factor I B [Source:NCBI gene;Acc:100036601... [more]
nfib1.204e-1529.94nuclear factor I B [Source:NCBI gene;Acc:100036601... [more]
back to top
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nfic1.302e-1725.99nuclear factor I/C [Source:MGI Symbol;Acc:MGI:1095... [more]
Nfic1.328e-1725.99nuclear factor I/C [Source:MGI Symbol;Acc:MGI:1095... [more]
Nfic1.712e-1725.99nuclear factor I/C [Source:MGI Symbol;Acc:MGI:1095... [more]
Nfic1.780e-1725.99nuclear factor I/C [Source:MGI Symbol;Acc:MGI:1095... [more]
Nfic4.390e-1725.99nuclear factor I/C [Source:MGI Symbol;Acc:MGI:1095... [more]
back to top
BLAST of CTF/NF-I domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P70255|NFIC_MOUSE1.245e-1625.99Nuclear factor 1 C-type OS=Mus musculus OX=10090 G... [more]
sp|P17926|NFIC_CHICK1.781e-1625.63Nuclear factor 1 C-type OS=Gallus gallus OX=9031 G... [more]
sp|P21999|NFIC_PIG7.423e-1625.63Nuclear factor 1 C-type OS=Sus scrofa OX=9823 GN=N... [more]
sp|P08651|NFIC_HUMAN7.967e-1626.35Nuclear factor 1 C-type OS=Homo sapiens OX=9606 GN... [more]
sp|Q0VCL6|NFIB_BOVIN7.289e-1529.34Nuclear factor 1 B-type OS=Bos taurus OX=9913 GN=N... [more]
back to top
BLAST of CTF/NF-I domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G7YHM31.090e-7653.82Nuclear factor 1 A-type OS=Clonorchis sinensis OX=... [more]
G4LYE73.013e-7355.71CTF/NF-I domain-containing protein OS=Schistosoma ... [more]
A0A095AVC44.186e-7355.71Nuclear factor 1 C-type OS=Schistosoma haematobium... [more]
A0A3Q0KQ325.285e-7355.71CTF/NF-I domain-containing protein OS=Schistosoma ... [more]
A0A4V3SD976.020e-7353.82CTF/NF-I domain-containing protein OS=Opisthorchis... [more]
back to top
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000055156.12.700e-1730.54nuclear factor 1 B-type-like [Source:NCBI gene;Acc... [more]
nfia6.458e-1531.14nuclear factor I A [Source:NCBI gene;Acc:103027676... [more]
nfia8.234e-1531.14nuclear factor I A [Source:NCBI gene;Acc:103027676... [more]
nfia1.156e-1429.94nuclear factor I A [Source:NCBI gene;Acc:103027676... [more]
nfia1.185e-1429.94nuclear factor I A [Source:NCBI gene;Acc:103027676... [more]
back to top
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
nfia1.125e-1629.94nuclear factor I/A [Source:ZFIN;Acc:ZDB-GENE-05020... [more]
back to top
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO453946.084e-1228.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of CTF/NF-I domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nfia1.948e-1529.94nuclear factor I A [Source:NCBI gene;Acc:101158842... [more]
NFIB2.947e-1529.94nuclear factor I B [Source:NCBI gene;Acc:101169147... [more]
NFIB2.947e-1529.94nuclear factor I B [Source:NCBI gene;Acc:101169147... [more]
NFIB3.077e-1529.94nuclear factor I B [Source:NCBI gene;Acc:101169147... [more]
NFIB3.197e-1529.94nuclear factor I B [Source:NCBI gene;Acc:101169147... [more]
back to top
BLAST of CTF/NF-I domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000028598.10.000e+0100.00SMESG000028598.1[more]
SMESG000029310.17.066e-9055.21SMESG000029310.1[more]
SMESG000029310.19.591e-9055.21SMESG000029310.1[more]
SMESG000010567.12.626e-5247.67SMESG000010567.1[more]
SMESG000010567.11.707e-5138.75SMESG000010567.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011875 ID=SMED30011875|Name=CTF/NF-I domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=3911bp
GTTTTGTAGCACGTATTTTAATTTAAAATTAGTCTAACAAGTGATAAGTA
AATCTCACATTAGCTAATTTAATGTTATAATACTAATTGGAAAAGCTAAT
GGATGATTTTATGCATATCGATAAGCGAGTTAAATTAGAAGTAGACGTTT
CGAATGATTCATCTCACGACGCCCTTCACGTCGATGTGAATAGCAGCAAC
AGTGACATAGATCCAATTCATTATCATGACAATGATTTTTTGTCACAGAA
ATATTTGATGAGTGACAACAAGGAATATGTTCTAACAGATTCGACAAACG
GACATTACAACGGAGTTAATTCTTTTGCCAGTAAATTCAACTCGTATAAC
AATAATAATAACAACAACTCCAATCCGAAACCCAGTGAAGCGCTTTTCAT
TCATGCTCTCTTGTCGCGATGCAAACGTTTAGCACCTTTGTGGTTCAAAG
GAGCCCTGTCAATGCGTGAGAAAAACCGCAAAGAACACAAACGTGGATAT
ACAGTTTCAGGTGTTCAAACTTCATCAAGCTGGAGTGCAGTTCTTGATAA
AATAACGGAAATGTCTTGTAGAGCTGAAACTGAAATGGTGATGAATCTTT
TGAAGAAGTTGTACAAAGAATTGGCTTCCGATTCAATAATTTGGTTCATA
AAATGTTGGTTGAGACTTCCCGAAACTCGAGGGGAAAATTATTACAGTTG
TGTCCTAAGTCGAGGAGATGCCAGAGGTCGCATGCGGAGAATTGACGGAG
GGAAAGGTTCAGACAAGGTCTGGAGATTGGACACAATAGTTAGCATGCTA
TATCATGGAATGCCAATGTCCAGTACTGATACAAACATCATCGTTCATAC
TTGTGATCAAGAACTTTGCGTCCGACCTCAACATTTAAGATTTCGAGCAA
GTGCTGTTGCTTTAGCAGTGGTGTTAAAAGCTCTTCAACAAGGTGGATAT
CAGTTAATTCCACCGAAAAAAATTACCAAAGATAAAGACAATGAAAAACC
AGAATCTGCTGATACTGAAAATGGACAGCAACCAAACAGTAACAGATCCG
GTTCAGCGAGTTCAGTAATAAGTGGATCACAAAATCAAGACGAAGTTGAA
AATTCTGTTGAAATTTCTGGGCCATTCAATATTGAACAAATTCAACAGTA
TTTAATACAAGATTTAAAACCTTGTGTTCAATCACTCGAAAAAATGGTGC
TGAGTGCTACAGATCGATCAATACTTTGCGCAAATCCGGATCTTGATAAC
ATTAACAATATTACAGCAATATCATCAACTTATGACTCGCCTAGGACAAT
TGTAAATGATAACTCTTTACAATACAAAGCGTTCCATTTCGAAAAATCAA
ACAACTCTAGGCCAATGAAGAGACTGAACAATCATTTAGCCAGTGATTGT
AAATCTCCGAATTCCATCAAACGCGGCAGGTTATTGGATAGGAAAAACGG
AAGCAAAAGTCCTCCACTTCTTATGACAGACATTACTCCTGTGACTAGTG
GATACTTAAAAAATGCATCTGTCCCAATTCCAACAATGAATACAAAATCC
AATTCTAACAATATAAATCCTCATTTAAATGGTTGTAATCTCAATGGCAT
TAACAGATCTGATCCCCATTCAATAACCAATTCGTTTCCAAATTTTTATC
ATAATCATGCGCCAAATCATAATCCTTCAAATCATCATCCTTCAATGAAT
CTTTGTTCACCCAATCCCAATCCTAGGTATATGTATCAAAATCTTGGAAA
TCACAAATCAAATCCATTCCATCACAATCTTCATCATCCTTTTATTCCTG
GAACTGGATCCCATACTTTTCCACCTCTATTTCCATCCTCATCCAATATC
CCTGATCCCAGTAACTCAATAAAACACCATCATAGATTTTCACCCCTTTC
ATCTCCCCGACATGGATCACTGGATCATCTACCTTTATCATTAACGCCAA
CAAAAAATAATCGCCATGGTCATAACTCTAATATTATCCACCCAGTTTCC
GTGCCATACTATCCATCGTCTCAAACTCCATCGATCTTTCCGTTTCGTCA
CAACCCCTTCGAATCCATGCCTCCACTTGGGTTTTCTCGTTTTCAATCGC
CTAAGAAGCCACATTTCAACAATATCCATCGTCCAATTCCAGAACCAGCT
ACAACATGCCCAATGCCAAAACTGAGCAGTTCCAATATTCAACCGAACTT
TGAAGAAGATACTCCGCTGATTGAAGAAAACTTACCAAATGAAACCTTCA
GTAAAAGATCTAATGAAATGGAAAAAAATCCATCGCCTATTGAGGAAGAC
AGTGTAAACGCTTCCTCTTCAATACCGGAAAATAGCAACACTAGTACTAC
AACAACTTCAAGAAAAAGCAACAATGTCACCCCATCACAGACCCCTAGAA
AACCAGCTAAGAAACGATTAGAAGCTCGAACACCGACATTTGACAAAAAC
GATGAAAGTCAAGGTGACTCGTCTTTGGATTTTTCGGCATCAACTGGATC
TGCATTTAGACTCGTTCATAAAAGTAAATCGATCAGCACAACTGGCAATC
TAGACAATGCGACGCTAAGTAACATAACTGACAGTATTAAAGTTGAATTG
GGCACAGATGATACGGAATTATCAAACATCTTAACCGAGAGATCAAAAGT
TGATAAAGTTTTATCGAAAAAAGTCAACGAATTATCCGGACAATTATTAT
TGCAAAAGCATCAAAGAGATAAGGCTAATGAAAACAAATGTTCCGGTTCG
GCAGCATTGTTACATCCCCGAAATTCAGATAGCGCTCAGTCAGGTCATAA
TAAAGAGCAGTCTTCTCATTCTTGTGTTTGCTTGGGTAACGAAGACGACT
GTCCTAGTGCGAATGGATATCCTGGAAATTGTTGCTCATCAGCAGCTTCA
AGAACATCTGTAAAATCATACTCAGCATCTGCTCCAGACGGAGAAATGTT
TGTTCCGTTTAATTTTGTTTTTAGTGGAGTTTCAAGATCCACTCCGAATA
ATCAGACAACTCCCTCCGAACCGAAATCCTGTGAAAATGACAGTGTAAAT
GGTGTATGTGCTCGGTTTATGGGCAGCTTAAATCAAGAGAGATTAAATTC
TGGTCAAGCTCATATGCTTTTAAATGCAATTCGAAACTCCCCTATTTCAG
CTAATTGTACGGAGTTGCTGGATTTATTAAGCAGCATGGTTCAACAATAC
GGAATTGCATCTGGATCAAATATCAACAATTCTGTTGATCATGGTTCATC
TGAGCAAACAAGATCGGAAAGTCGAATTCTTGCTCATATCTACCAAAGAT
TATATAAGACTTCACCATCAGATAGGCCAGCTAATCAATTACTGCAAAAA
AATTACAGTTTTAGTCCTTTATCAACAGAAGTTGATCTGAACTATCTTCG
TGCTGCAGCGGTAGCACATCATAATGGCTCATTCAATAAAAATAAATCTC
GACTGAGCACCCGGTTCAGTGATCATCACCACATAAAAACCCATTTGCCG
ACATCAAGAAGCGACAGTTGTGCTTCATTCGACACAAATCACTTAGATTC
AATAAACGGCAATCGGTCTCGCTATCATTCCAGTGACAATCCGCCAACAA
CGGAAAGCACGCAACCGGTGACAGTGTCAACAATATCGGCGACCCCCCCG
GACAATGGGCCGGTGTCGAGTTGTTCTGCATTTTCTGTTACCGATACTCA
TTTTGATTCTGATAATTCACAAAAGAAATTCAACATGGTTTAGCTGATCG
AGATCATTTTCATTATTAAAATCAATAGAAAATAATATATAAAAATAAAG
GTACTTGAAAACATTCCACAACAAAAAGTCGCCTAGAAAACAATGATGTA
AATAAATGACACATTTTCTCTTTTCTATTTAAATTATTATCTCTCTCACA
AATGAAAGAAA
back to top

protein sequence of SMED30011875-orf-1

>SMED30011875-orf-1 ID=SMED30011875-orf-1|Name=SMED30011875-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1215bp
MDDFMHIDKRVKLEVDVSNDSSHDALHVDVNSSNSDIDPIHYHDNDFLSQ
KYLMSDNKEYVLTDSTNGHYNGVNSFASKFNSYNNNNNNNSNPKPSEALF
IHALLSRCKRLAPLWFKGALSMREKNRKEHKRGYTVSGVQTSSSWSAVLD
KITEMSCRAETEMVMNLLKKLYKELASDSIIWFIKCWLRLPETRGENYYS
CVLSRGDARGRMRRIDGGKGSDKVWRLDTIVSMLYHGMPMSSTDTNIIVH
TCDQELCVRPQHLRFRASAVALAVVLKALQQGGYQLIPPKKITKDKDNEK
PESADTENGQQPNSNRSGSASSVISGSQNQDEVENSVEISGPFNIEQIQQ
YLIQDLKPCVQSLEKMVLSATDRSILCANPDLDNINNITAISSTYDSPRT
IVNDNSLQYKAFHFEKSNNSRPMKRLNNHLASDCKSPNSIKRGRLLDRKN
GSKSPPLLMTDITPVTSGYLKNASVPIPTMNTKSNSNNINPHLNGCNLNG
INRSDPHSITNSFPNFYHNHAPNHNPSNHHPSMNLCSPNPNPRYMYQNLG
NHKSNPFHHNLHHPFIPGTGSHTFPPLFPSSSNIPDPSNSIKHHHRFSPL
SSPRHGSLDHLPLSLTPTKNNRHGHNSNIIHPVSVPYYPSSQTPSIFPFR
HNPFESMPPLGFSRFQSPKKPHFNNIHRPIPEPATTCPMPKLSSSNIQPN
FEEDTPLIEENLPNETFSKRSNEMEKNPSPIEEDSVNASSSIPENSNTST
TTTSRKSNNVTPSQTPRKPAKKRLEARTPTFDKNDESQGDSSLDFSASTG
SAFRLVHKSKSISTTGNLDNATLSNITDSIKVELGTDDTELSNILTERSK
VDKVLSKKVNELSGQLLLQKHQRDKANENKCSGSAALLHPRNSDSAQSGH
NKEQSSHSCVCLGNEDDCPSANGYPGNCCSSAASRTSVKSYSASAPDGEM
FVPFNFVFSGVSRSTPNNQTTPSEPKSCENDSVNGVCARFMGSLNQERLN
SGQAHMLLNAIRNSPISANCTELLDLLSSMVQQYGIASGSNINNSVDHGS
SEQTRSESRILAHIYQRLYKTSPSDRPANQLLQKNYSFSPLSTEVDLNYL
RAAAVAHHNGSFNKNKSRLSTRFSDHHHIKTHLPTSRSDSCASFDTNHLD
SINGNRSRYHSSDNPPTTESTQPVTVSTISATPPDNGPVSSCSAFSVTDT
HFDSDNSQKKFNMV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000647CTF/NFI
IPR020604CTF/NFI_DNA-bd-dom
Vocabulary: biological process
TermDefinition
GO:0006260DNA replication
GO:0006355regulation of transcription, DNA-templated
GO:0006351transcription, DNA-templated
Vocabulary: molecular function
TermDefinition
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0003677DNA binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 732..766
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1152..1175
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 705..793
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 305..334
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 289..334
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 768..789
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 290..304
NoneNo IPR availablePANTHERPTHR11492:SF2NUCLEAR FACTOR 1 C-TYPEcoord: 100..371
IPR000647CTF transcription factor/nuclear factor 1PANTHERPTHR11492NUCLEAR FACTOR Icoord: 100..371
IPR020604CTF transcription factor/nuclear factor 1, DNA-binding domainPROSITEPS51080CTF_NFI_2coord: 86..289
score: 12.642