Phosphodiesterase

Overview
NamePhosphodiesterase
Smed IDSMED30011874
Length (bp)2537
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Phosphodiesterase (SMED30011874) t-SNE clustered cells

Violin plots show distribution of expression levels for Phosphodiesterase (SMED30011874) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Phosphodiesterase (SMED30011874) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Phosphodiesterase (SMED30011874) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011874

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30011874h1SMcG0000699 SmedASXL_013379SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30011874h1SMcG0000699 dd_Smed_v4_6513_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30011874h1SMcG0000699 dd_Smed_v4_6513_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30011874h1SMcG0000699 dd_Smed_v6_6513_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30011874h1SMcG0000699 dd_Smed_v4_6513_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Phosphodiesterase vs. Ensembl Human
Match: PDE7A (phosphodiesterase 7A [Source:HGNC Symbol;Acc:HGNC:8791])

HSP 1 Score: 301.212 bits (770), Expect = 6.404e-93
Identity = 145/313 (46.33%), Postives = 203/313 (64.86%), Query Frame = 2
Query:  722 KMILNSIDNWDFNIFALERFTSGTPLTYLSIHLFEKHNLIQHFQLDISMVFQFLVTIERSYHQSNPYHNALHAADVTQAINCIIQDKQIFGQLTSQDILCSLLSTICHDVDHPGLNNMFLINSNHHLSILYKKQSILENHHWAFSLSVLRQTNLFLHFDKDLWKQVTNTCGSLIRATDISKQNAYLSDFNKILLSKDSPINEPLNEEQKILVLQMAIKCADICNPCRRWDICNCWAYLVTEEFFQQGDKEKALLLPISPIMDREKSKQAVVQRDFIKFLVLPLFTVWHQFIESNLSRNILDLIDSNKNMWQQL 1660
            K +L  + NW+F+IF  +R T+G  L  L+ HLF  H LI++F LD+  + +FLV I+  YH  NPYHNA+HAADVTQA++C +++ ++   +T  DIL SL++   HD+DHPG+N  FLI +NH+L+ LYK  S+LENHHW  ++ +LR++ LF H   +  +Q+    G+LI ATDIS+QN YLS F   L   D  + +      + LVLQMA+KCADICNPCR W++   W+  VTEEFF QGD EK   L +SP+ DR     A +Q  F+ +LV PLFT W +F  + LS+ +L  +  NK  W+ L
Sbjct:  119 KCMLEKVGNWNFDIFLFDRLTNGNSLVSLTFHLFSLHGLIEYFHLDMMKLRRFLVMIQEDYHSQNPYHNAVHAADVTQAMHCYLKEPKLANSVTPWDILLSLIAAATHDLDHPGVNQPFLIKTNHYLATLYKNTSVLENHHWRSAVGLLRESGLFSHLPLESRQQMETQIGALILATDISRQNEYLSLFRSHLDRGDLCLEDT---RHRHLVLQMALKCADICNPCRTWELSKQWSEKVTEEFFHQGDIEKKYHLGVSPLCDRHTESIANIQIGFMTYLVEPLFTEWARFSNTRLSQTMLGHVGLNKASWKGL 428          
BLAST of Phosphodiesterase vs. Ensembl Human
Match: PDE7A (phosphodiesterase 7A [Source:HGNC Symbol;Acc:HGNC:8791])

HSP 1 Score: 301.982 bits (772), Expect = 7.695e-93
Identity = 145/313 (46.33%), Postives = 203/313 (64.86%), Query Frame = 2
Query:  722 KMILNSIDNWDFNIFALERFTSGTPLTYLSIHLFEKHNLIQHFQLDISMVFQFLVTIERSYHQSNPYHNALHAADVTQAINCIIQDKQIFGQLTSQDILCSLLSTICHDVDHPGLNNMFLINSNHHLSILYKKQSILENHHWAFSLSVLRQTNLFLHFDKDLWKQVTNTCGSLIRATDISKQNAYLSDFNKILLSKDSPINEPLNEEQKILVLQMAIKCADICNPCRRWDICNCWAYLVTEEFFQQGDKEKALLLPISPIMDREKSKQAVVQRDFIKFLVLPLFTVWHQFIESNLSRNILDLIDSNKNMWQQL 1660
            K +L  + NW+F+IF  +R T+G  L  L+ HLF  H LI++F LD+  + +FLV I+  YH  NPYHNA+HAADVTQA++C +++ ++   +T  DIL SL++   HD+DHPG+N  FLI +NH+L+ LYK  S+LENHHW  ++ +LR++ LF H   +  +Q+    G+LI ATDIS+QN YLS F   L   D  + +      + LVLQMA+KCADICNPCR W++   W+  VTEEFF QGD EK   L +SP+ DR     A +Q  F+ +LV PLFT W +F  + LS+ +L  +  NK  W+ L
Sbjct:  145 KCMLEKVGNWNFDIFLFDRLTNGNSLVSLTFHLFSLHGLIEYFHLDMMKLRRFLVMIQEDYHSQNPYHNAVHAADVTQAMHCYLKEPKLANSVTPWDILLSLIAAATHDLDHPGVNQPFLIKTNHYLATLYKNTSVLENHHWRSAVGLLRESGLFSHLPLESRQQMETQIGALILATDISRQNEYLSLFRSHLDRGDLCLEDT---RHRHLVLQMALKCADICNPCRTWELSKQWSEKVTEEFFHQGDIEKKYHLGVSPLCDRHTESIANIQIGFMTYLVEPLFTEWARFSNTRLSQTMLGHVGLNKASWKGL 454          
BLAST of Phosphodiesterase vs. Ensembl Human
Match: PDE7B (phosphodiesterase 7B [Source:HGNC Symbol;Acc:HGNC:8792])

HSP 1 Score: 285.034 bits (728), Expect = 8.199e-87
Identity = 136/324 (41.98%), Postives = 204/324 (62.96%), Query Frame = 2
Query:  692 LIDMKQYPSIKMILNSIDNWDFNIFALERFTSGTPLTYLSIHLFEKHNLIQHFQLDISMVFQFLVTIERSYHQSNPYHNALHAADVTQAINCIIQDKQIFGQLTSQDILCSLLSTICHDVDHPGLNNMFLINSNHHLSILYKKQSILENHHWAFSLSVLRQTNLFLHFDKDLWKQVTNTCGSLIRATDISKQNAYLSDFNKILLSKDSPINEPLNEEQKILVLQMAIKCADICNPCRRWDICNCWAYLVTEEFFQQGDKEKALLLPISPIMDREKSKQAVVQRDFIKFLVLPLFTVWHQFI-ESNLSRNILDLIDSNKNMWQQL 1660
            L+D       + +L+ +  WDF+IF  +R T+G  L  L  HLF  H LI HF+LD+  + +FLV ++  YH  NPYHNA+HAADVTQA++C +++ ++   LT  DI+  LL+   HDVDHPG+N  FLI +NHHL+ LY+  S+LENHHW  ++ +LR++ L  H  K++ + +    GSLI ATDI++QN +L+     L +KD  + +    + +  +LQ+A+KCADICNPCR W++   W+  V EEF++QG+ E+   L ISP+ +++K     +Q  F+ ++V PLF  W  F   S LS N+L  +  NK  W+ L
Sbjct:   96 LLDEDYLGQARHMLSKVGMWDFDIFLFDRLTNGNSLVTLLCHLFNTHGLIHHFKLDMVTLHRFLVMVQEDYHSQNPYHNAVHAADVTQAMHCYLKEPKLASFLTPLDIMLGLLAAAAHDVDHPGVNQPFLIKTNHHLANLYQNMSVLENHHWRSTIGMLRESRLLAHLPKEMTQDIEQQLGSLILATDINRQNEFLTRLKAHLHNKDLRLEDA---QDRHFMLQIALKCADICNPCRIWEMSKQWSERVCEEFYRQGELEQKFELEISPLCNQQKDSIPSIQIGFMSYIVEPLFREWAHFTGNSTLSENMLGHLAHNKAQWKSL 416          
BLAST of Phosphodiesterase vs. Ensembl Human
Match: PDE7B (phosphodiesterase 7B [Source:HGNC Symbol;Acc:HGNC:8792])

HSP 1 Score: 285.804 bits (730), Expect = 1.457e-86
Identity = 136/324 (41.98%), Postives = 204/324 (62.96%), Query Frame = 2
Query:  692 LIDMKQYPSIKMILNSIDNWDFNIFALERFTSGTPLTYLSIHLFEKHNLIQHFQLDISMVFQFLVTIERSYHQSNPYHNALHAADVTQAINCIIQDKQIFGQLTSQDILCSLLSTICHDVDHPGLNNMFLINSNHHLSILYKKQSILENHHWAFSLSVLRQTNLFLHFDKDLWKQVTNTCGSLIRATDISKQNAYLSDFNKILLSKDSPINEPLNEEQKILVLQMAIKCADICNPCRRWDICNCWAYLVTEEFFQQGDKEKALLLPISPIMDREKSKQAVVQRDFIKFLVLPLFTVWHQFI-ESNLSRNILDLIDSNKNMWQQL 1660
            L+D       + +L+ +  WDF+IF  +R T+G  L  L  HLF  H LI HF+LD+  + +FLV ++  YH  NPYHNA+HAADVTQA++C +++ ++   LT  DI+  LL+   HDVDHPG+N  FLI +NHHL+ LY+  S+LENHHW  ++ +LR++ L  H  K++ + +    GSLI ATDI++QN +L+     L +KD  +    + + +  +LQ+A+KCADICNPCR W++   W+  V EEF++QG+ E+   L ISP+ +++K     +Q  F+ ++V PLF  W  F   S LS N+L  +  NK  W+ L
Sbjct:  148 LLDEDYLGQARHMLSKVGMWDFDIFLFDRLTNGNSLVTLLCHLFNTHGLIHHFKLDMVTLHRFLVMVQEDYHSQNPYHNAVHAADVTQAMHCYLKEPKLASFLTPLDIMLGLLAAAAHDVDHPGVNQPFLIKTNHHLANLYQNMSVLENHHWRSTIGMLRESRLLAHLPKEMTQDIEQQLGSLILATDINRQNEFLTRLKAHLHNKDLRLE---DAQDRHFMLQIALKCADICNPCRIWEMSKQWSERVCEEFYRQGELEQKFELEISPLCNQQKDSIPSIQIGFMSYIVEPLFREWAHFTGNSTLSENMLGHLAHNKAQWKSL 468          
BLAST of Phosphodiesterase vs. Ensembl Human
Match: PDE7A (phosphodiesterase 7A [Source:HGNC Symbol;Acc:HGNC:8791])

HSP 1 Score: 270.396 bits (690), Expect = 1.155e-81
Identity = 129/272 (47.43%), Postives = 179/272 (65.81%), Query Frame = 2
Query:  722 KMILNSIDNWDFNIFALERFTSGTPLTYLSIHLFEKHNLIQHFQLDISMVFQFLVTIERSYHQSNPYHNALHAADVTQAINCIIQDKQIFGQLTSQDILCSLLSTICHDVDHPGLNNMFLINSNHHLSILYKKQSILENHHWAFSLSVLRQTNLFLHFDKDLWKQVTNTCGSLIRATDISKQNAYLSDFNKILLSKDSPINEPLNEEQKILVLQMAIKCADICNPCRRWDICNCWAYLVTEEFFQQGDKEKALLLPISPIMDREKSKQAVVQ 1537
            K +L  + NW+F+IF  +R T+G  L  L+ HLF  H LI++F LD+  + +FLV I+  YH  NPYHNA+HAADVTQA++C +++ ++   +T  DIL SL++   HD+DHPG+N  FLI +NH+L+ LYK  S+LENHHW  ++ +LR++ LF H   +  +Q+    G+LI ATDIS+QN YLS F   L   D  + +      + LVLQMA+KCADICNPCR W++   W+  VTEEFF QGD EK   L +SP+ DR     A +Q
Sbjct:  145 KCMLEKVGNWNFDIFLFDRLTNGNSLVSLTFHLFSLHGLIEYFHLDMMKLRRFLVMIQEDYHSQNPYHNAVHAADVTQAMHCYLKEPKLANSVTPWDILLSLIAAATHDLDHPGVNQPFLIKTNHYLATLYKNTSVLENHHWRSAVGLLRESGLFSHLPLESRQQMETQIGALILATDISRQNEYLSLFRSHLDRGDLCLED---TRHRHLVLQMALKCADICNPCRTWELSKQWSEKVTEEFFHQGDIEKKYHLGVSPLCDRHTESIANIQ 413          
BLAST of Phosphodiesterase vs. Ensembl Celegans
Match: pde-4 (Probable 3',5'-cyclic phosphodiesterase pde-4 [Source:UniProtKB/Swiss-Prot;Acc:Q22000])

HSP 1 Score: 181.415 bits (459), Expect = 1.622e-48
Identity = 99/317 (31.23%), Postives = 175/317 (55.21%), Query Frame = 2
Query:  719 IKMILNSIDNWDFNIFALERFTSGTPLTYLSIHLFEKHNLIQHFQLDISMVFQFLVTIERSYHQSNPYHNALHAADVTQAINCIIQDKQIFGQLTSQDILCSLLSTICHDVDHPGLNNMFLINSNHHLSILYKKQSILENHHWAFSLSVLRQTN--LFLHFDKDLWKQVTNTCGSLIRATDISKQNAYLSDFNKILLSKDSPINEPLNEEQ---KILVLQMAIKCADICNPCRRWDICNCWAYLVTEEFFQQGDKEKALLLPISPIMDREKSKQAVVQRDFIKFLVLPLFTVWHQFIESNLSRNILDLIDSNKNMWQ 1654
            I + +  +D+W  ++F ++  +    LT ++  L  + NL + F++  S +  +L+ +E  Y ++N YHN +HAADV Q+++ ++    +    T  ++L ++ +   HDVDHPG  N +LINSN+ L+I+Y  +S+LE HH A +  +L+ +N     +  +    Q       ++ ATD+SK  + L+D   ++ +K    N  +  ++   KI VLQ  I  AD+ NP +  ++   W   + EE+++QGDKEK L L ISP+ DR        Q  FI ++V PL+  W   +  + ++NILD ++ N+  +Q
Sbjct:  215 IAVHMQRLDDWGPDVFKIDELSKNHSLTVVTFSLLRQRNLFKTFEIHQSTLVTYLLNLEHHY-RNNHYHNFIHAADVAQSMHVLLMSPVLTEVFTDLEVLAAIFAGAVHDVDHPGFTNQYLINSNNELAIMYNDESVLEQHHLAVAFKLLQDSNCDFLANLSRKQRLQFRKIVIDMVLATDMSKHMSLLADLKTMVEAKKVAGNNVIVLDKYNDKIQVLQSMIHLADLSNPTKPIELYQQWNQRIMEEYWRQGDKEKELGLEISPMCDRGNVTIEKSQVGFIDYIVHPLYETWADLVYPD-AQNILDQLEENREWYQ 529          
BLAST of Phosphodiesterase vs. Ensembl Celegans
Match: pde-4 (Probable 3',5'-cyclic phosphodiesterase pde-4 [Source:UniProtKB/Swiss-Prot;Acc:Q22000])

HSP 1 Score: 181.8 bits (460), Expect = 2.670e-48
Identity = 99/317 (31.23%), Postives = 175/317 (55.21%), Query Frame = 2
Query:  719 IKMILNSIDNWDFNIFALERFTSGTPLTYLSIHLFEKHNLIQHFQLDISMVFQFLVTIERSYHQSNPYHNALHAADVTQAINCIIQDKQIFGQLTSQDILCSLLSTICHDVDHPGLNNMFLINSNHHLSILYKKQSILENHHWAFSLSVLRQTN--LFLHFDKDLWKQVTNTCGSLIRATDISKQNAYLSDFNKILLSKDSPINEPLNEEQ---KILVLQMAIKCADICNPCRRWDICNCWAYLVTEEFFQQGDKEKALLLPISPIMDREKSKQAVVQRDFIKFLVLPLFTVWHQFIESNLSRNILDLIDSNKNMWQ 1654
            I + +  +D+W  ++F ++  +    LT ++  L  + NL + F++  S +  +L+ +E  Y ++N YHN +HAADV Q+++ ++    +    T  ++L ++ +   HDVDHPG  N +LINSN+ L+I+Y  +S+LE HH A +  +L+ +N     +  +    Q       ++ ATD+SK  + L+D   ++ +K    N  +  ++   KI VLQ  I  AD+ NP +  ++   W   + EE+++QGDKEK L L ISP+ DR        Q  FI ++V PL+  W   +  + ++NILD ++ N+  +Q
Sbjct:  265 IAVHMQRLDDWGPDVFKIDELSKNHSLTVVTFSLLRQRNLFKTFEIHQSTLVTYLLNLEHHY-RNNHYHNFIHAADVAQSMHVLLMSPVLTEVFTDLEVLAAIFAGAVHDVDHPGFTNQYLINSNNELAIMYNDESVLEQHHLAVAFKLLQDSNCDFLANLSRKQRLQFRKIVIDMVLATDMSKHMSLLADLKTMVEAKKVAGNNVIVLDKYNDKIQVLQSMIHLADLSNPTKPIELYQQWNQRIMEEYWRQGDKEKELGLEISPMCDRGNVTIEKSQVGFIDYIVHPLYETWADLVYPD-AQNILDQLEENREWYQ 579          
BLAST of Phosphodiesterase vs. Ensembl Celegans
Match: pde-4 (Probable 3',5'-cyclic phosphodiesterase pde-4 [Source:UniProtKB/Swiss-Prot;Acc:Q22000])

HSP 1 Score: 181.415 bits (459), Expect = 3.659e-48
Identity = 99/317 (31.23%), Postives = 175/317 (55.21%), Query Frame = 2
Query:  719 IKMILNSIDNWDFNIFALERFTSGTPLTYLSIHLFEKHNLIQHFQLDISMVFQFLVTIERSYHQSNPYHNALHAADVTQAINCIIQDKQIFGQLTSQDILCSLLSTICHDVDHPGLNNMFLINSNHHLSILYKKQSILENHHWAFSLSVLRQTN--LFLHFDKDLWKQVTNTCGSLIRATDISKQNAYLSDFNKILLSKDSPINEPLNEEQ---KILVLQMAIKCADICNPCRRWDICNCWAYLVTEEFFQQGDKEKALLLPISPIMDREKSKQAVVQRDFIKFLVLPLFTVWHQFIESNLSRNILDLIDSNKNMWQ 1654
            I + +  +D+W  ++F ++  +    LT ++  L  + NL + F++  S +  +L+ +E  Y ++N YHN +HAADV Q+++ ++    +    T  ++L ++ +   HDVDHPG  N +LINSN+ L+I+Y  +S+LE HH A +  +L+ +N     +  +    Q       ++ ATD+SK  + L+D   ++ +K    N  +  ++   KI VLQ  I  AD+ NP +  ++   W   + EE+++QGDKEK L L ISP+ DR        Q  FI ++V PL+  W   +  + ++NILD ++ N+  +Q
Sbjct:  278 IAVHMQRLDDWGPDVFKIDELSKNHSLTVVTFSLLRQRNLFKTFEIHQSTLVTYLLNLEHHY-RNNHYHNFIHAADVAQSMHVLLMSPVLTEVFTDLEVLAAIFAGAVHDVDHPGFTNQYLINSNNELAIMYNDESVLEQHHLAVAFKLLQDSNCDFLANLSRKQRLQFRKIVIDMVLATDMSKHMSLLADLKTMVEAKKVAGNNVIVLDKYNDKIQVLQSMIHLADLSNPTKPIELYQQWNQRIMEEYWRQGDKEKELGLEISPMCDRGNVTIEKSQVGFIDYIVHPLYETWADLVYPD-AQNILDQLEENREWYQ 592          
BLAST of Phosphodiesterase vs. Ensembl Celegans
Match: pde-4 (Probable 3',5'-cyclic phosphodiesterase pde-4 [Source:UniProtKB/Swiss-Prot;Acc:Q22000])

HSP 1 Score: 181.415 bits (459), Expect = 4.023e-48
Identity = 99/317 (31.23%), Postives = 175/317 (55.21%), Query Frame = 2
Query:  719 IKMILNSIDNWDFNIFALERFTSGTPLTYLSIHLFEKHNLIQHFQLDISMVFQFLVTIERSYHQSNPYHNALHAADVTQAINCIIQDKQIFGQLTSQDILCSLLSTICHDVDHPGLNNMFLINSNHHLSILYKKQSILENHHWAFSLSVLRQTN--LFLHFDKDLWKQVTNTCGSLIRATDISKQNAYLSDFNKILLSKDSPINEPLNEEQ---KILVLQMAIKCADICNPCRRWDICNCWAYLVTEEFFQQGDKEKALLLPISPIMDREKSKQAVVQRDFIKFLVLPLFTVWHQFIESNLSRNILDLIDSNKNMWQ 1654
            I + +  +D+W  ++F ++  +    LT ++  L  + NL + F++  S +  +L+ +E  Y ++N YHN +HAADV Q+++ ++    +    T  ++L ++ +   HDVDHPG  N +LINSN+ L+I+Y  +S+LE HH A +  +L+ +N     +  +    Q       ++ ATD+SK  + L+D   ++ +K    N  +  ++   KI VLQ  I  AD+ NP +  ++   W   + EE+++QGDKEK L L ISP+ DR        Q  FI ++V PL+  W   +  + ++NILD ++ N+  +Q
Sbjct:  290 IAVHMQRLDDWGPDVFKIDELSKNHSLTVVTFSLLRQRNLFKTFEIHQSTLVTYLLNLEHHY-RNNHYHNFIHAADVAQSMHVLLMSPVLTEVFTDLEVLAAIFAGAVHDVDHPGFTNQYLINSNNELAIMYNDESVLEQHHLAVAFKLLQDSNCDFLANLSRKQRLQFRKIVIDMVLATDMSKHMSLLADLKTMVEAKKVAGNNVIVLDKYNDKIQVLQSMIHLADLSNPTKPIELYQQWNQRIMEEYWRQGDKEKELGLEISPMCDRGNVTIEKSQVGFIDYIVHPLYETWADLVYPD-AQNILDQLEENREWYQ 604          
BLAST of Phosphodiesterase vs. Ensembl Celegans
Match: pde-4 (Probable 3',5'-cyclic phosphodiesterase pde-4 [Source:UniProtKB/Swiss-Prot;Acc:Q22000])

HSP 1 Score: 181.415 bits (459), Expect = 4.378e-48
Identity = 99/317 (31.23%), Postives = 175/317 (55.21%), Query Frame = 2
Query:  719 IKMILNSIDNWDFNIFALERFTSGTPLTYLSIHLFEKHNLIQHFQLDISMVFQFLVTIERSYHQSNPYHNALHAADVTQAINCIIQDKQIFGQLTSQDILCSLLSTICHDVDHPGLNNMFLINSNHHLSILYKKQSILENHHWAFSLSVLRQTN--LFLHFDKDLWKQVTNTCGSLIRATDISKQNAYLSDFNKILLSKDSPINEPLNEEQ---KILVLQMAIKCADICNPCRRWDICNCWAYLVTEEFFQQGDKEKALLLPISPIMDREKSKQAVVQRDFIKFLVLPLFTVWHQFIESNLSRNILDLIDSNKNMWQ 1654
            I + +  +D+W  ++F ++  +    LT ++  L  + NL + F++  S +  +L+ +E  Y ++N YHN +HAADV Q+++ ++    +    T  ++L ++ +   HDVDHPG  N +LINSN+ L+I+Y  +S+LE HH A +  +L+ +N     +  +    Q       ++ ATD+SK  + L+D   ++ +K    N  +  ++   KI VLQ  I  AD+ NP +  ++   W   + EE+++QGDKEK L L ISP+ DR        Q  FI ++V PL+  W   +  + ++NILD ++ N+  +Q
Sbjct:  292 IAVHMQRLDDWGPDVFKIDELSKNHSLTVVTFSLLRQRNLFKTFEIHQSTLVTYLLNLEHHY-RNNHYHNFIHAADVAQSMHVLLMSPVLTEVFTDLEVLAAIFAGAVHDVDHPGFTNQYLINSNNELAIMYNDESVLEQHHLAVAFKLLQDSNCDFLANLSRKQRLQFRKIVIDMVLATDMSKHMSLLADLKTMVEAKKVAGNNVIVLDKYNDKIQVLQSMIHLADLSNPTKPIELYQQWNQRIMEEYWRQGDKEKELGLEISPMCDRGNVTIEKSQVGFIDYIVHPLYETWADLVYPD-AQNILDQLEENREWYQ 606          
BLAST of Phosphodiesterase vs. Ensembl Fly
Match: dnc (gene:FBgn0000479 transcript:FBtr0070522)

HSP 1 Score: 198.364 bits (503), Expect = 1.392e-54
Identity = 101/319 (31.66%), Postives = 176/319 (55.17%), Query Frame = 2
Query:  719 IKMILNSIDNWDFNIFALERFTSGTPLTYLSIHLFEKHNLIQHFQLDISMVFQFLVTIERSYHQSNPYHNALHAADVTQAINCIIQDKQIFGQLTSQDILCSLLSTICHDVDHPGLNNMFLINSNHHLSILYKKQSILENHHWAFSLSVLRQ--TNLFLHFDKDLWKQVTNTCGSLIRATDISKQNAYLSDFNKILLSKDSPINEPL---NEEQKILVLQMAIKCADICNPCRRWDICNCWAYLVTEEFFQQGDKEKALLLPISPIMDREKSKQAVVQRDFIKFLVLPLFTVWHQFIESNLSRNILDLIDSNKNMWQQL 1660
            +  +L  +D W   IF++  F+   PLT ++  +F+   L+    +       F+ T+E  Y + NP+HN+LHAADVTQ+ N ++    + G  T  ++  +L +   HDVDHPGL N FL+NS+  L+++Y  +S+LENHH A +  +L+    ++F +  K   + +      ++ +TD+SK  + L+D   ++ +K    +  L   N   +I VL+  + CAD+ NP +   +   W  L+ EEFF QGDKE+   + ISP+ DR  +     Q  FI ++V PL+  W   +  + +++ILD ++ N++ +Q +
Sbjct:  115 LGTLLGELDTWGIQIFSIGEFSVNRPLTCVAYTIFQSRELLTSLMIPPKTFLNFMSTLEDHYVKDNPFHNSLHAADVTQSTNVLLNTPALEGVFTPLEVGGALFAACIHDVDHPGLTNQFLVNSSSELALMYNDESVLENHHLAVAFKLLQNQGCDIFCNMQKKQRQTLRKMVIDIVLSTDMSKHMSLLADLKTMVETKKVAGSGVLLLDNYTDRIQVLENLVHCADLSNPTKPLPLYKRWVALLMEEFFLQGDKERESGMDISPMCDRHNATIEKSQVGFIDYIVHPLWETWADLVHPD-AQDILDTLEENRDYYQSM 432          
BLAST of Phosphodiesterase vs. Ensembl Fly
Match: dnc (gene:FBgn0000479 transcript:FBtr0070518)

HSP 1 Score: 199.134 bits (505), Expect = 5.785e-54
Identity = 109/361 (30.19%), Postives = 194/361 (53.74%), Query Frame = 2
Query:  719 IKMILNSIDNWDFNIFALERFTSGTPLTYLSIHLFEKHNLIQHFQLDISMVFQFLVTIERSYHQSNPYHNALHAADVTQAINCIIQDKQIFGQLTSQDILCSLLSTICHDVDHPGLNNMFLINSNHHLSILYKKQSILENHHWAFSLSVLRQT--NLFLHFDKDLWKQVTNTCGSLIRATDISKQNAYLSDFNKILLSKDSPINEPL---NEEQKILVLQMAIKCADICNPCRRWDICNCWAYLVTEEFFQQGDKEKALLLPISPIMDREKSKQAVVQRDFIKFLVLPLFTVWHQFIESNLSRNILDLIDSNKNMWQQLSDLSTPEFNSIILSSIQSVYDRIQLMQVMDYTEDHQLSHLQE 1786
            +  +L  +D W   IF++  F+   PLT ++  +F+   L+    +       F+ T+E  Y + NP+HN+LHAADVTQ+ N ++    + G  T  ++  +L +   HDVDHPGL N FL+NS+  L+++Y  +S+LENHH A +  +L+    ++F +  K   + +      ++ +TD+SK  + L+D   ++ +K    +  L   N   +I VL+  + CAD+ NP +   +   W  L+ EEFF QGDKE+   + ISP+ DR  +     Q  FI ++V PL+  W   +  + +++ILD ++ N++ +Q +  +      S +  + Q   DRI+    ++ ++   L+ L+E
Sbjct:  236 LGTLLGELDTWGIQIFSIGEFSVNRPLTCVAYTIFQSRELLTSLMIPPKTFLNFMSTLEDHYVKDNPFHNSLHAADVTQSTNVLLNTPALEGVFTPLEVGGALFAACIHDVDHPGLTNQFLVNSSSELALMYNDESVLENHHLAVAFKLLQNQGCDIFCNMQKKQRQTLRKMVIDIVLSTDMSKHMSLLADLKTMVETKKVAGSGVLLLDNYTDRIQVLENLVHCADLSNPTKPLPLYKRWVALLMEEFFLQGDKERESGMDISPMCDRHNATIEKSQVGFIDYIVHPLWETWADLVHPD-AQDILDTLEENRDYYQSM--IPPSPPPSGVDENPQE--DRIRFQVTLEESDQENLAELEE 591          
BLAST of Phosphodiesterase vs. Ensembl Fly
Match: dnc (gene:FBgn0000479 transcript:FBtr0333312)

HSP 1 Score: 199.134 bits (505), Expect = 5.785e-54
Identity = 109/361 (30.19%), Postives = 194/361 (53.74%), Query Frame = 2
Query:  719 IKMILNSIDNWDFNIFALERFTSGTPLTYLSIHLFEKHNLIQHFQLDISMVFQFLVTIERSYHQSNPYHNALHAADVTQAINCIIQDKQIFGQLTSQDILCSLLSTICHDVDHPGLNNMFLINSNHHLSILYKKQSILENHHWAFSLSVLRQT--NLFLHFDKDLWKQVTNTCGSLIRATDISKQNAYLSDFNKILLSKDSPINEPL---NEEQKILVLQMAIKCADICNPCRRWDICNCWAYLVTEEFFQQGDKEKALLLPISPIMDREKSKQAVVQRDFIKFLVLPLFTVWHQFIESNLSRNILDLIDSNKNMWQQLSDLSTPEFNSIILSSIQSVYDRIQLMQVMDYTEDHQLSHLQE 1786
            +  +L  +D W   IF++  F+   PLT ++  +F+   L+    +       F+ T+E  Y + NP+HN+LHAADVTQ+ N ++    + G  T  ++  +L +   HDVDHPGL N FL+NS+  L+++Y  +S+LENHH A +  +L+    ++F +  K   + +      ++ +TD+SK  + L+D   ++ +K    +  L   N   +I VL+  + CAD+ NP +   +   W  L+ EEFF QGDKE+   + ISP+ DR  +     Q  FI ++V PL+  W   +  + +++ILD ++ N++ +Q +  +      S +  + Q   DRI+    ++ ++   L+ L+E
Sbjct:  236 LGTLLGELDTWGIQIFSIGEFSVNRPLTCVAYTIFQSRELLTSLMIPPKTFLNFMSTLEDHYVKDNPFHNSLHAADVTQSTNVLLNTPALEGVFTPLEVGGALFAACIHDVDHPGLTNQFLVNSSSELALMYNDESVLENHHLAVAFKLLQNQGCDIFCNMQKKQRQTLRKMVIDIVLSTDMSKHMSLLADLKTMVETKKVAGSGVLLLDNYTDRIQVLENLVHCADLSNPTKPLPLYKRWVALLMEEFFLQGDKERESGMDISPMCDRHNATIEKSQVGFIDYIVHPLWETWADLVHPD-AQDILDTLEENRDYYQSM--IPPSPPPSGVDENPQE--DRIRFQVTLEESDQENLAELEE 591          
BLAST of Phosphodiesterase vs. Ensembl Fly
Match: dnc (gene:FBgn0000479 transcript:FBtr0333317)

HSP 1 Score: 200.29 bits (508), Expect = 6.864e-54
Identity = 109/361 (30.19%), Postives = 194/361 (53.74%), Query Frame = 2
Query:  719 IKMILNSIDNWDFNIFALERFTSGTPLTYLSIHLFEKHNLIQHFQLDISMVFQFLVTIERSYHQSNPYHNALHAADVTQAINCIIQDKQIFGQLTSQDILCSLLSTICHDVDHPGLNNMFLINSNHHLSILYKKQSILENHHWAFSLSVLRQT--NLFLHFDKDLWKQVTNTCGSLIRATDISKQNAYLSDFNKILLSKDSPINEPL---NEEQKILVLQMAIKCADICNPCRRWDICNCWAYLVTEEFFQQGDKEKALLLPISPIMDREKSKQAVVQRDFIKFLVLPLFTVWHQFIESNLSRNILDLIDSNKNMWQQLSDLSTPEFNSIILSSIQSVYDRIQLMQVMDYTEDHQLSHLQE 1786
            +  +L  +D W   IF++  F+   PLT ++  +F+   L+    +       F+ T+E  Y + NP+HN+LHAADVTQ+ N ++    + G  T  ++  +L +   HDVDHPGL N FL+NS+  L+++Y  +S+LENHH A +  +L+    ++F +  K   + +      ++ +TD+SK  + L+D   ++ +K    +  L   N   +I VL+  + CAD+ NP +   +   W  L+ EEFF QGDKE+   + ISP+ DR  +     Q  FI ++V PL+  W   +  + +++ILD ++ N++ +Q +  +      S +  + Q   DRI+    ++ ++   L+ L+E
Sbjct:  309 LGTLLGELDTWGIQIFSIGEFSVNRPLTCVAYTIFQSRELLTSLMIPPKTFLNFMSTLEDHYVKDNPFHNSLHAADVTQSTNVLLNTPALEGVFTPLEVGGALFAACIHDVDHPGLTNQFLVNSSSELALMYNDESVLENHHLAVAFKLLQNQGCDIFCNMQKKQRQTLRKMVIDIVLSTDMSKHMSLLADLKTMVETKKVAGSGVLLLDNYTDRIQVLENLVHCADLSNPTKPLPLYKRWVALLMEEFFLQGDKERESGMDISPMCDRHNATIEKSQVGFIDYIVHPLWETWADLVHPD-AQDILDTLEENRDYYQSM--IPPSPPPSGVDENPQE--DRIRFQVTLEESDQENLAELEE 664          
BLAST of Phosphodiesterase vs. Ensembl Fly
Match: dnc (gene:FBgn0000479 transcript:FBtr0333316)

HSP 1 Score: 200.29 bits (508), Expect = 6.864e-54
Identity = 109/361 (30.19%), Postives = 194/361 (53.74%), Query Frame = 2
Query:  719 IKMILNSIDNWDFNIFALERFTSGTPLTYLSIHLFEKHNLIQHFQLDISMVFQFLVTIERSYHQSNPYHNALHAADVTQAINCIIQDKQIFGQLTSQDILCSLLSTICHDVDHPGLNNMFLINSNHHLSILYKKQSILENHHWAFSLSVLRQT--NLFLHFDKDLWKQVTNTCGSLIRATDISKQNAYLSDFNKILLSKDSPINEPL---NEEQKILVLQMAIKCADICNPCRRWDICNCWAYLVTEEFFQQGDKEKALLLPISPIMDREKSKQAVVQRDFIKFLVLPLFTVWHQFIESNLSRNILDLIDSNKNMWQQLSDLSTPEFNSIILSSIQSVYDRIQLMQVMDYTEDHQLSHLQE 1786
            +  +L  +D W   IF++  F+   PLT ++  +F+   L+    +       F+ T+E  Y + NP+HN+LHAADVTQ+ N ++    + G  T  ++  +L +   HDVDHPGL N FL+NS+  L+++Y  +S+LENHH A +  +L+    ++F +  K   + +      ++ +TD+SK  + L+D   ++ +K    +  L   N   +I VL+  + CAD+ NP +   +   W  L+ EEFF QGDKE+   + ISP+ DR  +     Q  FI ++V PL+  W   +  + +++ILD ++ N++ +Q +  +      S +  + Q   DRI+    ++ ++   L+ L+E
Sbjct:  309 LGTLLGELDTWGIQIFSIGEFSVNRPLTCVAYTIFQSRELLTSLMIPPKTFLNFMSTLEDHYVKDNPFHNSLHAADVTQSTNVLLNTPALEGVFTPLEVGGALFAACIHDVDHPGLTNQFLVNSSSELALMYNDESVLENHHLAVAFKLLQNQGCDIFCNMQKKQRQTLRKMVIDIVLSTDMSKHMSLLADLKTMVETKKVAGSGVLLLDNYTDRIQVLENLVHCADLSNPTKPLPLYKRWVALLMEEFFLQGDKERESGMDISPMCDRHNATIEKSQVGFIDYIVHPLWETWADLVHPD-AQDILDTLEENRDYYQSM--IPPSPPPSGVDENPQE--DRIRFQVTLEESDQENLAELEE 664          
BLAST of Phosphodiesterase vs. Ensembl Zebrafish
Match: pde7a (phosphodiesterase 7A [Source:ZFIN;Acc:ZDB-GENE-031222-10])

HSP 1 Score: 301.212 bits (770), Expect = 1.204e-92
Identity = 145/313 (46.33%), Postives = 202/313 (64.54%), Query Frame = 2
Query:  722 KMILNSIDNWDFNIFALERFTSGTPLTYLSIHLFEKHNLIQHFQLDISMVFQFLVTIERSYHQSNPYHNALHAADVTQAINCIIQDKQIFGQLTSQDILCSLLSTICHDVDHPGLNNMFLINSNHHLSILYKKQSILENHHWAFSLSVLRQTNLFLHFDKDLWKQVTNTCGSLIRATDISKQNAYLSDFNKILLSKDSPINEPLNEEQKILVLQMAIKCADICNPCRRWDICNCWAYLVTEEFFQQGDKEKALLLPISPIMDREKSKQAVVQRDFIKFLVLPLFTVWHQFIESNLSRNILDLIDSNKNMWQQL 1660
            K +L  + +W+F+IF  +R T+G  L +L+ HL  ++ LI+ FQLD+  V +FLV ++  YH  NPYHNA+HAADVTQA++C +++ ++   LTS DIL  LL+   HD+DHPG+N  FLI +NH+L+ LY+  S+LENHHW  ++ +LR+T LF H   +    +    GSLI ATDIS+QN YLS F   L   D  +    N   +  VLQMA+KCADICNPCR W++   W+  VTEEFF QGD EK L L ISP+ D E +  A VQ  F+ ++V PLF  W +F ++ LS+ +L  +  NK  W  +
Sbjct:  147 KCMLEKVGSWNFDIFLFDRLTNGNSLVFLTFHLLSQYGLIELFQLDMVKVRRFLVLVQEDYHNQNPYHNAVHAADVTQAMHCYLREPKLAQSLTSFDILLGLLAAATHDLDHPGVNQPFLIKTNHYLAALYRNTSVLENHHWRSAVGLLRETELFSHLPAEDSLSIERQLGSLILATDISRQNEYLSRFRTHLDENDLNLG---NASHRHFVLQMALKCADICNPCRPWELSKQWSEKVTEEFFHQGDIEKKLKLEISPLCDSEANTIASVQIGFMTYVVEPLFAEWARFSDTRLSQTMLGHLGLNKASWSTM 456          
BLAST of Phosphodiesterase vs. Ensembl Zebrafish
Match: pde4d (phosphodiesterase 4D, cAMP-specific [Source:ZFIN;Acc:ZDB-GENE-081105-16])

HSP 1 Score: 199.134 bits (505), Expect = 1.108e-53
Identity = 99/313 (31.63%), Postives = 174/313 (55.59%), Query Frame = 2
Query:  731 LNSIDNWDFNIFALERFTSGTPLTYLSIHLFEKHNLIQHFQLDISMVFQFLVTIERSYHQSNPYHNALHAADVTQAINCIIQDKQIFGQLTSQDILCSLLSTICHDVDHPGLNNMFLINSNHHLSILYKKQSILENHHWAFSLSVLRQTN--LFLHFDKDLWKQVTNTCGSLIRATDISKQNAYLSDFNKILLSKDSPINEPL---NEEQKILVLQMAIKCADICNPCRRWDICNCWAYLVTEEFFQQGDKEKALLLPISPIMDREKSKQAVVQRDFIKFLVLPLFTVWHQFIESNLSRNILDLIDSNKNMWQ 1654
            L  ++ W  N+F +  F+   PLT +   +F++ +L++ F++ +     +L+T+E  YH    YHN +HAADVTQ+ + ++    +    T  +IL ++ ++  HDVDHPG++N FLIN+N  L+++Y   S+LENHH A    +L++ N  +F +  K   + +      ++ ATD+SK    L+D   ++ +K    +  L   N   +I VLQ  + CAD+ NP +   +   W   + EEFF QGD+E+   + ISP+ D+  +     Q  FI ++V PL+  W   +  + +++ILD ++ N+  +Q
Sbjct:  249 LEDVNKWGLNVFKVSEFSGNRPLTVMMYTIFQERDLLKTFKIPLDTFITYLMTLEDHYHADVAYHNNIHAADVTQSTHVLLSTPALEAVFTDLEILAAIFASAIHDVDHPGVSNQFLINTNSELALMYNDSSVLENHHLAVGFKLLQEENCDIFQNLTKKQRQSLRKMVIDIVLATDMSKHMNLLADLKTMVETKKVTSSGVLLLDNYSDRIQVLQNMVHCADLSNPTKPLQLYRQWTDRIMEEFFSQGDRERERGMEISPMCDKHNASVEKSQVGFIDYIVHPLWETWADLVHPD-AQDILDTLEDNREWYQ 560          
BLAST of Phosphodiesterase vs. Ensembl Zebrafish
Match: BX510928.2 (phosphodiesterase 4D, cAMP-specific [Source:NCBI gene;Acc:566998])

HSP 1 Score: 199.519 bits (506), Expect = 1.459e-53
Identity = 99/313 (31.63%), Postives = 174/313 (55.59%), Query Frame = 2
Query:  731 LNSIDNWDFNIFALERFTSGTPLTYLSIHLFEKHNLIQHFQLDISMVFQFLVTIERSYHQSNPYHNALHAADVTQAINCIIQDKQIFGQLTSQDILCSLLSTICHDVDHPGLNNMFLINSNHHLSILYKKQSILENHHWAFSLSVLRQTN--LFLHFDKDLWKQVTNTCGSLIRATDISKQNAYLSDFNKILLSKDSPINEPL---NEEQKILVLQMAIKCADICNPCRRWDICNCWAYLVTEEFFQQGDKEKALLLPISPIMDREKSKQAVVQRDFIKFLVLPLFTVWHQFIESNLSRNILDLIDSNKNMWQ 1654
            L  ++ W  N+F +  F+   PLT +   +F++ +L++ F++ +     +L+T+E  YH    YHN +HAADVTQ+ + ++    +    T  +IL ++ ++  HDVDHPG++N FLIN+N  L+++Y   S+LENHH A    +L++ N  +F +  K   + +      ++ ATD+SK    L+D   ++ +K    +  L   N   +I VLQ  + CAD+ NP +   +   W   + EEFF QGD+E+   + ISP+ D+  +     Q  FI ++V PL+  W   +  + +++ILD ++ N+  +Q
Sbjct:  262 LEDVNKWGLNVFKVSEFSGNRPLTVMMYTIFQERDLLKTFKIPLDTFITYLMTLEDHYHADVAYHNNIHAADVTQSTHVLLSTPALEAVFTDLEILAAIFASAIHDVDHPGVSNQFLINTNSELALMYNDSSVLENHHLAVGFKLLQEENCDIFQNLTKKQRQSLRKMVIDIVLATDMSKHMNLLADLKTMVETKKVTSSGVLLLDNYSDRIQVLQNMVHCADLSNPTKPLQLYRQWTDRIMEEFFSQGDRERERGMEISPMCDKHNASVEKSQVGFIDYIVHPLWETWADLVHPD-AQDILDTLEDNREWYQ 573          
BLAST of Phosphodiesterase vs. Ensembl Zebrafish
Match: pde4d (phosphodiesterase 4D, cAMP-specific [Source:ZFIN;Acc:ZDB-GENE-081105-16])

HSP 1 Score: 199.519 bits (506), Expect = 1.536e-53
Identity = 99/313 (31.63%), Postives = 174/313 (55.59%), Query Frame = 2
Query:  731 LNSIDNWDFNIFALERFTSGTPLTYLSIHLFEKHNLIQHFQLDISMVFQFLVTIERSYHQSNPYHNALHAADVTQAINCIIQDKQIFGQLTSQDILCSLLSTICHDVDHPGLNNMFLINSNHHLSILYKKQSILENHHWAFSLSVLRQTN--LFLHFDKDLWKQVTNTCGSLIRATDISKQNAYLSDFNKILLSKDSPINEPL---NEEQKILVLQMAIKCADICNPCRRWDICNCWAYLVTEEFFQQGDKEKALLLPISPIMDREKSKQAVVQRDFIKFLVLPLFTVWHQFIESNLSRNILDLIDSNKNMWQ 1654
            L  ++ W  N+F +  F+   PLT +   +F++ +L++ F++ +     +L+T+E  YH    YHN +HAADVTQ+ + ++    +    T  +IL ++ ++  HDVDHPG++N FLIN+N  L+++Y   S+LENHH A    +L++ N  +F +  K   + +      ++ ATD+SK    L+D   ++ +K    +  L   N   +I VLQ  + CAD+ NP +   +   W   + EEFF QGD+E+   + ISP+ D+  +     Q  FI ++V PL+  W   +  + +++ILD ++ N+  +Q
Sbjct:  268 LEDVNKWGLNVFKVSEFSGNRPLTVMMYTIFQERDLLKTFKIPLDTFITYLMTLEDHYHADVAYHNNIHAADVTQSTHVLLSTPALEAVFTDLEILAAIFASAIHDVDHPGVSNQFLINTNSELALMYNDSSVLENHHLAVGFKLLQEENCDIFQNLTKKQRQSLRKMVIDIVLATDMSKHMNLLADLKTMVETKKVTSSGVLLLDNYSDRIQVLQNMVHCADLSNPTKPLQLYRQWTDRIMEEFFSQGDRERERGMEISPMCDKHNASVEKSQVGFIDYIVHPLWETWADLVHPD-AQDILDTLEDNREWYQ 579          
BLAST of Phosphodiesterase vs. Ensembl Zebrafish
Match: pde4cb (phosphodiesterase 4C, cAMP-specific b [Source:ZFIN;Acc:ZDB-GENE-030131-4075])

HSP 1 Score: 195.282 bits (495), Expect = 3.133e-52
Identity = 100/325 (30.77%), Postives = 176/325 (54.15%), Query Frame = 2
Query:  731 LNSIDNWDFNIFALERFTSGTPLTYLSIHLFEKHNLIQHFQLDISMVFQFLVTIERSYHQSNPYHNALHAADVTQAINCIIQDKQIFGQLTSQDILCSLLSTICHDVDHPGLNNMFLINSNHHLSILYKKQSILENHHWAFSLSVLRQTN--LFLHFDKDLWKQVTNTCGSLIRATDISKQNAYLSDFNKILLSKDSPINEPL---NEEQKILVLQMAIKCADICNPCRRWDICNCWAYLVTEEFFQQGDKEKALLLPISPIMDREKSKQAVVQRDFIKFLVLPLFTVWHQFIESNLSRNILDLIDSNKNMWQQL---SDLSTPE 1681
            L  +D W  +IF +  ++   PLT +   +F++ +L++ F++       FL+T+E  YH    YHN +HAADV Q+ + ++    +    T  +I+ +L ++  HDVDHPG+ N FLIN+N  L+++Y   S+LENHH A    +L++ N  +F +  K   + +      ++ ATD+SK   +L+D   ++ +K       L   N   +I VLQ  + CAD+ NP +  ++   W   +  EFF QGD+E+   + +SP+ D+  +     Q  FI +++ PL+  W   +  + +++ILD ++ N+  +Q +   S   TPE
Sbjct:  267 LEDLDRWGIDIFKIAEYSGNRPLTVMMYTIFQERDLLKTFKIPSDTFLTFLMTLEDHYHADVAYHNNIHAADVVQSTHVLLSTPALEDVFTDLEIMAALFASAIHDVDHPGVTNQFLINTNSELALMYNDASVLENHHLAVGFKLLQEENCDIFCNLSKKQRQSLRQMTIDMVLATDMSKHMNFLADLKTMVETKKVTSQGVLLLDNYSDRIQVLQNMVHCADLSNPTKPLELYRKWTDRIMVEFFSQGDRERDKGIDVSPMCDKHTASMENTQVGFIDYIIHPLWETWADLVHPD-AQDILDTLEDNREWYQSMIPRSPSPTPE 590          
BLAST of Phosphodiesterase vs. Ensembl Xenopus
Match: PDE7A (phosphodiesterase 7A [Source:NCBI gene;Acc:100498541])

HSP 1 Score: 300.056 bits (767), Expect = 2.492e-92
Identity = 140/313 (44.73%), Postives = 199/313 (63.58%), Query Frame = 2
Query:  722 KMILNSIDNWDFNIFALERFTSGTPLTYLSIHLFEKHNLIQHFQLDISMVFQFLVTIERSYHQSNPYHNALHAADVTQAINCIIQDKQIFGQLTSQDILCSLLSTICHDVDHPGLNNMFLINSNHHLSILYKKQSILENHHWAFSLSVLRQTNLFLHFDKDLWKQVTNTCGSLIRATDISKQNAYLSDFNKILLSKDSPINEPLNEEQKILVLQMAIKCADICNPCRRWDICNCWAYLVTEEFFQQGDKEKALLLPISPIMDREKSKQAVVQRDFIKFLVLPLFTVWHQFIESNLSRNILDLIDSNKNMWQQL 1660
            K +L  + +W F+IF  +R T+G  L  L+ HL   H LI HFQLD+  + +FLV ++  YH  NPYHNA+HAADVTQA+ C +++ ++    T  DIL  L++   HD+DHPG+N  FLI +NH+L+ LYK  S+LENHHW  ++ +LR++ LF H   +  + +    GS+I ATDIS+QN YLS F   L   D  ++   N   ++ +LQMA+KCADICNPCR W++   W+  VTEEFF QGD E+   L +SP+ DR+ S  A +Q  FI +LV PLF  W +F  + LS+ +L  +  NK  W+ +
Sbjct:  145 KCMLEKVGSWSFDIFLFDRLTNGNSLVTLTFHLLSHHGLIDHFQLDMVKLRRFLVMVQEDYHSQNPYHNAVHAADVTQAMYCFLKEPKLAKSFTPWDILLGLIAAATHDLDHPGVNQSFLIKTNHYLATLYKNTSVLENHHWRSAVGLLRESGLFAHMTLEERQHMEGQLGSIILATDISRQNEYLSQFRTHLDRGDLCLD---NASDRLFILQMALKCADICNPCRTWELSKQWSEKVTEEFFYQGDVERKYKLDVSPLCDRQTSNIANIQIGFITYLVEPLFVEWARFSNTRLSQTMLGHVGLNKASWKGM 454          
BLAST of Phosphodiesterase vs. Ensembl Xenopus
Match: PDE7A (phosphodiesterase 7A [Source:NCBI gene;Acc:100498541])

HSP 1 Score: 295.434 bits (755), Expect = 2.767e-92
Identity = 139/311 (44.69%), Postives = 198/311 (63.67%), Query Frame = 2
Query:  728 ILNSIDNWDFNIFALERFTSGTPLTYLSIHLFEKHNLIQHFQLDISMVFQFLVTIERSYHQSNPYHNALHAADVTQAINCIIQDKQIFGQLTSQDILCSLLSTICHDVDHPGLNNMFLINSNHHLSILYKKQSILENHHWAFSLSVLRQTNLFLHFDKDLWKQVTNTCGSLIRATDISKQNAYLSDFNKILLSKDSPINEPLNEEQKILVLQMAIKCADICNPCRRWDICNCWAYLVTEEFFQQGDKEKALLLPISPIMDREKSKQAVVQRDFIKFLVLPLFTVWHQFIESNLSRNILDLIDSNKNMWQQL 1660
            +L  + +W F+IF  +R T+G  L  L+ HL   H LI HFQLD+  + +FLV ++  YH  NPYHNA+HAADVTQA+ C +++ ++    T  DIL  L++   HD+DHPG+N  FLI +NH+L+ LYK  S+LENHHW  ++ +LR++ LF H   +  + +    GS+I ATDIS+QN YLS F   L   D  ++   N   ++ +LQMA+KCADICNPCR W++   W+  VTEEFF QGD E+   L +SP+ DR+ S  A +Q  FI +LV PLF  W +F  + LS+ +L  +  NK  W+ +
Sbjct:   18 MLEKVGSWSFDIFLFDRLTNGNSLVTLTFHLLSHHGLIDHFQLDMVKLRRFLVMVQEDYHSQNPYHNAVHAADVTQAMYCFLKEPKLAKSFTPWDILLGLIAAATHDLDHPGVNQSFLIKTNHYLATLYKNTSVLENHHWRSAVGLLRESGLFAHMTLEERQHMEGQLGSIILATDISRQNEYLSQFRTHLDRGDLCLD---NASDRLFILQMALKCADICNPCRTWELSKQWSEKVTEEFFYQGDVERKYKLDVSPLCDRQTSNIANIQIGFITYLVEPLFVEWARFSNTRLSQTMLGHVGLNKASWKGM 325          
BLAST of Phosphodiesterase vs. Ensembl Xenopus
Match: PDE7A (phosphodiesterase 7A [Source:NCBI gene;Acc:100498541])

HSP 1 Score: 299.671 bits (766), Expect = 2.922e-92
Identity = 140/313 (44.73%), Postives = 199/313 (63.58%), Query Frame = 2
Query:  722 KMILNSIDNWDFNIFALERFTSGTPLTYLSIHLFEKHNLIQHFQLDISMVFQFLVTIERSYHQSNPYHNALHAADVTQAINCIIQDKQIFGQLTSQDILCSLLSTICHDVDHPGLNNMFLINSNHHLSILYKKQSILENHHWAFSLSVLRQTNLFLHFDKDLWKQVTNTCGSLIRATDISKQNAYLSDFNKILLSKDSPINEPLNEEQKILVLQMAIKCADICNPCRRWDICNCWAYLVTEEFFQQGDKEKALLLPISPIMDREKSKQAVVQRDFIKFLVLPLFTVWHQFIESNLSRNILDLIDSNKNMWQQL 1660
            K +L  + +W F+IF  +R T+G  L  L+ HL   H LI HFQLD+  + +FLV ++  YH  NPYHNA+HAADVTQA+ C +++ ++    T  DIL  L++   HD+DHPG+N  FLI +NH+L+ LYK  S+LENHHW  ++ +LR++ LF H   +  + +    GS+I ATDIS+QN YLS F   L   D  ++   N   ++ +LQMA+KCADICNPCR W++   W+  VTEEFF QGD E+   L +SP+ DR+ S  A +Q  FI +LV PLF  W +F  + LS+ +L  +  NK  W+ +
Sbjct:  145 KCMLEKVGSWSFDIFLFDRLTNGNSLVTLTFHLLSHHGLIDHFQLDMVKLRRFLVMVQEDYHSQNPYHNAVHAADVTQAMYCFLKEPKLAKSFTPWDILLGLIAAATHDLDHPGVNQSFLIKTNHYLATLYKNTSVLENHHWRSAVGLLRESGLFAHMTLEERQHMEGQLGSIILATDISRQNEYLSQFRTHLDRGDLCLD---NASDRLFILQMALKCADICNPCRTWELSKQWSEKVTEEFFYQGDVERKYKLDVSPLCDRQTSNIANIQIGFITYLVEPLFVEWARFSNTRLSQTMLGHVGLNKASWKGM 454          
BLAST of Phosphodiesterase vs. Ensembl Xenopus
Match: PDE7A (phosphodiesterase 7A [Source:NCBI gene;Acc:100498541])

HSP 1 Score: 297.745 bits (761), Expect = 6.208e-92
Identity = 140/313 (44.73%), Postives = 199/313 (63.58%), Query Frame = 2
Query:  722 KMILNSIDNWDFNIFALERFTSGTPLTYLSIHLFEKHNLIQHFQLDISMVFQFLVTIERSYHQSNPYHNALHAADVTQAINCIIQDKQIFGQLTSQDILCSLLSTICHDVDHPGLNNMFLINSNHHLSILYKKQSILENHHWAFSLSVLRQTNLFLHFDKDLWKQVTNTCGSLIRATDISKQNAYLSDFNKILLSKDSPINEPLNEEQKILVLQMAIKCADICNPCRRWDICNCWAYLVTEEFFQQGDKEKALLLPISPIMDREKSKQAVVQRDFIKFLVLPLFTVWHQFIESNLSRNILDLIDSNKNMWQQL 1660
            K +L  + +W F+IF  +R T+G  L  L+ HL   H LI HFQLD+  + +FLV ++  YH  NPYHNA+HAADVTQA+ C +++ ++    T  DIL  L++   HD+DHPG+N  FLI +NH+L+ LYK  S+LENHHW  ++ +LR++ LF H   +  + +    GS+I ATDIS+QN YLS F   L   D  ++   N   ++ +LQMA+KCADICNPCR W++   W+  VTEEFF QGD E+   L +SP+ DR+ S  A +Q  FI +LV PLF  W +F  + LS+ +L  +  NK  W+ +
Sbjct:  110 KCMLEKVGSWSFDIFLFDRLTNGNSLVTLTFHLLSHHGLIDHFQLDMVKLRRFLVMVQEDYHSQNPYHNAVHAADVTQAMYCFLKEPKLAKSFTPWDILLGLIAAATHDLDHPGVNQSFLIKTNHYLATLYKNTSVLENHHWRSAVGLLRESGLFAHMTLEERQHMEGQLGSIILATDISRQNEYLSQFRTHLDRGDLCLD---NASDRLFILQMALKCADICNPCRTWELSKQWSEKVTEEFFYQGDVERKYKLDVSPLCDRQTSNIANIQIGFITYLVEPLFVEWARFSNTRLSQTMLGHVGLNKASWKGM 419          
BLAST of Phosphodiesterase vs. Ensembl Xenopus
Match: PDE7A (phosphodiesterase 7A [Source:NCBI gene;Acc:100498541])

HSP 1 Score: 297.36 bits (760), Expect = 9.921e-92
Identity = 140/313 (44.73%), Postives = 199/313 (63.58%), Query Frame = 2
Query:  722 KMILNSIDNWDFNIFALERFTSGTPLTYLSIHLFEKHNLIQHFQLDISMVFQFLVTIERSYHQSNPYHNALHAADVTQAINCIIQDKQIFGQLTSQDILCSLLSTICHDVDHPGLNNMFLINSNHHLSILYKKQSILENHHWAFSLSVLRQTNLFLHFDKDLWKQVTNTCGSLIRATDISKQNAYLSDFNKILLSKDSPINEPLNEEQKILVLQMAIKCADICNPCRRWDICNCWAYLVTEEFFQQGDKEKALLLPISPIMDREKSKQAVVQRDFIKFLVLPLFTVWHQFIESNLSRNILDLIDSNKNMWQQL 1660
            K +L  + +W F+IF  +R T+G  L  L+ HL   H LI HFQLD+  + +FLV ++  YH  NPYHNA+HAADVTQA+ C +++ ++    T  DIL  L++   HD+DHPG+N  FLI +NH+L+ LYK  S+LENHHW  ++ +LR++ LF H   +  + +    GS+I ATDIS+QN YLS F   L   D  ++   N   ++ +LQMA+KCADICNPCR W++   W+  VTEEFF QGD E+   L +SP+ DR+ S  A +Q  FI +LV PLF  W +F  + LS+ +L  +  NK  W+ +
Sbjct:  112 KCMLEKVGSWSFDIFLFDRLTNGNSLVTLTFHLLSHHGLIDHFQLDMVKLRRFLVMVQEDYHSQNPYHNAVHAADVTQAMYCFLKEPKLAKSFTPWDILLGLIAAATHDLDHPGVNQSFLIKTNHYLATLYKNTSVLENHHWRSAVGLLRESGLFAHMTLEERQHMEGQLGSIILATDISRQNEYLSQFRTHLDRGDLCLD---NASDRLFILQMALKCADICNPCRTWELSKQWSEKVTEEFFYQGDVERKYKLDVSPLCDRQTSNIANIQIGFITYLVEPLFVEWARFSNTRLSQTMLGHVGLNKASWKGM 421          
BLAST of Phosphodiesterase vs. Ensembl Mouse
Match: Pde7a (phosphodiesterase 7A [Source:MGI Symbol;Acc:MGI:1202402])

HSP 1 Score: 303.523 bits (776), Expect = 1.285e-93
Identity = 144/313 (46.01%), Postives = 206/313 (65.81%), Query Frame = 2
Query:  722 KMILNSIDNWDFNIFALERFTSGTPLTYLSIHLFEKHNLIQHFQLDISMVFQFLVTIERSYHQSNPYHNALHAADVTQAINCIIQDKQIFGQLTSQDILCSLLSTICHDVDHPGLNNMFLINSNHHLSILYKKQSILENHHWAFSLSVLRQTNLFLHFDKDLWKQVTNTCGSLIRATDISKQNAYLSDFNKILLSKDSPINEPLNEEQKILVLQMAIKCADICNPCRRWDICNCWAYLVTEEFFQQGDKEKALLLPISPIMDREKSKQAVVQRDFIKFLVLPLFTVWHQFIESNLSRNILDLIDSNKNMWQQL 1660
            K +L  + NW+F+IF  +R T+G  L  L+ HLF  H LI++F LD+  + +FLV I+  YH  NPYHNA+HAADVTQA++C +++ ++   +T  DIL SL++   HD+DHPG+N  FLI +NH+L+ LYK  S+LENHHW  ++ +LR++ LF H   +  +++    G+LI ATDIS+QN YLS F   L   D  +++      + LVLQMA+KCADICNPCR W++   W+  VTEEFF QGD EK   L +SP+ DR+    A +Q  F+ +LV PLFT W +F ++ LS+ +L  +  NK  W+ L
Sbjct:  145 KCMLEKVGNWNFDIFLFDRLTNGNSLVSLTFHLFSLHGLIEYFHLDMVKLRRFLVMIQEDYHSQNPYHNAVHAADVTQAMHCYLKEPKLASSVTPWDILLSLIAAATHDLDHPGVNQPFLIKTNHYLATLYKNSSVLENHHWRSAVGLLRESGLFSHLPLESRQEMEAQIGALILATDISRQNEYLSLFRSHLDKGDLHLDDG---RHRHLVLQMALKCADICNPCRNWELSKQWSEKVTEEFFHQGDIEKKYHLGVSPLCDRQTESIANIQIGFMTYLVEPLFTEWARFSDTRLSQTMLGHVGLNKASWKGL 454          
BLAST of Phosphodiesterase vs. Ensembl Mouse
Match: Pde7a (phosphodiesterase 7A [Source:MGI Symbol;Acc:MGI:1202402])

HSP 1 Score: 302.368 bits (773), Expect = 1.590e-93
Identity = 144/313 (46.01%), Postives = 206/313 (65.81%), Query Frame = 2
Query:  722 KMILNSIDNWDFNIFALERFTSGTPLTYLSIHLFEKHNLIQHFQLDISMVFQFLVTIERSYHQSNPYHNALHAADVTQAINCIIQDKQIFGQLTSQDILCSLLSTICHDVDHPGLNNMFLINSNHHLSILYKKQSILENHHWAFSLSVLRQTNLFLHFDKDLWKQVTNTCGSLIRATDISKQNAYLSDFNKILLSKDSPINEPLNEEQKILVLQMAIKCADICNPCRRWDICNCWAYLVTEEFFQQGDKEKALLLPISPIMDREKSKQAVVQRDFIKFLVLPLFTVWHQFIESNLSRNILDLIDSNKNMWQQL 1660
            K +L  + NW+F+IF  +R T+G  L  L+ HLF  H LI++F LD+  + +FLV I+  YH  NPYHNA+HAADVTQA++C +++ ++   +T  DIL SL++   HD+DHPG+N  FLI +NH+L+ LYK  S+LENHHW  ++ +LR++ LF H   +  +++    G+LI ATDIS+QN YLS F   L   D  +++      + LVLQMA+KCADICNPCR W++   W+  VTEEFF QGD EK   L +SP+ DR+    A +Q  F+ +LV PLFT W +F ++ LS+ +L  +  NK  W+ L
Sbjct:  119 KCMLEKVGNWNFDIFLFDRLTNGNSLVSLTFHLFSLHGLIEYFHLDMVKLRRFLVMIQEDYHSQNPYHNAVHAADVTQAMHCYLKEPKLASSVTPWDILLSLIAAATHDLDHPGVNQPFLIKTNHYLATLYKNSSVLENHHWRSAVGLLRESGLFSHLPLESRQEMEAQIGALILATDISRQNEYLSLFRSHLDKGDLHLDDG---RHRHLVLQMALKCADICNPCRNWELSKQWSEKVTEEFFHQGDIEKKYHLGVSPLCDRQTESIANIQIGFMTYLVEPLFTEWARFSDTRLSQTMLGHVGLNKASWKGL 428          
BLAST of Phosphodiesterase vs. Ensembl Mouse
Match: Pde7b (phosphodiesterase 7B [Source:MGI Symbol;Acc:MGI:1352752])

HSP 1 Score: 288.115 bits (736), Expect = 4.149e-88
Identity = 138/324 (42.59%), Postives = 205/324 (63.27%), Query Frame = 2
Query:  692 LIDMKQYPSIKMILNSIDNWDFNIFALERFTSGTPLTYLSIHLFEKHNLIQHFQLDISMVFQFLVTIERSYHQSNPYHNALHAADVTQAINCIIQDKQIFGQLTSQDILCSLLSTICHDVDHPGLNNMFLINSNHHLSILYKKQSILENHHWAFSLSVLRQTNLFLHFDKDLWKQVTNTCGSLIRATDISKQNAYLSDFNKILLSKDSPINEPLNEEQKILVLQMAIKCADICNPCRRWDICNCWAYLVTEEFFQQGDKEKALLLPISPIMDREKSKQAVVQRDFIKFLVLPLFTVWHQFI-ESNLSRNILDLIDSNKNMWQQL 1660
            L+D       + +L+ +  WDF+IF  +R T+G  L  L  HLF  H LI HF+LD+  + +FLV ++  YH  NPYHNA+HAADVTQA++C +++ ++   LT  DI+  LL+   HDVDHPG+N  FLI +NHHL+ LY+  S+LENHHW  ++ +LR++ L  H  K++ + +    GSLI ATDI++QN +L+     L +KD  +    N + +  +LQ+A+KCADICNPCR W++   W+  V EEF++QGD E+   L ISP+ +++K     +Q  F+ ++V PLF  W +F   S LS N+L  +  NK  W+ L
Sbjct:  109 LLDEDYLGQARHMLSKVGTWDFDIFLFDRLTNGNSLVTLLCHLFNSHGLIHHFKLDMVTLHRFLVMVQEDYHGHNPYHNAVHAADVTQAMHCYLKEPKLASFLTPLDIMLGLLAAAAHDVDHPGVNQPFLIKTNHHLANLYQNMSVLENHHWRSTIGMLRESRLLAHLPKEMTQDIEQQLGSLILATDINRQNEFLTRLKAHLHNKDLRLE---NVQDRHFMLQIALKCADICNPCRIWEMSKQWSERVCEEFYRQGDLEQKFELEISPLCNQQKDSIPSIQIGFMTYIVEPLFREWARFTGNSTLSENMLSHLAHNKAQWKSL 429          
BLAST of Phosphodiesterase vs. Ensembl Mouse
Match: Pde7b (phosphodiesterase 7B [Source:MGI Symbol;Acc:MGI:1352752])

HSP 1 Score: 287.73 bits (735), Expect = 4.228e-88
Identity = 138/324 (42.59%), Postives = 205/324 (63.27%), Query Frame = 2
Query:  692 LIDMKQYPSIKMILNSIDNWDFNIFALERFTSGTPLTYLSIHLFEKHNLIQHFQLDISMVFQFLVTIERSYHQSNPYHNALHAADVTQAINCIIQDKQIFGQLTSQDILCSLLSTICHDVDHPGLNNMFLINSNHHLSILYKKQSILENHHWAFSLSVLRQTNLFLHFDKDLWKQVTNTCGSLIRATDISKQNAYLSDFNKILLSKDSPINEPLNEEQKILVLQMAIKCADICNPCRRWDICNCWAYLVTEEFFQQGDKEKALLLPISPIMDREKSKQAVVQRDFIKFLVLPLFTVWHQFI-ESNLSRNILDLIDSNKNMWQQL 1660
            L+D       + +L+ +  WDF+IF  +R T+G  L  L  HLF  H LI HF+LD+  + +FLV ++  YH  NPYHNA+HAADVTQA++C +++ ++   LT  DI+  LL+   HDVDHPG+N  FLI +NHHL+ LY+  S+LENHHW  ++ +LR++ L  H  K++ + +    GSLI ATDI++QN +L+     L +KD  +    N + +  +LQ+A+KCADICNPCR W++   W+  V EEF++QGD E+   L ISP+ +++K     +Q  F+ ++V PLF  W +F   S LS N+L  +  NK  W+ L
Sbjct:   96 LLDEDYLGQARHMLSKVGTWDFDIFLFDRLTNGNSLVTLLCHLFNSHGLIHHFKLDMVTLHRFLVMVQEDYHGHNPYHNAVHAADVTQAMHCYLKEPKLASFLTPLDIMLGLLAAAAHDVDHPGVNQPFLIKTNHHLANLYQNMSVLENHHWRSTIGMLRESRLLAHLPKEMTQDIEQQLGSLILATDINRQNEFLTRLKAHLHNKDLRLE---NVQDRHFMLQIALKCADICNPCRIWEMSKQWSERVCEEFYRQGDLEQKFELEISPLCNQQKDSIPSIQIGFMTYIVEPLFREWARFTGNSTLSENMLSHLAHNKAQWKSL 416          
BLAST of Phosphodiesterase vs. Ensembl Mouse
Match: Pde7b (phosphodiesterase 7B [Source:MGI Symbol;Acc:MGI:1352752])

HSP 1 Score: 288.886 bits (738), Expect = 7.142e-88
Identity = 138/324 (42.59%), Postives = 205/324 (63.27%), Query Frame = 2
Query:  692 LIDMKQYPSIKMILNSIDNWDFNIFALERFTSGTPLTYLSIHLFEKHNLIQHFQLDISMVFQFLVTIERSYHQSNPYHNALHAADVTQAINCIIQDKQIFGQLTSQDILCSLLSTICHDVDHPGLNNMFLINSNHHLSILYKKQSILENHHWAFSLSVLRQTNLFLHFDKDLWKQVTNTCGSLIRATDISKQNAYLSDFNKILLSKDSPINEPLNEEQKILVLQMAIKCADICNPCRRWDICNCWAYLVTEEFFQQGDKEKALLLPISPIMDREKSKQAVVQRDFIKFLVLPLFTVWHQFI-ESNLSRNILDLIDSNKNMWQQL 1660
            L+D       + +L+ +  WDF+IF  +R T+G  L  L  HLF  H LI HF+LD+  + +FLV ++  YH  NPYHNA+HAADVTQA++C +++ ++   LT  DI+  LL+   HDVDHPG+N  FLI +NHHL+ LY+  S+LENHHW  ++ +LR++ L  H  K++ + +    GSLI ATDI++QN +L+     L +KD  +    N + +  +LQ+A+KCADICNPCR W++   W+  V EEF++QGD E+   L ISP+ +++K     +Q  F+ ++V PLF  W +F   S LS N+L  +  NK  W+ L
Sbjct:  148 LLDEDYLGQARHMLSKVGTWDFDIFLFDRLTNGNSLVTLLCHLFNSHGLIHHFKLDMVTLHRFLVMVQEDYHGHNPYHNAVHAADVTQAMHCYLKEPKLASFLTPLDIMLGLLAAAAHDVDHPGVNQPFLIKTNHHLANLYQNMSVLENHHWRSTIGMLRESRLLAHLPKEMTQDIEQQLGSLILATDINRQNEFLTRLKAHLHNKDLRLE---NVQDRHFMLQIALKCADICNPCRIWEMSKQWSERVCEEFYRQGDLEQKFELEISPLCNQQKDSIPSIQIGFMTYIVEPLFREWARFTGNSTLSENMLSHLAHNKAQWKSL 468          
BLAST of Phosphodiesterase vs. UniProt/SwissProt
Match: sp|P70453|PDE7A_MOUSE (High affinity cAMP-specific 3',5'-cyclic phosphodiesterase 7A OS=Mus musculus OX=10090 GN=Pde7a PE=2 SV=2)

HSP 1 Score: 302.368 bits (773), Expect = 1.113e-92
Identity = 144/313 (46.01%), Postives = 206/313 (65.81%), Query Frame = 2
Query:  722 KMILNSIDNWDFNIFALERFTSGTPLTYLSIHLFEKHNLIQHFQLDISMVFQFLVTIERSYHQSNPYHNALHAADVTQAINCIIQDKQIFGQLTSQDILCSLLSTICHDVDHPGLNNMFLINSNHHLSILYKKQSILENHHWAFSLSVLRQTNLFLHFDKDLWKQVTNTCGSLIRATDISKQNAYLSDFNKILLSKDSPINEPLNEEQKILVLQMAIKCADICNPCRRWDICNCWAYLVTEEFFQQGDKEKALLLPISPIMDREKSKQAVVQRDFIKFLVLPLFTVWHQFIESNLSRNILDLIDSNKNMWQQL 1660
            K +L  + NW+F+IF  +R T+G  L  L+ HLF  H LI++F LD+  + +FLV I+  YH  NPYHNA+HAADVTQA++C +++ ++   +T  DIL SL++   HD+DHPG+N  FLI +NH+L+ LYK  S+LENHHW  ++ +LR++ LF H   +  +++    G+LI ATDIS+QN YLS F   L   D  +++      + LVLQMA+KCADICNPCR W++   W+  VTEEFF QGD EK   L +SP+ DR+    A +Q  F+ +LV PLFT W +F ++ LS+ +L  +  NK  W+ L
Sbjct:  119 KCMLEKVGNWNFDIFLFDRLTNGNSLVSLTFHLFSLHGLIEYFHLDMVKLRRFLVMIQEDYHSQNPYHNAVHAADVTQAMHCYLKEPKLASSVTPWDILLSLIAAATHDLDHPGVNQPFLIKTNHYLATLYKNSSVLENHHWRSAVGLLRESGLFSHLPLESRQEMEAQIGALILATDISRQNEYLSLFRSHLDKGDLHLDDG---RHRHLVLQMALKCADICNPCRNWELSKQWSEKVTEEFFHQGDIEKKYHLGVSPLCDRQTESIANIQIGFMTYLVEPLFTEWARFSDTRLSQTMLGHVGLNKASWKGL 428          
BLAST of Phosphodiesterase vs. UniProt/SwissProt
Match: sp|Q13946|PDE7A_HUMAN (High affinity cAMP-specific 3',5'-cyclic phosphodiesterase 7A OS=Homo sapiens OX=9606 GN=PDE7A PE=1 SV=2)

HSP 1 Score: 301.982 bits (772), Expect = 3.696e-92
Identity = 145/313 (46.33%), Postives = 203/313 (64.86%), Query Frame = 2
Query:  722 KMILNSIDNWDFNIFALERFTSGTPLTYLSIHLFEKHNLIQHFQLDISMVFQFLVTIERSYHQSNPYHNALHAADVTQAINCIIQDKQIFGQLTSQDILCSLLSTICHDVDHPGLNNMFLINSNHHLSILYKKQSILENHHWAFSLSVLRQTNLFLHFDKDLWKQVTNTCGSLIRATDISKQNAYLSDFNKILLSKDSPINEPLNEEQKILVLQMAIKCADICNPCRRWDICNCWAYLVTEEFFQQGDKEKALLLPISPIMDREKSKQAVVQRDFIKFLVLPLFTVWHQFIESNLSRNILDLIDSNKNMWQQL 1660
            K +L  + NW+F+IF  +R T+G  L  L+ HLF  H LI++F LD+  + +FLV I+  YH  NPYHNA+HAADVTQA++C +++ ++   +T  DIL SL++   HD+DHPG+N  FLI +NH+L+ LYK  S+LENHHW  ++ +LR++ LF H   +  +Q+    G+LI ATDIS+QN YLS F   L   D  + +      + LVLQMA+KCADICNPCR W++   W+  VTEEFF QGD EK   L +SP+ DR     A +Q  F+ +LV PLFT W +F  + LS+ +L  +  NK  W+ L
Sbjct:  145 KCMLEKVGNWNFDIFLFDRLTNGNSLVSLTFHLFSLHGLIEYFHLDMMKLRRFLVMIQEDYHSQNPYHNAVHAADVTQAMHCYLKEPKLANSVTPWDILLSLIAAATHDLDHPGVNQPFLIKTNHYLATLYKNTSVLENHHWRSAVGLLRESGLFSHLPLESRQQMETQIGALILATDISRQNEYLSLFRSHLDRGDLCLEDT---RHRHLVLQMALKCADICNPCRTWELSKQWSEKVTEEFFHQGDIEKKYHLGVSPLCDRHTESIANIQIGFMTYLVEPLFTEWARFSNTRLSQTMLGHVGLNKASWKGL 454          
BLAST of Phosphodiesterase vs. UniProt/SwissProt
Match: sp|O08593|PDE7A_RAT (High affinity cAMP-specific 3',5'-cyclic phosphodiesterase 7A (Fragment) OS=Rattus norvegicus OX=10116 GN=Pde7a PE=2 SV=1)

HSP 1 Score: 299.286 bits (765), Expect = 7.618e-92
Identity = 143/313 (45.69%), Postives = 204/313 (65.18%), Query Frame = 2
Query:  722 KMILNSIDNWDFNIFALERFTSGTPLTYLSIHLFEKHNLIQHFQLDISMVFQFLVTIERSYHQSNPYHNALHAADVTQAINCIIQDKQIFGQLTSQDILCSLLSTICHDVDHPGLNNMFLINSNHHLSILYKKQSILENHHWAFSLSVLRQTNLFLHFDKDLWKQVTNTCGSLIRATDISKQNAYLSDFNKILLSKDSPINEPLNEEQKILVLQMAIKCADICNPCRRWDICNCWAYLVTEEFFQQGDKEKALLLPISPIMDREKSKQAVVQRDFIKFLVLPLFTVWHQFIESNLSRNILDLIDSNKNMWQQL 1660
            K +L  + NW+F+IF  +R T+G  L  L+ HLF  H LI++F LD+  + +FLV I+  YH  NPYHNA+HAADVTQA++C +++ ++   +T  DIL SL++   HD+DHPG+N  FLI +NH+L+ LYK  S+LENHHW  ++ +LR++ LF H   +   ++    G+LI ATDIS+QN YLS F   L   D  +++      + LVLQMA+KCADICNPCR W++   W+  VTEEFF QGD EK   L +SP+ DR+    A +Q  F+ +L  PLFT W +F ++ LS+ +L  +  NK  W+ L
Sbjct:   89 KCMLEKVGNWNFDIFLFDRLTNGNSLVSLTFHLFSLHGLIEYFHLDMVKLRRFLVMIQEDYHSQNPYHNAVHAADVTQAMHCYLKEPKLANSVTPWDILLSLIAAATHDLDHPGVNQPFLIKTNHYLATLYKNTSVLENHHWRSAVGLLRESGLFSHLPLESRHEMEAQIGALILATDISRQNEYLSLFRSHLDKGDLHLDDG---RHRHLVLQMALKCADICNPCRNWELSKQWSEKVTEEFFHQGDIEKKYHLGVSPLCDRQTESIANIQIGFMTYLQEPLFTEWARFSDTRLSQTMLGHVGLNKASWKGL 398          
BLAST of Phosphodiesterase vs. UniProt/SwissProt
Match: sp|Q9QXQ1|PDE7B_MOUSE (cAMP-specific 3',5'-cyclic phosphodiesterase 7B OS=Mus musculus OX=10090 GN=Pde7b PE=1 SV=1)

HSP 1 Score: 287.73 bits (735), Expect = 2.958e-87
Identity = 138/324 (42.59%), Postives = 205/324 (63.27%), Query Frame = 2
Query:  692 LIDMKQYPSIKMILNSIDNWDFNIFALERFTSGTPLTYLSIHLFEKHNLIQHFQLDISMVFQFLVTIERSYHQSNPYHNALHAADVTQAINCIIQDKQIFGQLTSQDILCSLLSTICHDVDHPGLNNMFLINSNHHLSILYKKQSILENHHWAFSLSVLRQTNLFLHFDKDLWKQVTNTCGSLIRATDISKQNAYLSDFNKILLSKDSPINEPLNEEQKILVLQMAIKCADICNPCRRWDICNCWAYLVTEEFFQQGDKEKALLLPISPIMDREKSKQAVVQRDFIKFLVLPLFTVWHQFI-ESNLSRNILDLIDSNKNMWQQL 1660
            L+D       + +L+ +  WDF+IF  +R T+G  L  L  HLF  H LI HF+LD+  + +FLV ++  YH  NPYHNA+HAADVTQA++C +++ ++   LT  DI+  LL+   HDVDHPG+N  FLI +NHHL+ LY+  S+LENHHW  ++ +LR++ L  H  K++ + +    GSLI ATDI++QN +L+     L +KD  +    N + +  +LQ+A+KCADICNPCR W++   W+  V EEF++QGD E+   L ISP+ +++K     +Q  F+ ++V PLF  W +F   S LS N+L  +  NK  W+ L
Sbjct:   96 LLDEDYLGQARHMLSKVGTWDFDIFLFDRLTNGNSLVTLLCHLFNSHGLIHHFKLDMVTLHRFLVMVQEDYHGHNPYHNAVHAADVTQAMHCYLKEPKLASFLTPLDIMLGLLAAAAHDVDHPGVNQPFLIKTNHHLANLYQNMSVLENHHWRSTIGMLRESRLLAHLPKEMTQDIEQQLGSLILATDINRQNEFLTRLKAHLHNKDLRLE---NVQDRHFMLQIALKCADICNPCRIWEMSKQWSERVCEEFYRQGDLEQKFELEISPLCNQQKDSIPSIQIGFMTYIVEPLFREWARFTGNSTLSENMLSHLAHNKAQWKSL 416          
BLAST of Phosphodiesterase vs. UniProt/SwissProt
Match: sp|Q9NP56|PDE7B_HUMAN (cAMP-specific 3',5'-cyclic phosphodiesterase 7B OS=Homo sapiens OX=9606 GN=PDE7B PE=1 SV=1)

HSP 1 Score: 285.034 bits (728), Expect = 3.937e-86
Identity = 136/324 (41.98%), Postives = 204/324 (62.96%), Query Frame = 2
Query:  692 LIDMKQYPSIKMILNSIDNWDFNIFALERFTSGTPLTYLSIHLFEKHNLIQHFQLDISMVFQFLVTIERSYHQSNPYHNALHAADVTQAINCIIQDKQIFGQLTSQDILCSLLSTICHDVDHPGLNNMFLINSNHHLSILYKKQSILENHHWAFSLSVLRQTNLFLHFDKDLWKQVTNTCGSLIRATDISKQNAYLSDFNKILLSKDSPINEPLNEEQKILVLQMAIKCADICNPCRRWDICNCWAYLVTEEFFQQGDKEKALLLPISPIMDREKSKQAVVQRDFIKFLVLPLFTVWHQFI-ESNLSRNILDLIDSNKNMWQQL 1660
            L+D       + +L+ +  WDF+IF  +R T+G  L  L  HLF  H LI HF+LD+  + +FLV ++  YH  NPYHNA+HAADVTQA++C +++ ++   LT  DI+  LL+   HDVDHPG+N  FLI +NHHL+ LY+  S+LENHHW  ++ +LR++ L  H  K++ + +    GSLI ATDI++QN +L+     L +KD  + +    + +  +LQ+A+KCADICNPCR W++   W+  V EEF++QG+ E+   L ISP+ +++K     +Q  F+ ++V PLF  W  F   S LS N+L  +  NK  W+ L
Sbjct:   96 LLDEDYLGQARHMLSKVGMWDFDIFLFDRLTNGNSLVTLLCHLFNTHGLIHHFKLDMVTLHRFLVMVQEDYHSQNPYHNAVHAADVTQAMHCYLKEPKLASFLTPLDIMLGLLAAAAHDVDHPGVNQPFLIKTNHHLANLYQNMSVLENHHWRSTIGMLRESRLLAHLPKEMTQDIEQQLGSLILATDINRQNEFLTRLKAHLHNKDLRLEDA---QDRHFMLQIALKCADICNPCRIWEMSKQWSERVCEEFYRQGELEQKFELEISPLCNQQKDSIPSIQIGFMSYIVEPLFREWAHFTGNSTLSENMLGHLAHNKAQWKSL 416          
BLAST of Phosphodiesterase vs. TrEMBL
Match: A0A452UEN9 (Phosphodiesterase OS=Ursus maritimus OX=29073 GN=PDE7A PE=3 SV=1)

HSP 1 Score: 308.531 bits (789), Expect = 6.894e-93
Identity = 150/335 (44.78%), Postives = 214/335 (63.88%), Query Frame = 2
Query:  722 KMILNSIDNWDFNIFALERFTSGTPLTYLSIHLFEKHNLIQHFQLDISMVFQFLVTIERSYHQSNPYHNALHAADVTQAINCIIQDKQIFGQLTSQDILCSLLSTICHDVDHPGLNNMFLINSNHHLSILYKKQSILENHHWAFSLSVLRQTNLFLHFDKDLWKQVTNTCGSLIRATDISKQNAYLSDFNKILLSKDSPINEPLNEEQKILVLQMAIKCADICNPCRRWDICNCWAYLVTEEFFQQGDKEKALLLPISPIMDREKSKQAVVQRDFIKFLVLPLFTVWHQFIESNLSRNILDLIDSNKNMWQQL---------SDLSTPEFNSIIL 1699
            K +L  + NW+F+IF  +R T+G  L  L+ HLF  H LI++F LD+  + +FLV I+  YH  NPYHNA+HAADVTQA++C +++ ++ G +T  D+L SL++   HD+DHPG+N  FLI +NH+L+ LYK  S+LENHHW  ++ +LR++ LF H   +  +Q+    G+LI ATDIS+QN YLS F   L   D  + +      + LVLQMA+KCADICNPCR W++   W+  VTEEFF QGD EK   L +SP+ DR+    A +Q  F+ +LV PLFT W +F ++ LS+ +L  +  NK  W+ L         +D +  E NS +L
Sbjct:   83 KCMLEKVGNWNFDIFLFDRLTNGNSLVSLTFHLFSLHGLIEYFHLDMMKLRRFLVMIQEDYHSQNPYHNAVHAADVTQAMHCYLKEPKLAGSVTPWDVLLSLIAAATHDLDHPGVNQPFLIKTNHYLATLYKNTSVLENHHWRSAVGLLRESGLFSHMPSESRQQMETQIGALILATDISRQNEYLSLFRSHLDRGDLSLEDA---RHRHLVLQMALKCADICNPCRTWELSKQWSEKVTEEFFHQGDLEKKYHLGVSPLCDRQTESIANIQIGFMTYLVEPLFTEWARFSDTRLSQTMLGHMGLNKASWKGLQREQSTSEDTDAAFEELNSQLL 414          
BLAST of Phosphodiesterase vs. TrEMBL
Match: A0A452UEP2 (Phosphodiesterase OS=Ursus maritimus OX=29073 GN=PDE7A PE=3 SV=1)

HSP 1 Score: 308.531 bits (789), Expect = 8.434e-93
Identity = 150/335 (44.78%), Postives = 214/335 (63.88%), Query Frame = 2
Query:  722 KMILNSIDNWDFNIFALERFTSGTPLTYLSIHLFEKHNLIQHFQLDISMVFQFLVTIERSYHQSNPYHNALHAADVTQAINCIIQDKQIFGQLTSQDILCSLLSTICHDVDHPGLNNMFLINSNHHLSILYKKQSILENHHWAFSLSVLRQTNLFLHFDKDLWKQVTNTCGSLIRATDISKQNAYLSDFNKILLSKDSPINEPLNEEQKILVLQMAIKCADICNPCRRWDICNCWAYLVTEEFFQQGDKEKALLLPISPIMDREKSKQAVVQRDFIKFLVLPLFTVWHQFIESNLSRNILDLIDSNKNMWQQL---------SDLSTPEFNSIIL 1699
            K +L  + NW+F+IF  +R T+G  L  L+ HLF  H LI++F LD+  + +FLV I+  YH  NPYHNA+HAADVTQA++C +++ ++ G +T  D+L SL++   HD+DHPG+N  FLI +NH+L+ LYK  S+LENHHW  ++ +LR++ LF H   +  +Q+    G+LI ATDIS+QN YLS F   L   D  + +      + LVLQMA+KCADICNPCR W++   W+  VTEEFF QGD EK   L +SP+ DR+    A +Q  F+ +LV PLFT W +F ++ LS+ +L  +  NK  W+ L         +D +  E NS +L
Sbjct:   92 KCMLEKVGNWNFDIFLFDRLTNGNSLVSLTFHLFSLHGLIEYFHLDMMKLRRFLVMIQEDYHSQNPYHNAVHAADVTQAMHCYLKEPKLAGSVTPWDVLLSLIAAATHDLDHPGVNQPFLIKTNHYLATLYKNTSVLENHHWRSAVGLLRESGLFSHMPSESRQQMETQIGALILATDISRQNEYLSLFRSHLDRGDLSLEDA---RHRHLVLQMALKCADICNPCRTWELSKQWSEKVTEEFFHQGDLEKKYHLGVSPLCDRQTESIANIQIGFMTYLVEPLFTEWARFSDTRLSQTMLGHMGLNKASWKGLQREQSTSEDTDAAFEELNSQLL 423          
BLAST of Phosphodiesterase vs. TrEMBL
Match: A0A384DDY4 (Phosphodiesterase OS=Ursus maritimus OX=29073 GN=PDE7A PE=3 SV=1)

HSP 1 Score: 309.686 bits (792), Expect = 1.042e-92
Identity = 150/335 (44.78%), Postives = 214/335 (63.88%), Query Frame = 2
Query:  722 KMILNSIDNWDFNIFALERFTSGTPLTYLSIHLFEKHNLIQHFQLDISMVFQFLVTIERSYHQSNPYHNALHAADVTQAINCIIQDKQIFGQLTSQDILCSLLSTICHDVDHPGLNNMFLINSNHHLSILYKKQSILENHHWAFSLSVLRQTNLFLHFDKDLWKQVTNTCGSLIRATDISKQNAYLSDFNKILLSKDSPINEPLNEEQKILVLQMAIKCADICNPCRRWDICNCWAYLVTEEFFQQGDKEKALLLPISPIMDREKSKQAVVQRDFIKFLVLPLFTVWHQFIESNLSRNILDLIDSNKNMWQQL---------SDLSTPEFNSIIL 1699
            K +L  + NW+F+IF  +R T+G  L  L+ HLF  H LI++F LD+  + +FLV I+  YH  NPYHNA+HAADVTQA++C +++ ++ G +T  D+L SL++   HD+DHPG+N  FLI +NH+L+ LYK  S+LENHHW  ++ +LR++ LF H   +  +Q+    G+LI ATDIS+QN YLS F   L   D  + +      + LVLQMA+KCADICNPCR W++   W+  VTEEFF QGD EK   L +SP+ DR+    A +Q  F+ +LV PLFT W +F ++ LS+ +L  +  NK  W+ L         +D +  E NS +L
Sbjct:  138 KCMLEKVGNWNFDIFLFDRLTNGNSLVSLTFHLFSLHGLIEYFHLDMMKLRRFLVMIQEDYHSQNPYHNAVHAADVTQAMHCYLKEPKLAGSVTPWDVLLSLIAAATHDLDHPGVNQPFLIKTNHYLATLYKNTSVLENHHWRSAVGLLRESGLFSHMPSESRQQMETQIGALILATDISRQNEYLSLFRSHLDRGDLSLEDA---RHRHLVLQMALKCADICNPCRTWELSKQWSEKVTEEFFHQGDLEKKYHLGVSPLCDRQTESIANIQIGFMTYLVEPLFTEWARFSDTRLSQTMLGHMGLNKASWKGLQREQSTSEDTDAAFEELNSQLL 469          
BLAST of Phosphodiesterase vs. TrEMBL
Match: A0A452Q9S2 (Phosphodiesterase OS=Ursus americanus OX=9643 GN=PDE7A PE=3 SV=1)

HSP 1 Score: 308.531 bits (789), Expect = 1.305e-92
Identity = 150/335 (44.78%), Postives = 214/335 (63.88%), Query Frame = 2
Query:  722 KMILNSIDNWDFNIFALERFTSGTPLTYLSIHLFEKHNLIQHFQLDISMVFQFLVTIERSYHQSNPYHNALHAADVTQAINCIIQDKQIFGQLTSQDILCSLLSTICHDVDHPGLNNMFLINSNHHLSILYKKQSILENHHWAFSLSVLRQTNLFLHFDKDLWKQVTNTCGSLIRATDISKQNAYLSDFNKILLSKDSPINEPLNEEQKILVLQMAIKCADICNPCRRWDICNCWAYLVTEEFFQQGDKEKALLLPISPIMDREKSKQAVVQRDFIKFLVLPLFTVWHQFIESNLSRNILDLIDSNKNMWQQL---------SDLSTPEFNSIIL 1699
            K +L  + NW+F+IF  +R T+G  L  L+ HLF  H LI++F LD+  + +FLV I+  YH  NPYHNA+HAADVTQA++C +++ ++ G +T  D+L SL++   HD+DHPG+N  FLI +NH+L+ LYK  S+LENHHW  ++ +LR++ LF H   +  +Q+    G+LI ATDIS+QN YLS F   L   D  + +      + LVLQMA+KCADICNPCR W++   W+  VTEEFF QGD EK   L +SP+ DR+    A +Q  F+ +LV PLFT W +F ++ LS+ +L  +  NK  W+ L         +D +  E NS +L
Sbjct:  112 KCMLEKVGNWNFDIFLFDRLTNGNSLVSLTFHLFSLHGLIEYFHLDMMKLRRFLVMIQEDYHSQNPYHNAVHAADVTQAMHCYLKEPKLAGSVTPWDVLLSLIAAATHDLDHPGVNQPFLIKTNHYLATLYKNTSVLENHHWRSAVGLLRESGLFSHMPSESRQQMETQIGALILATDISRQNEYLSLFRSHLDRGDLSLEDA---RHRHLVLQMALKCADICNPCRTWELSKQWSEKVTEEFFHQGDLEKKYHLGVSPLCDRQTESIANIQIGFMTYLVEPLFTEWARFSDTRLSQTMLGHMGLNKASWKGLQREQSTSEDTDAAFEELNSQLL 443          
BLAST of Phosphodiesterase vs. TrEMBL
Match: A0A452UET9 (Phosphodiesterase OS=Ursus maritimus OX=29073 GN=PDE7A PE=3 SV=1)

HSP 1 Score: 308.531 bits (789), Expect = 1.510e-92
Identity = 150/335 (44.78%), Postives = 214/335 (63.88%), Query Frame = 2
Query:  722 KMILNSIDNWDFNIFALERFTSGTPLTYLSIHLFEKHNLIQHFQLDISMVFQFLVTIERSYHQSNPYHNALHAADVTQAINCIIQDKQIFGQLTSQDILCSLLSTICHDVDHPGLNNMFLINSNHHLSILYKKQSILENHHWAFSLSVLRQTNLFLHFDKDLWKQVTNTCGSLIRATDISKQNAYLSDFNKILLSKDSPINEPLNEEQKILVLQMAIKCADICNPCRRWDICNCWAYLVTEEFFQQGDKEKALLLPISPIMDREKSKQAVVQRDFIKFLVLPLFTVWHQFIESNLSRNILDLIDSNKNMWQQL---------SDLSTPEFNSIIL 1699
            K +L  + NW+F+IF  +R T+G  L  L+ HLF  H LI++F LD+  + +FLV I+  YH  NPYHNA+HAADVTQA++C +++ ++ G +T  D+L SL++   HD+DHPG+N  FLI +NH+L+ LYK  S+LENHHW  ++ +LR++ LF H   +  +Q+    G+LI ATDIS+QN YLS F   L   D  + +      + LVLQMA+KCADICNPCR W++   W+  VTEEFF QGD EK   L +SP+ DR+    A +Q  F+ +LV PLFT W +F ++ LS+ +L  +  NK  W+ L         +D +  E NS +L
Sbjct:  113 KCMLEKVGNWNFDIFLFDRLTNGNSLVSLTFHLFSLHGLIEYFHLDMMKLRRFLVMIQEDYHSQNPYHNAVHAADVTQAMHCYLKEPKLAGSVTPWDVLLSLIAAATHDLDHPGVNQPFLIKTNHYLATLYKNTSVLENHHWRSAVGLLRESGLFSHMPSESRQQMETQIGALILATDISRQNEYLSLFRSHLDRGDLSLEDA---RHRHLVLQMALKCADICNPCRTWELSKQWSEKVTEEFFHQGDLEKKYHLGVSPLCDRQTESIANIQIGFMTYLVEPLFTEWARFSDTRLSQTMLGHMGLNKASWKGLQREQSTSEDTDAAFEELNSQLL 444          
BLAST of Phosphodiesterase vs. Ensembl Cavefish
Match: pde7a (phosphodiesterase 7A [Source:NCBI gene;Acc:103042481])

HSP 1 Score: 288.115 bits (736), Expect = 1.002e-88
Identity = 141/323 (43.65%), Postives = 204/323 (63.16%), Query Frame = 2
Query:  692 LIDMKQYPSIKMILNSIDNWDFNIFALERFTSGTPLTYLSIHLFEKHNLIQHFQLDISMVFQFLVTIERSYHQSNPYHNALHAADVTQAINCIIQDKQIFGQLTSQDILCSLLSTICHDVDHPGLNNMFLINSNHHLSILYKKQSILENHHWAFSLSVLRQTNLFLHFDKDLWKQVTNTCGSLIRATDISKQNAYLSDFNKILLSKDSPINEPLNEEQKILVLQMAIKCADICNPCRRWDICNCWAYLVTEEFFQQGDKEKALLLPISPIMDREKSKQAVVQRDFIKFLVLPLFTVWHQFIESNLSRNILDLIDSNKNMWQQL 1660
            ++D       K +L  + +W+F+IF  +R T+G  L  L+++L   + LI+ FQLD+  V +FLV ++  YH  NPYHNA+HAADVTQA++C +++ ++   LTS DIL  LL+   HD+DHPG+N  FLI +NH+L++LY+  S+LENHHW  ++ +LR+T L  H   +    +    GSLI ATDIS+QN YLS F   L  +D  +    N   +  +LQMA+KCADICNPCR W++   W+  VTEEFF QGD EK   L +SP+ D E +  A VQ  F+ ++V PLF  W +F ++ LS+ +L  +  NK  W  +
Sbjct:   73 ILDEDYCGQAKCMLEKVGSWNFDIFLFDRLTNGNSLVTLTLYLLSHYGLIELFQLDMVKVHRFLVLVQEDYHNHNPYHNAVHAADVTQAMHCYLKEPKLAKSLTSCDILLGLLAAATHDLDHPGVNQPFLIKTNHYLAVLYRNTSVLENHHWRSAVGLLRETELLSHLPAEDRLTMERQLGSLILATDISRQNEYLSKFRTHLDQEDLCLG---NASHRHFILQMALKCADICNPCRPWELSKQWSEKVTEEFFHQGDIEKKHKLEVSPLCDSENNSIADVQIGFMTYVVEPLFAEWARFSDTRLSQTMLGHLCLNKASWNAM 392          
BLAST of Phosphodiesterase vs. Ensembl Cavefish
Match: pde7a (phosphodiesterase 7A [Source:NCBI gene;Acc:103042481])

HSP 1 Score: 288.115 bits (736), Expect = 1.695e-88
Identity = 141/323 (43.65%), Postives = 204/323 (63.16%), Query Frame = 2
Query:  692 LIDMKQYPSIKMILNSIDNWDFNIFALERFTSGTPLTYLSIHLFEKHNLIQHFQLDISMVFQFLVTIERSYHQSNPYHNALHAADVTQAINCIIQDKQIFGQLTSQDILCSLLSTICHDVDHPGLNNMFLINSNHHLSILYKKQSILENHHWAFSLSVLRQTNLFLHFDKDLWKQVTNTCGSLIRATDISKQNAYLSDFNKILLSKDSPINEPLNEEQKILVLQMAIKCADICNPCRRWDICNCWAYLVTEEFFQQGDKEKALLLPISPIMDREKSKQAVVQRDFIKFLVLPLFTVWHQFIESNLSRNILDLIDSNKNMWQQL 1660
            ++D       K +L  + +W+F+IF  +R T+G  L  L+++L   + LI+ FQLD+  V +FLV ++  YH  NPYHNA+HAADVTQA++C +++ ++   LTS DIL  LL+   HD+DHPG+N  FLI +NH+L++LY+  S+LENHHW  ++ +LR+T L  H   +    +    GSLI ATDIS+QN YLS F   L  +D  +    N   +  +LQMA+KCADICNPCR W++   W+  VTEEFF QGD EK   L +SP+ D E +  A VQ  F+ ++V PLF  W +F ++ LS+ +L  +  NK  W  +
Sbjct:   84 ILDEDYCGQAKCMLEKVGSWNFDIFLFDRLTNGNSLVTLTLYLLSHYGLIELFQLDMVKVHRFLVLVQEDYHNHNPYHNAVHAADVTQAMHCYLKEPKLAKSLTSCDILLGLLAAATHDLDHPGVNQPFLIKTNHYLAVLYRNTSVLENHHWRSAVGLLRETELLSHLPAEDRLTMERQLGSLILATDISRQNEYLSKFRTHLDQEDLCLG---NASHRHFILQMALKCADICNPCRPWELSKQWSEKVTEEFFHQGDIEKKHKLEVSPLCDSENNSIADVQIGFMTYVVEPLFAEWARFSDTRLSQTMLGHLCLNKASWNAM 403          
BLAST of Phosphodiesterase vs. Ensembl Cavefish
Match: pde7a (phosphodiesterase 7A [Source:NCBI gene;Acc:103042481])

HSP 1 Score: 288.886 bits (738), Expect = 5.886e-88
Identity = 140/313 (44.73%), Postives = 201/313 (64.22%), Query Frame = 2
Query:  722 KMILNSIDNWDFNIFALERFTSGTPLTYLSIHLFEKHNLIQHFQLDISMVFQFLVTIERSYHQSNPYHNALHAADVTQAINCIIQDKQIFGQLTSQDILCSLLSTICHDVDHPGLNNMFLINSNHHLSILYKKQSILENHHWAFSLSVLRQTNLFLHFDKDLWKQVTNTCGSLIRATDISKQNAYLSDFNKILLSKDSPINEPLNEEQKILVLQMAIKCADICNPCRRWDICNCWAYLVTEEFFQQGDKEKALLLPISPIMDREKSKQAVVQRDFIKFLVLPLFTVWHQFIESNLSRNILDLIDSNKNMWQQL 1660
            K +L  + +W+F+IF  +R T+G  L  L+++L   + LI+ FQLD+  V +FLV ++  YH  NPYHNA+HAADVTQA++C +++ ++   LTS DIL  LL+   HD+DHPG+N  FLI +NH+L++LY+  S+LENHHW  ++ +LR+T L  H   +    +    GSLI ATDIS+QN YLS F   L  +D  +    N   +  +LQMA+KCADICNPCR W++   W+  VTEEFF QGD EK   L +SP+ D E +  A VQ  F+ ++V PLF  W +F ++ LS+ +L  +  NK  W  +
Sbjct:  158 KCMLEKVGSWNFDIFLFDRLTNGNSLVTLTLYLLSHYGLIELFQLDMVKVHRFLVLVQEDYHNHNPYHNAVHAADVTQAMHCYLKEPKLAKSLTSCDILLGLLAAATHDLDHPGVNQPFLIKTNHYLAVLYRNTSVLENHHWRSAVGLLRETELLSHLPAEDRLTMERQLGSLILATDISRQNEYLSKFRTHLDQEDLCLG---NASHRHFILQMALKCADICNPCRPWELSKQWSEKVTEEFFHQGDIEKKHKLEVSPLCDSENNSIADVQIGFMTYVVEPLFAEWARFSDTRLSQTMLGHLCLNKASWNAM 467          
BLAST of Phosphodiesterase vs. Ensembl Cavefish
Match: pde7a (phosphodiesterase 7A [Source:NCBI gene;Acc:103042481])

HSP 1 Score: 287.345 bits (734), Expect = 1.029e-87
Identity = 140/313 (44.73%), Postives = 201/313 (64.22%), Query Frame = 2
Query:  722 KMILNSIDNWDFNIFALERFTSGTPLTYLSIHLFEKHNLIQHFQLDISMVFQFLVTIERSYHQSNPYHNALHAADVTQAINCIIQDKQIFGQLTSQDILCSLLSTICHDVDHPGLNNMFLINSNHHLSILYKKQSILENHHWAFSLSVLRQTNLFLHFDKDLWKQVTNTCGSLIRATDISKQNAYLSDFNKILLSKDSPINEPLNEEQKILVLQMAIKCADICNPCRRWDICNCWAYLVTEEFFQQGDKEKALLLPISPIMDREKSKQAVVQRDFIKFLVLPLFTVWHQFIESNLSRNILDLIDSNKNMWQQL 1660
            K +L  + +W+F+IF  +R T+G  L  L+++L   + LI+ FQLD+  V +FLV ++  YH  NPYHNA+HAADVTQA++C +++ ++   LTS DIL  LL+   HD+DHPG+N  FLI +NH+L++LY+  S+LENHHW  ++ +LR+T L  H   +    +    GSLI ATDIS+QN YLS F   L  +D  +    N   +  +LQMA+KCADICNPCR W++   W+  VTEEFF QGD EK   L +SP+ D E +  A VQ  F+ ++V PLF  W +F ++ LS+ +L  +  NK  W  +
Sbjct:  132 KCMLEKVGSWNFDIFLFDRLTNGNSLVTLTLYLLSHYGLIELFQLDMVKVHRFLVLVQEDYHNHNPYHNAVHAADVTQAMHCYLKEPKLAKSLTSCDILLGLLAAATHDLDHPGVNQPFLIKTNHYLAVLYRNTSVLENHHWRSAVGLLRETELLSHLPAEDRLTMERQLGSLILATDISRQNEYLSKFRTHLDQEDLCLG---NASHRHFILQMALKCADICNPCRPWELSKQWSEKVTEEFFHQGDIEKKHKLEVSPLCDSENNSIADVQIGFMTYVVEPLFAEWARFSDTRLSQTMLGHLCLNKASWNAM 441          
BLAST of Phosphodiesterase vs. Ensembl Cavefish
Match: pde7a (phosphodiesterase 7A [Source:NCBI gene;Acc:103042481])

HSP 1 Score: 286.574 bits (732), Expect = 1.374e-87
Identity = 141/323 (43.65%), Postives = 204/323 (63.16%), Query Frame = 2
Query:  692 LIDMKQYPSIKMILNSIDNWDFNIFALERFTSGTPLTYLSIHLFEKHNLIQHFQLDISMVFQFLVTIERSYHQSNPYHNALHAADVTQAINCIIQDKQIFGQLTSQDILCSLLSTICHDVDHPGLNNMFLINSNHHLSILYKKQSILENHHWAFSLSVLRQTNLFLHFDKDLWKQVTNTCGSLIRATDISKQNAYLSDFNKILLSKDSPINEPLNEEQKILVLQMAIKCADICNPCRRWDICNCWAYLVTEEFFQQGDKEKALLLPISPIMDREKSKQAVVQRDFIKFLVLPLFTVWHQFIESNLSRNILDLIDSNKNMWQQL 1660
            ++D       K +L  + +W+F+IF  +R T+G  L  L+++L   + LI+ FQLD+  V +FLV ++  YH  NPYHNA+HAADVTQA++C +++ ++   LTS DIL  LL+   HD+DHPG+N  FLI +NH+L++LY+  S+LENHHW  ++ +LR+T L  H   +    +    GSLI ATDIS+QN YLS F   L  +D  +    N   +  +LQMA+KCADICNPCR W++   W+  VTEEFF QGD EK   L +SP+ D E +  A VQ  F+ ++V PLF  W +F ++ LS+ +L  +  NK  W  +
Sbjct:  115 ILDEDYCGQAKCMLEKVGSWNFDIFLFDRLTNGNSLVTLTLYLLSHYGLIELFQLDMVKVHRFLVLVQEDYHNHNPYHNAVHAADVTQAMHCYLKEPKLAKSLTSCDILLGLLAAATHDLDHPGVNQPFLIKTNHYLAVLYRNTSVLENHHWRSAVGLLRETELLSHLPAEDRLTMERQLGSLILATDISRQNEYLSKFRTHLDQEDLCLG---NASHRHFILQMALKCADICNPCRPWELSKQWSEKVTEEFFHQGDIEKKHKLEVSPLCDSENNSIADVQIGFMTYVVEPLFAEWARFSDTRLSQTMLGHLCLNKASWNAM 434          
BLAST of Phosphodiesterase vs. Ensembl Sea Lamprey
Match: pde7a (phosphodiesterase 7A [Source:ZFIN;Acc:ZDB-GENE-031222-10])

HSP 1 Score: 280.411 bits (716), Expect = 1.859e-87
Identity = 139/313 (44.41%), Postives = 192/313 (61.34%), Query Frame = 2
Query:  728 ILNSIDNWDFNIFALERFTSGTPLTYLSIHLFEKHNLIQHFQLDISMVFQFLVTIERSYHQSNPYHNALHAADVTQAINCIIQDKQIFGQLTSQDILCSLLSTICHDVDHPGLNNMFLINSNHHLSILYKKQSILENHHWAFSLSVLRQTNLFLHFDKDLWKQVTNTCGSLIRATDISKQNAYLSDFNKILLSKDSPINEPLNEEQKILVLQMAIKCADICNPCRRWDICNCWAYLVTEEFFQQGDKEKALLLPISPIMDREKSKQAVVQRDFIKFLVLPLFTVWHQFIESNLSRNILDLIDSNKNMWQQLSD 1666
            +L    +W F++F  +R T+G  L  L+ HLF  H LIQHFQLD+  +  FLV ++  YH  NPYHNA+HAADVTQA++C +++ ++   LT +DI+  LL+   HDVDHPG+N  FLI ++HHL+ LY   S+LENHHW  ++ +LR++ LF H   D   Q+    GSLI ATDIS+QN +LS F   L   D  + E      +  +LQ+A+KCADICNPCR WD    W+  V EEFF+QGD E+   L ISP+ DR       +Q  F+ F+V PLF  W +F+       +L  +  NK  W+ L +
Sbjct:    1 MLMKAASWSFDMFLFDRLTNGNSLVSLTCHLFNFHGLIQHFQLDMVKLRGFLVMVQEDYHNQNPYHNAVHAADVTQAMHCYLREPKLAVHLTRRDIMLGLLAASAHDVDHPGVNQPFLIKTHHHLASLYHNSSVLENHHWRSTVGMLRESGLFAHLPMDERLQMERDLGSLILATDISRQNEFLSQFKSHLDKGDLCLEEA---PHRHFILQIALKCADICNPCRVWDTSKRWSEKVCEEFFKQGDMERKWRLEISPLCDRYTQTVPNIQIGFMTFVVEPLFMEWARFMGYTHLSPMLGHLGLNKASWRGLQN 310          
BLAST of Phosphodiesterase vs. Ensembl Sea Lamprey
Match: pde8a (phosphodiesterase 8A [Source:ZFIN;Acc:ZDB-GENE-070112-622])

HSP 1 Score: 199.519 bits (506), Expect = 1.976e-54
Identity = 109/343 (31.78%), Postives = 177/343 (51.60%), Query Frame = 2
Query:  713 PSIKMILNSIDNWDFNIFALERFTSGTPLTYLSIHLFEKHNLIQHFQLDISMVFQFLVTIERSYHQSNPYHNALHAADVTQAINCIIQDKQIFGQLTSQDILCSLLSTICHDVDHPGLNNMFLINSNHHLSILYKKQSILENHH--WAFSLSVL-RQTNLFLHFDKDLWKQVTNTCGSLIRATDISKQ----NAYLSDFNKILLSKDSPINEPLN-----------------EEQKILVLQMAIKCADICNPCRRWDICNCWAYLVTEEFFQQGDKEKALLLPIS-PIMDREKSKQAVVQRDFIKFLVLPLFTVWHQFIESNLSRNILDLIDSNKNMWQQLSD 1666
            P +  IL++ + WDF+IF LE  T   PL YL + +F +  +        + +  +L  IE +YH SN YHN+ HAADV  A    ++ +++   L   D + +L++   HDVDHPG  N FL N+   L++LY   ++LE+HH   AF LS+  R  N+F + D+  ++ +      ++ AT+++K     N +++  NK+  +  +  +  LN                  E ++LV +M IKCAD+CNPCR   +C  WA  ++EE+F Q D+EK   LP+  P+ DR        Q  FI + +  +F  W  + E     N++  + +N   W+ L D
Sbjct:  331 PCVAFILDAEETWDFDIFELESSTHARPLVYLGLKVFARFGVCDFLGCSEATLRAWLSLIEANYHSSNSYHNSTHAADVLHATAYFLRKERVKSCLDQADEVAALIAATVHDVDHPGRTNSFLCNAGSELAVLYNDTAVLESHHAALAFQLSMRDRAANIFRNMDRSEFRTLRQAIIDMVLATEMTKHFEHVNKFVNSVNKMAAAGSTGDSVSLNGSSSEDDSGGGPGPPSTPEMRLLVKRMLIKCADVCNPCRPLALCVEWAGRISEEYFAQTDEEKRKGLPVVMPVFDRCSCSVPKSQISFIDYFITDMFDAWDAYAELP---NLMQHLSTNYRYWKALDD 670          
BLAST of Phosphodiesterase vs. Ensembl Sea Lamprey
Match: PDE1C (phosphodiesterase 1C [Source:HGNC Symbol;Acc:HGNC:8776])

HSP 1 Score: 170.629 bits (431), Expect = 3.688e-46
Identity = 94/308 (30.52%), Postives = 160/308 (51.95%), Query Frame = 2
Query:  671 KMYSY-KGLIDMKQYPSIKMILNSIDNWDFNIFALERFTSGTPLTYLSIHLFEKHNLIQHFQLDISMVFQFLVTIERSYHQ-SNPYHNALHAADVTQAINCIIQDKQIFGQLTSQDILCSLLSTICHDVDHPGLNNMFLINSNHHLSILYKKQSILENHHWAFSLSVLR---QTNLFLHFDKDLWKQVTNTCGSLIRATDISKQNAYLSDFNKILLSKDSPINEPLNEEQKILVLQMAIKCADICNPCRRWDICNCWAYLVTEEFFQQGDKEKALLLPISPIMDREKSKQAVVQRDFIKFLVLPLFTV 1579
            +MY     ++ +   P++  +L  +D W F++FAL   +    L ++   LF +++LI  F++ +S V  F+  +E  Y +  NPYHN++HAADVTQ ++ ++        L   +IL  + +   HD +H G  N F I +    +ILY  +S+LENHH + +  +++   + N+ ++  KD W+++       + ATD+S     L    K LL +   + +P         + + +  ADI +P + W++   W   + EEFF+QGDKE  L L  SP+ DR  +     Q  FI ++V P FTV
Sbjct:  117 RMYRRTSSMVGLSYPPAVISVLKEVDKWSFDVFALHEASGEHALKFIVYELFTRYDLIARFKIPVSSVVSFVEALEAGYSKHKNPYHNSVHAADVTQTVHYLMLKTGTIHWLNELEILSMIFAAAIHDYEHTGTTNNFHIQTRSDSAILYNDRSVLENHHVSAAYRLMQEDEEMNILINLSKDDWRELRALVVETVLATDMSCHFHQLKSI-KNLLQQPEGVEKP-------KAMSLMLHTADISHPAKNWNLHRRWTMSLMEEFFRQGDKEAELGLSFSPLCDRNATMVPQSQIGFIDYIVEPTFTV 416          
BLAST of Phosphodiesterase vs. Ensembl Sea Lamprey
Match: pde1a (phosphodiesterase 1A, calmodulin-dependent [Source:ZFIN;Acc:ZDB-GENE-090831-2])

HSP 1 Score: 154.066 bits (388), Expect = 6.869e-40
Identity = 86/309 (27.83%), Postives = 161/309 (52.10%), Query Frame = 2
Query:  671 KMYSYKG-LIDMKQYPSIKMILN--SIDNWDFNIFALERFTSGTPLTYLSIHLFEKHNLIQHFQLDISMVFQFLVTIERSYHQ-SNPYHNALHAADVTQAINCIIQDKQIFGQLTSQDILCSLLSTICHDVDHPGLNNMFLINSNHHLSILYKKQSILENHHWAFSLSVLR--QTNLFLHFDKDLWKQVTNTCGSLIRATDISKQNAYLSDFNKILLSKDSPINEPLNEEQKILVLQMAIKCADICNPCRRWDICNCWAYLVTEEFFQQGDKEKALLLPISPIMDREKSKQAVVQRDFIKFLVLPLFTV 1579
            +MY     ++ +   P++ + L   +   W F++F L   +    L ++   L  ++ LI  +++ ++ +  F+  +E  Y +  NPYHN  HAADVTQ ++ ++    +   L+  + L  + +   HD++H G  N F I +   +++LY  +++LENHH + +  +++    N+F++  KD W+++      ++ ATD+S        F +I   K S + +P + + K   + + +   DI +P + W +   W   + EEFF+QGD+E  L LP SP+ DR  +  A  Q  F+ F+V P F+V
Sbjct:  124 RMYRRTSNMVGLSYPPNVLVALKNWTCHKWSFDVFVLNEASGEHALKFVMHELLTRYELISRYKIPVAALVSFVEALEAGYSKHKNPYHNLAHAADVTQTVHYLLLQSGLMHWLSELETLAVIFAAAIHDLEHTGTTNNFHIQTRSDVALLYNDRAVLENHHVSAAYRLMQDDDMNIFINLSKDDWRELRALVVEMVLATDMS------CHFQQIKTMK-SALQQPESID-KSKAMSLLLHAGDISHPTKEWPLHQRWTEALMEEFFRQGDREAKLGLPFSPLCDRNSTMVAQSQIGFMDFIVEPTFSV 424          
BLAST of Phosphodiesterase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007435.1 (pep scaffold:Pmarinus_7.0:GL486982:1709:8825:-1 gene:ENSPMAG00000006710.1 transcript:ENSPMAT00000007435.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 120.553 bits (301), Expect = 2.250e-31
Identity = 64/186 (34.41%), Postives = 105/186 (56.45%), Query Frame = 2
Query:  998 LTSQDILCSLLSTICHDVDHPGLNNMFLINSNHHLSILYKKQSILENHHWAFSLSVLRQTN--LFLHFDKDLWKQVTNTCGSLIRATDISKQNAYLSDFNKILLSKDSPINEPL---NEEQKILVLQMAIKCADICNPCRRWDICNCWAYLVTEEFFQQGDKEKALLLPISPIMDREKSKQAVVQR 1540
             T  +IL ++ ++  HDVDHPG++N FLIN+N  L+++Y  +S+LENHH A    +L++ N  +F +  K   + +      ++ ATD+SK    L+D   ++ +K    +  L   N   +I VLQ  + CAD+ NP +  D+   W   + EEFF+QGD+E+   + ISP+ D+  +     QR
Sbjct:    8 FTDLEILAAIFASAIHDVDHPGVSNQFLINTNSELALMYNDESVLENHHLAVGFKLLQEENCDIFQNLSKKQRQTLRKMVIDMVLATDMSKHMNLLADLKTMVETKKVTSSGVLLLDNYTDRIQVLQNMVHCADLSNPTKPLDVYRQWTERIMEEFFRQGDRERERGMEISPMCDKHSASVEKSQR 193          
BLAST of Phosphodiesterase vs. Ensembl Yeast
Match: PDE2 (High-affinity cyclic AMP phosphodiesterase; component of the cAMP-dependent protein kinase signaling system, protects the cell from extracellular cAMP, contains readthrough motif surrounding termination codon [Source:SGD;Acc:S000005887])

HSP 1 Score: 78.1814 bits (191), Expect = 1.742e-15
Identity = 65/199 (32.66%), Postives = 91/199 (45.73%), Query Frame = 2
Query:  887 TIERSYHQSNPYHNALHAADVTQAI----NCIIQDKQIFGQLTSQDILCSLLSTICHDVDHPGLNNMFLINSNHHLSILYKKQSILENHHWAFSLSVLRQTNLFLHFDKDLWKQVTNTC-------GSLIRATDISKQNAYLSDFNKILLSKDSPINEPLNEEQKILVLQMAIKCADICNPCRRWDICNCWAYLVTEEF 1450
            T+E SYHQ N +HN  HA DV QA       +++D  +   L     LC  ++ I HDV HPG NN  L N    ++  +K  SILEN H            LF     + W Q+ +            I ATD++  + Y          +D  ++E  N  ++I ++ + IK ADI N  R   I   WAYL+T EF
Sbjct:  253 TLESSYHQVNKFHNFRHAIDVMQATWRLCTYLLKDNPVQTLL-----LC--MAAIGHDVGHPGTNNQLLCNCESEVAQNFKNVSILENFH----------RELFQQLLSEHWPQLLSISKKKFDFISEAILATDMALHSQY----------EDRLMHE--NPMKQITLISLIIKAADISNVTRTLSISARWAYLITLEF 422          
BLAST of Phosphodiesterase vs. Ensembl Nematostella
Match: EDO46133 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQM4])

HSP 1 Score: 183.341 bits (464), Expect = 9.586e-50
Identity = 98/341 (28.74%), Postives = 189/341 (55.43%), Query Frame = 2
Query:  668 TKMYSYKGLI-----DMKQYPSIKMILNSIDNWDFNIFALERFTSGTPLTYLSIHLFEKHNLIQHFQLDISMVFQFLVTIERSYHQSNPYHNALHAADVTQAINCIIQDKQIFGQLTSQDILCSLLSTICHDVDHPGLNNMFLINSNHHLSILYKKQSILENHHWAFSLSVLRQ--TNLFLHFDKDLWKQVTNTCGSLIRATDISKQNAYLSDFNKILLSK-----DSPINEPLNEEQKILVLQMAIKCADICNPCRRWDICNCWAYLVTEEFFQQGDKEKAL-LLPISPIMDREKSKQAVVQRDFIKFLVLPLFTVWHQFIESNLSRNILDLIDSNKNMW 1651
            T+++S+ G +     +++    +  IL +++ WDF+ FAL   T+G P+  +S  + +  +L++ F++  +    ++  +E  Y +  P+HN +HAADVTQ  + ++  +      T  +IL +++++  HDVDHPG+NN FL+ +N  ++++Y  +S+LENHH A +  +L+    ++F +  K   +        ++ ATD +K  + L+    ++ +K      S +    N   ++ VL+  + CAD+ NP +   I   W   + EEFF+QGDKE+ +  + ISP+MDR  +     Q  FI F+  PL+  W + ++ + ++++LD I+ N+  +
Sbjct:  180 TRLHSFSGSVPRFGVEVQNESELATILENVNKWDFDAFALGEATNGHPMLAVSYTILQARDLLKIFKIKPTTFINYMTLVENHYLKDVPFHNCIHAADVTQTAHVLLSAQAFDNVFTDLEILSAIIASAVHDVDHPGVNNHFLVATNSEMALMYNDESVLENHHLAVAFQLLQHEDCDIFENLSKQERQTARRMIIEMVLATDNAKHMSLLASLKTMVETKKVAGTGSGVLCLENYTDRMQVLKSLVHCADLSNPTKPLPIYRKWVDRLMEEFFRQGDKERDIDGMEISPMMDRHNASIEKSQVVFIDFVAQPLWETWGELVQPD-AQDLLDTIEDNRQWY 519          
BLAST of Phosphodiesterase vs. Ensembl Nematostella
Match: EDO32142 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVX8])

HSP 1 Score: 181.03 bits (458), Expect = 2.938e-47
Identity = 103/323 (31.89%), Postives = 167/323 (51.70%), Query Frame = 2
Query:  746 NWDFNIFALERFTSGTPLTYLSIHLFEKHNLIQHFQLDISMVFQFLVTIERSYHQSNPYHNALHAADVTQAINCIIQDKQIFGQLTSQDILCSLLSTICHDVDHPGLNNMFLINSNHHLSILYKKQSILENHHWAFSLSVLR---QTNLFLHFDKDLWKQVTNTCGSLIRATDISKQNAYLSDFNKIL------------LSKDSPINEPLNEEQKILVLQMAIKCADICNPCRRWDICNCWAYLVTEEFFQQGDKEKALLLPIS-PIMDREKSKQAVVQRDFIKFLVLPLFTVWHQFIESNLSRNILDLIDSNKNMWQQLSD 1666
            +WDF+I  LE+ ++  PL +L + +  +  + +   +    V  +L  IE +YH+ N YHN+ HAADV  A    +  +++   L   D + SL++ I HDVDHPG  N FL N+   L+ILY   ++LE+HH A +  +     ++N+F + D + ++ V      ++ AT++++   +LS F   +             S  + +N P   E + L+ +M IKCADI NP R   +C  WAY + EE+F Q D+EK   LP+  P+ DR        Q  FI + V  L+  W  F  + +   I  L D N + W++ +D
Sbjct:  522 DWDFDILKLEKASNHRPLYFLGLKILNRFRVCEKLNISEDYVKNWLQLIEANYHRKNAYHNSTHAADVLHATAVFLAKERVKAVLEPLDEVASLIAAIVHDVDHPGYTNSFLCNAGSELAILYNDIAVLESHHAALAFKLTARDDKSNIFSNLDVEEFRTVRQAIIDMVMATEMTRHFEHLSKFVNSINKRRSSSTPDSNTSTSTALNTP---ENRTLIKRMLIKCADIANPARPRYLCKEWAYRIAEEYFSQTDEEKRRGLPVVMPVFDRATCNVPRSQVWFIDYFVSDLYDAWDAF--AYVPETIRHLTD-NYDYWKKAAD 838          
BLAST of Phosphodiesterase vs. Ensembl Nematostella
Match: EDO37301 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGA1])

HSP 1 Score: 160.999 bits (406), Expect = 1.851e-43
Identity = 96/286 (33.57%), Postives = 150/286 (52.45%), Query Frame = 2
Query:  749 WDFNIFALERFTSGTPLTYLSIHLFEKHNLIQHFQLDISMVFQFLVTIERSYHQ-SNPYHNALHAADVTQAINCIIQDKQIFGQLTSQDILCSLLSTICHDVDHPGLNNMFLINSNHHLSILYKKQSILENHHWAFSLSVLR--QTNLFLHFDKDLWKQVTNTCGSLIRATDISKQNAYLSDFNKILLSKDSPINEPLNEEQKILVLQMAIKCADICNPCRRWDICNCWAYLVTEEFFQQGDKEKALLLPISPIMDREKSKQAVVQRDFIKFLVLPLFTVWHQFIE 1597
            W F++FAL     G PL Y+   +  + +++++F++    + +FL  +E  Y + SNPYHN  HAADVT  ++  ++   +   L+  ++   LLS I HD++H G  N F INS   L++LY  +S+LENHH + +  +L+  + N+    + + +  V +     + ATD+S     L    K+ L   SPI    N E    V+Q+ +  ADI NP + W I   W   + EEFF QGD E  L L +SP+ DR  +     Q  FI F+V P   V  + +E
Sbjct:   81 WTFDVFALSESCEGHPLRYIGYEVLHRRDMLRNFKIHAMTLDRFLQDVETGYKRHSNPYHNDCHAADVTHTVHYFLECMGVSKYLSDLEVFGLLLSAIIHDLEHTGTTNAFHINSRSDLALLYNDRSVLENHHVSCAFRILQDDEKNILSGLNLEQYADVRSLMIDTVLATDMSSHFEQLR-LMKVALVAGSPIE---NRE----VVQLLLHVADISNPTKDWTIHRQWTTKIMEEFFTQGDMEIELGLDVSPLCDRSTTLIPESQIGFIDFIVSPALEVCSEVLE 358          
BLAST of Phosphodiesterase vs. Ensembl Nematostella
Match: EDO32179 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVS5])

HSP 1 Score: 157.918 bits (398), Expect = 3.750e-41
Identity = 93/296 (31.42%), Postives = 160/296 (54.05%), Query Frame = 2
Query:  797 LTYLSIHLFEKHNLIQHFQLDISMVFQFLVTIERSYHQSNPYHNALHAADVTQAINCIIQDKQIFGQLTSQDILCSLLSTICHDVDHPGLNNMFLINSNHHLSILYKKQSILENHHWAFSLSVLRQ--TNLFLHFDKDLWKQVTNTCGSLIRATDISKQNAYLSDFNKILLSK---DSPINEPLNEEQKILVLQMAIKCADICNPCRRWDICNCWAYLVTEEFFQQGDKEKALLLPISPIMDREKSKQAVVQRDFIKFLVLPLFTVWHQF---IESNLSRNILDLIDSNKNMWQQL 1660
            + YL   ++    L+  F+++ S +  FL  + R Y+ + P+HN  HA  VTQ +  +I   +IF ++T QD+L  L S +CHD+DHPG NN + IN+   L++ Y   S LENHH A +  +++Q  +N+  +   + +K++       I +TD+++ +  L+ F ++L S    D       +E  K +++Q+ IK +D+ N  R  D+   W   + +EFF Q D EK   LP++P MDR+K  +   Q  FIKF+++PLF    +    +E ++   +   +D    M Q +
Sbjct:  184 MLYLLQQMYIDLGLLDEFKIERSKLQHFLFEVYRHYNPT-PFHNFRHAFCVTQMMYGLIWLTEIFNKITKQDLLIMLTSALCHDLDHPGYNNAYQINARTELALRYNDISPLENHHCAVAFDIMKQDKSNILQNVSAETFKKIREGMIKCILSTDMARHSDILNKFKELLKSGFKFD-------DEAHKSMLMQIMIKVSDVSNEARPMDVAEPWLDCLLQEFFIQSDVEKLEGLPVAPFMDRDKVTKPSAQIGFIKFVLVPLFEALGELFPILEDHIVSPVRKALDYYVGMGQTM 471          
BLAST of Phosphodiesterase vs. Ensembl Nematostella
Match: EDO43748 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXZ4])

HSP 1 Score: 138.658 bits (348), Expect = 1.261e-35
Identity = 95/333 (28.53%), Postives = 148/333 (44.44%), Query Frame = 2
Query:  728 ILNSIDNWDFNIFALERFTSGTPLTYLSIHLFEKHNLIQHFQLDISMVFQFLVTIERSYHQSNPYHNALHAADVTQAINCIIQDK--------------------------------------------QIFGQLTSQDILCSLLS----TICHDVDHPGLNNMFLINSNHHLSILYKKQSILENHHWAFSLSVLR---QTNLFLHFDKDLWKQVTNTCGSLIRATDISKQNAYLSDFNKILLSKDSPINEPLNEEQKILVLQMAIKCADICNPCRRWDICNCWAYLVTEEFFQQGDKEKALLLPISPIMDREKSKQAVVQRDFIKFLVLPLF 1573
            +++ + +W+F IF  +    G  L  +S  +F+     + F++       +   +E  YH S PYHN++HA+DV Q +  +   K                                              +G L     L  LLS       HD DHPG  N FL+ +  H ++LY  +S+LENHH A + ++L    + N         +K+        I ATD+ +    LSDFN    + +  +N   +E  ++L LQ  IK +DI  P +R DI   W   + EEF++QGD E+A  + +SP MDR++   A +Q  FI  LV PL+
Sbjct:   19 LMDKVTDWNFPIF--DACEHGNILVQVSYRIFQNAGFFEIFKIPERKFLNYFFALESGYH-SIPYHNSIHASDVLQGVYFLTTAKIPGFCPPGTPQKLGDNESDSDSDSGITSGVLGEGEEDKKDDDGGGDYGALVDVIPLLELLSLYTAAAMHDYDHPGRTNAFLVATLSHQALLYNDRSVLENHHAAAAFTLLMSDPKYNFLCELSPAEFKRFRFLAIEAILATDLKRHFDILSDFNA--KTAEGGVNWD-SEADRLLTLQFCIKMSDISGPSKRRDIHTLWTERIVEEFYEQGDDERARGMAVSPYMDRQQPHVAQLQDSFINHLVAPLY 345          
BLAST of Phosphodiesterase vs. Ensembl Medaka
Match: pde7a (phosphodiesterase 7A [Source:NCBI gene;Acc:101157095])

HSP 1 Score: 296.59 bits (758), Expect = 6.974e-91
Identity = 143/316 (45.25%), Postives = 202/316 (63.92%), Query Frame = 2
Query:  728 ILNSIDNWDFNIFALERFTSGTPLTYLSIHLFEKHNLIQHFQLDISMVFQFLVTIERSYHQSNPYHNALHAADVTQAINCIIQDKQIFGQLTSQDILCSLLSTICHDVDHPGLNNMFLINSNHHLSILYKKQSILENHHWAFSLSVLRQTNLFLHFDKDLWKQVTNTCGSLIRATDISKQNAYLSDFNKILLSKDSPINEPLNEEQKILVLQMAIKCADICNPCRRWDICNCWAYLVTEEFFQQGDKEKALLLPISPIMDREKSKQAVVQRDFIKFLVLPLFTVWHQFIESNLSRNILDLIDSNKNMWQQLSDLST 1675
            +L  + NW+F+IF  +R T+G  L  L+ HL  K+ L++ FQLD+  +++FLV ++  YH  NPYHNA+HAADVTQA+ C +Q+  +   LTS DIL  LL+   HD+ HPG+N  FLI ++H+L+ LY+  S+LENHHW  ++ +LR+T LF H   +    +    GSLI ATDIS+QN YLS F   L  ++  ++   N   +  VLQMA+KCADICNPCR W++   W+  VTEEFFQQGD EK   L +SP+ DRE +    +Q  F+ ++V PLF  W +F +S LS+ +L  +  NK  W+ L    T
Sbjct:  153 MLEKVGNWNFDIFLFDRLTNGNSLVTLTFHLLNKYGLVELFQLDMVKLWRFLVMVQEDYHNDNPYHNAVHAADVTQAMYCFLQEPMLAKSLTSYDILLGLLAAATHDLGHPGVNQPFLIKTDHYLATLYRNTSVLENHHWKSAVGLLRETRLFSHLPAEDSLNMERELGSLILATDISRQNDYLSRFRMHLDKENLCLS---NASHRHFVLQMALKCADICNPCRPWELSKQWSERVTEEFFQQGDIEKKHKLEVSPLCDREANTIGNIQIGFMSYVVEPLFAEWARFSDSRLSQTMLGHMGLNKASWEGLQQEQT 465          
BLAST of Phosphodiesterase vs. Ensembl Medaka
Match: PDE7B (phosphodiesterase 7B [Source:NCBI gene;Acc:101164940])

HSP 1 Score: 268.855 bits (686), Expect = 3.596e-80
Identity = 131/329 (39.82%), Postives = 197/329 (59.88%), Query Frame = 2
Query:  692 LIDMKQYPSIKMILNSIDNWDFNIFALERFTSGTPLTYLSIHLFEKHNLIQHFQLDISMVFQFLVTIERSYHQSNPYHNALHAADVTQAINCIIQDKQIFGQLTSQDILCSLLSTICHDVDHPGLNNMFLINSNHHLSILYKKQSILENHHWAFSLSVLRQTNLFLHFDKDLWKQVTNTCGSLIRATDISKQNAYLSDFNKILLSKDSPINEPLNEEQKILVLQMAIKCADICNPCRRWDICNCWAYLVTEEFFQQGDKEKALLLPISPIMDREKSKQAVVQRDFIKFLVLPLFTVWHQFIE-SNLSRNILDLIDSNKNMWQQLSDLST 1675
            L+D         +L+ +  W+F+IF  +R T+G  L  L  HLF  ++LI HFQLDI  + +F   +++ YH  NPYHNA+HAADVTQAI C +++ ++  QL+  D+   L++   HDVDHPG+N  FLI + HHL+ LY+  S+LE+HHW  ++ +LR++ L  H   ++ + +    GSLI ATDI +QN +L  F + L ++D  +   L    +  +LQ+A+KCAD+CNPCR W++   W   V EEF +QG+ EK   L +SP  D +      +Q  FI  +  PLF  W++F   S LS+ +LD +  NK  W +L +  T
Sbjct:  177 LLDDDYLGQAAHMLSKVGTWNFDIFLFDRLTNGNSLVTLMCHLFNIYDLIHHFQLDIVKLHRFFGMVQKDYHSQNPYHNAIHAADVTQAIYCYLKEPKLADQLSPLDVFLGLIAAAAHDVDHPGVNQPFLIKTRHHLASLYQNTSVLESHHWRSTVGMLRESGLLAHLPAEITRVIEQQLGSLILATDICRQNEFLLTFREHLDNQDLDL---LEASHRHFILQIALKCADVCNPCRSWELSRQWGERVCEEFHKQGELEKKFDLEVSPQCDHQVDSVPAIQSGFISCIAEPLFEEWNRFTHPSLLSQTMLDHLHKNKAHWIRLLNPGT 502          
BLAST of Phosphodiesterase vs. Ensembl Medaka
Match: pde4d (phosphodiesterase 4D [Source:NCBI gene;Acc:101167796])

HSP 1 Score: 194.126 bits (492), Expect = 9.286e-52
Identity = 97/313 (30.99%), Postives = 173/313 (55.27%), Query Frame = 2
Query:  731 LNSIDNWDFNIFALERFTSGTPLTYLSIHLFEKHNLIQHFQLDISMVFQFLVTIERSYHQSNPYHNALHAADVTQAINCIIQDKQIFGQLTSQDILCSLLSTICHDVDHPGLNNMFLINSNHHLSILYKKQSILENHHWAFSLSVLRQTN--LFLHFDKDLWKQVTNTCGSLIRATDISKQNAYLSDFNKILLSKDSPINEPL---NEEQKILVLQMAIKCADICNPCRRWDICNCWAYLVTEEFFQQGDKEKALLLPISPIMDREKSKQAVVQRDFIKFLVLPLFTVWHQFIESNLSRNILDLIDSNKNMWQ 1654
            L  ++ W  N+F +  F+   PLT +   +F++ +L++ F++ +     +L+T+E  YH    YHN +HAADVTQ+ + ++    +    T  +IL ++ ++  HDVDHPG++N FLI++N  L+++Y   S+LENHH A    +L++ N  +F +  K   + +      ++ ATD+SK    L+D   ++ +K    +  L   N   +I VLQ  + CAD+ NP +   +   W   + EEFF QGD+E+   + ISP+ D+  +     Q  FI ++  PL+  W   +  + +++ILD ++ N+  +Q
Sbjct:  275 LEHVNKWGLNVFKITEFSGNRPLTVMMHTIFQERDLLKTFKIPLDTFITYLLTLEDHYHGDVAYHNNIHAADVTQSTHVLLSTPALEAVFTDLEILAAIFASAIHDVDHPGVSNQFLISTNSELALMYNDSSVLENHHLAVGFKLLQEENCDIFQNLTKKQRQSLRKMVIDIVLATDMSKHMNLLADLKTMVETKKVTSSGVLLLDNYSDRIQVLQNMVHCADLSNPTKPLQLYRQWTDRIMEEFFSQGDRERERGMEISPMCDKHNASVEKSQVGFIDYIAHPLWETWADLVHPD-AQDILDTLEDNREWYQ 586          
BLAST of Phosphodiesterase vs. Ensembl Medaka
Match: pde4d (phosphodiesterase 4D [Source:NCBI gene;Acc:101167796])

HSP 1 Score: 193.741 bits (491), Expect = 1.560e-51
Identity = 97/313 (30.99%), Postives = 173/313 (55.27%), Query Frame = 2
Query:  731 LNSIDNWDFNIFALERFTSGTPLTYLSIHLFEKHNLIQHFQLDISMVFQFLVTIERSYHQSNPYHNALHAADVTQAINCIIQDKQIFGQLTSQDILCSLLSTICHDVDHPGLNNMFLINSNHHLSILYKKQSILENHHWAFSLSVLRQTN--LFLHFDKDLWKQVTNTCGSLIRATDISKQNAYLSDFNKILLSKDSPINEPL---NEEQKILVLQMAIKCADICNPCRRWDICNCWAYLVTEEFFQQGDKEKALLLPISPIMDREKSKQAVVQRDFIKFLVLPLFTVWHQFIESNLSRNILDLIDSNKNMWQ 1654
            L  ++ W  N+F +  F+   PLT +   +F++ +L++ F++ +     +L+T+E  YH    YHN +HAADVTQ+ + ++    +    T  +IL ++ ++  HDVDHPG++N FLI++N  L+++Y   S+LENHH A    +L++ N  +F +  K   + +      ++ ATD+SK    L+D   ++ +K    +  L   N   +I VLQ  + CAD+ NP +   +   W   + EEFF QGD+E+   + ISP+ D+  +     Q  FI ++  PL+  W   +  + +++ILD ++ N+  +Q
Sbjct:  278 LEHVNKWGLNVFKITEFSGNRPLTVMMHTIFQERDLLKTFKIPLDTFITYLLTLEDHYHGDVAYHNNIHAADVTQSTHVLLSTPALEAVFTDLEILAAIFASAIHDVDHPGVSNQFLISTNSELALMYNDSSVLENHHLAVGFKLLQEENCDIFQNLTKKQRQSLRKMVIDIVLATDMSKHMNLLADLKTMVETKKVTSSGVLLLDNYSDRIQVLQNMVHCADLSNPTKPLQLYRQWTDRIMEEFFSQGDRERERGMEISPMCDKHNASVEKSQVGFIDYIAHPLWETWADLVHPD-AQDILDTLEDNREWYQ 589          
BLAST of Phosphodiesterase vs. Ensembl Medaka
Match: pde4d (phosphodiesterase 4D [Source:NCBI gene;Acc:101167796])

HSP 1 Score: 194.126 bits (492), Expect = 2.172e-51
Identity = 97/313 (30.99%), Postives = 173/313 (55.27%), Query Frame = 2
Query:  731 LNSIDNWDFNIFALERFTSGTPLTYLSIHLFEKHNLIQHFQLDISMVFQFLVTIERSYHQSNPYHNALHAADVTQAINCIIQDKQIFGQLTSQDILCSLLSTICHDVDHPGLNNMFLINSNHHLSILYKKQSILENHHWAFSLSVLRQTN--LFLHFDKDLWKQVTNTCGSLIRATDISKQNAYLSDFNKILLSKDSPINEPL---NEEQKILVLQMAIKCADICNPCRRWDICNCWAYLVTEEFFQQGDKEKALLLPISPIMDREKSKQAVVQRDFIKFLVLPLFTVWHQFIESNLSRNILDLIDSNKNMWQ 1654
            L  ++ W  N+F +  F+   PLT +   +F++ +L++ F++ +     +L+T+E  YH    YHN +HAADVTQ+ + ++    +    T  +IL ++ ++  HDVDHPG++N FLI++N  L+++Y   S+LENHH A    +L++ N  +F +  K   + +      ++ ATD+SK    L+D   ++ +K    +  L   N   +I VLQ  + CAD+ NP +   +   W   + EEFF QGD+E+   + ISP+ D+  +     Q  FI ++  PL+  W   +  + +++ILD ++ N+  +Q
Sbjct:  336 LEHVNKWGLNVFKITEFSGNRPLTVMMHTIFQERDLLKTFKIPLDTFITYLLTLEDHYHGDVAYHNNIHAADVTQSTHVLLSTPALEAVFTDLEILAAIFASAIHDVDHPGVSNQFLISTNSELALMYNDSSVLENHHLAVGFKLLQEENCDIFQNLTKKQRQSLRKMVIDIVLATDMSKHMNLLADLKTMVETKKVTSSGVLLLDNYSDRIQVLQNMVHCADLSNPTKPLQLYRQWTDRIMEEFFSQGDRERERGMEISPMCDKHNASVEKSQVGFIDYIAHPLWETWADLVHPD-AQDILDTLEDNREWYQ 647          
BLAST of Phosphodiesterase vs. Planmine SMEST
Match: SMESG000028250.1 (SMESG000028250.1)

HSP 1 Score: 1316.98 bits (3407), Expect = 0.000e+0
Identity = 637/639 (99.69%), Postives = 638/639 (99.84%), Query Frame = 2
Query:  428 MFPFSTSIFMILRSFQEDTENLKNLDPRFSIILETDHFSIAKLPDMSFNQFPTMSDSLRLSTSFLPLSTRKDRFKDRYAYTKMYSYKGLIDMKQYPSIKMILNSIDNWDFNIFALERFTSGTPLTYLSIHLFEKHNLIQHFQLDISMVFQFLVTIERSYHQSNPYHNALHAADVTQAINCIIQDKQIFGQLTSQDILCSLLSTICHDVDHPGLNNMFLINSNHHLSILYKKQSILENHHWAFSLSVLRQTNLFLHFDKDLWKQVTNTCGSLIRATDISKQNAYLSDFNKILLSKDSPINEPLNEEQKILVLQMAIKCADICNPCRRWDICNCWAYLVTEEFFQQGDKEKALLLPISPIMDREKSKQAVVQRDFIKFLVLPLFTVWHQFIESNLSRNILDLIDSNKNMWQQLSDLSTPEFNSIILSSIQSVYDRIQLMQVMDYTEDHQLSHLQELLIDARNNKENENISREDSVDMDENPNMDNFCLYDLSAITEGQTNHYQQYRRGSLPITLQTCNRDSLFSSGVRKSIALNRPKLMIRRTSLQPGQGYTTSLMSTSISKNRNNSVQFVTPPSSDVQKFPTACRRKSAPAIKLNQTSLLESINYGRRGSLTGIFCSNKINTGLCSSQSQLYQPAHSLND 2344
            MFPFSTSIFMILRSFQED ENLKNLDPRFSIILETDHFSIAKLPDMSFNQFPTMSDSLRLSTSFLPLSTRKDRFKDRYAYTKMYSYKGLIDMKQYPSIKMILNSIDNWDFNIFALERFTSGTPLTYLSIHLFEKHNLIQHFQLDISMVFQFLVTIERSYHQSNPYHNALHAADVTQAINCIIQDKQIFGQLTSQDILCSLLSTICHDVDHPGLNNMFLINSNHHLSILYKKQS+LENHHWAFSLSVLRQTNLFLHFDKDLWKQVTNTCGSLIRATDISKQNAYLSDFNKILLSKDSPINEPLNEEQKILVLQMAIKCADICNPCRRWDICNCWAYLVTEEFFQQGDKEKALLLPISPIMDREKSKQAVVQRDFIKFLVLPLFTVWHQFIESNLSRNILDLIDSNKNMWQQLSDLSTPEFNSIILSSIQSVYDRIQLMQVMDYTEDHQLSHLQELLIDARNNKENENISREDSVDMDENPNMDNFCLYDLSAITEGQTNHYQQYRRGSLPITLQTCNRDSLFSSGVRKSIALNRPKLMIRRTSLQPGQGYTTSLMSTSISKNRNNSVQFVTPPSSDVQKFPTACRRKSAPAIKLNQTSLLESINYGRRGSLTGIFCSNKINTGLCSSQSQLYQPAHSLND
Sbjct:    1 MFPFSTSIFMILRSFQEDPENLKNLDPRFSIILETDHFSIAKLPDMSFNQFPTMSDSLRLSTSFLPLSTRKDRFKDRYAYTKMYSYKGLIDMKQYPSIKMILNSIDNWDFNIFALERFTSGTPLTYLSIHLFEKHNLIQHFQLDISMVFQFLVTIERSYHQSNPYHNALHAADVTQAINCIIQDKQIFGQLTSQDILCSLLSTICHDVDHPGLNNMFLINSNHHLSILYKKQSVLENHHWAFSLSVLRQTNLFLHFDKDLWKQVTNTCGSLIRATDISKQNAYLSDFNKILLSKDSPINEPLNEEQKILVLQMAIKCADICNPCRRWDICNCWAYLVTEEFFQQGDKEKALLLPISPIMDREKSKQAVVQRDFIKFLVLPLFTVWHQFIESNLSRNILDLIDSNKNMWQQLSDLSTPEFNSIILSSIQSVYDRIQLMQVMDYTEDHQLSHLQELLIDARNNKENENISREDSVDMDENPNMDNFCLYDLSAITEGQTNHYQQYRRGSLPITLQTCNRDSLFSSGVRKSIALNRPKLMIRRTSLQPGQGYTTSLMSTSISKNRNNSVQFVTPPSSDVQKFPTACRRKSAPAIKLNQTSLLESINYGRRGSLTGIFCSNKINTGLCSSQSQLYQPAHSLND 639          
BLAST of Phosphodiesterase vs. Planmine SMEST
Match: SMESG000028250.1 (SMESG000028250.1)

HSP 1 Score: 1299.26 bits (3361), Expect = 0.000e+0
Identity = 628/630 (99.68%), Postives = 629/630 (99.84%), Query Frame = 2
Query:  455 MILRSFQEDTENLKNLDPRFSIILETDHFSIAKLPDMSFNQFPTMSDSLRLSTSFLPLSTRKDRFKDRYAYTKMYSYKGLIDMKQYPSIKMILNSIDNWDFNIFALERFTSGTPLTYLSIHLFEKHNLIQHFQLDISMVFQFLVTIERSYHQSNPYHNALHAADVTQAINCIIQDKQIFGQLTSQDILCSLLSTICHDVDHPGLNNMFLINSNHHLSILYKKQSILENHHWAFSLSVLRQTNLFLHFDKDLWKQVTNTCGSLIRATDISKQNAYLSDFNKILLSKDSPINEPLNEEQKILVLQMAIKCADICNPCRRWDICNCWAYLVTEEFFQQGDKEKALLLPISPIMDREKSKQAVVQRDFIKFLVLPLFTVWHQFIESNLSRNILDLIDSNKNMWQQLSDLSTPEFNSIILSSIQSVYDRIQLMQVMDYTEDHQLSHLQELLIDARNNKENENISREDSVDMDENPNMDNFCLYDLSAITEGQTNHYQQYRRGSLPITLQTCNRDSLFSSGVRKSIALNRPKLMIRRTSLQPGQGYTTSLMSTSISKNRNNSVQFVTPPSSDVQKFPTACRRKSAPAIKLNQTSLLESINYGRRGSLTGIFCSNKINTGLCSSQSQLYQPAHSLND 2344
            MILRSFQED ENLKNLDPRFSIILETDHFSIAKLPDMSFNQFPTMSDSLRLSTSFLPLSTRKDRFKDRYAYTKMYSYKGLIDMKQYPSIKMILNSIDNWDFNIFALERFTSGTPLTYLSIHLFEKHNLIQHFQLDISMVFQFLVTIERSYHQSNPYHNALHAADVTQAINCIIQDKQIFGQLTSQDILCSLLSTICHDVDHPGLNNMFLINSNHHLSILYKKQS+LENHHWAFSLSVLRQTNLFLHFDKDLWKQVTNTCGSLIRATDISKQNAYLSDFNKILLSKDSPINEPLNEEQKILVLQMAIKCADICNPCRRWDICNCWAYLVTEEFFQQGDKEKALLLPISPIMDREKSKQAVVQRDFIKFLVLPLFTVWHQFIESNLSRNILDLIDSNKNMWQQLSDLSTPEFNSIILSSIQSVYDRIQLMQVMDYTEDHQLSHLQELLIDARNNKENENISREDSVDMDENPNMDNFCLYDLSAITEGQTNHYQQYRRGSLPITLQTCNRDSLFSSGVRKSIALNRPKLMIRRTSLQPGQGYTTSLMSTSISKNRNNSVQFVTPPSSDVQKFPTACRRKSAPAIKLNQTSLLESINYGRRGSLTGIFCSNKINTGLCSSQSQLYQPAHSLND
Sbjct:    1 MILRSFQEDPENLKNLDPRFSIILETDHFSIAKLPDMSFNQFPTMSDSLRLSTSFLPLSTRKDRFKDRYAYTKMYSYKGLIDMKQYPSIKMILNSIDNWDFNIFALERFTSGTPLTYLSIHLFEKHNLIQHFQLDISMVFQFLVTIERSYHQSNPYHNALHAADVTQAINCIIQDKQIFGQLTSQDILCSLLSTICHDVDHPGLNNMFLINSNHHLSILYKKQSVLENHHWAFSLSVLRQTNLFLHFDKDLWKQVTNTCGSLIRATDISKQNAYLSDFNKILLSKDSPINEPLNEEQKILVLQMAIKCADICNPCRRWDICNCWAYLVTEEFFQQGDKEKALLLPISPIMDREKSKQAVVQRDFIKFLVLPLFTVWHQFIESNLSRNILDLIDSNKNMWQQLSDLSTPEFNSIILSSIQSVYDRIQLMQVMDYTEDHQLSHLQELLIDARNNKENENISREDSVDMDENPNMDNFCLYDLSAITEGQTNHYQQYRRGSLPITLQTCNRDSLFSSGVRKSIALNRPKLMIRRTSLQPGQGYTTSLMSTSISKNRNNSVQFVTPPSSDVQKFPTACRRKSAPAIKLNQTSLLESINYGRRGSLTGIFCSNKINTGLCSSQSQLYQPAHSLND 630          
BLAST of Phosphodiesterase vs. Planmine SMEST
Match: SMESG000028250.1 (SMESG000028250.1)

HSP 1 Score: 1268.45 bits (3281), Expect = 0.000e+0
Identity = 618/639 (96.71%), Postives = 620/639 (97.03%), Query Frame = 2
Query:  428 MFPFSTSIFMILRSFQEDTENLKNLDPRFSIILETDHFSIAKLPDMSFNQFPTMSDSLRLSTSFLPLSTRKDRFKDRYAYTKMYSYKGLIDMKQYPSIKMILNSIDNWDFNIFALERFTSGTPLTYLSIHLFEKHNLIQHFQLDISMVFQFLVTIERSYHQSNPYHNALHAADVTQAINCIIQDKQIFGQLTSQDILCSLLSTICHDVDHPGLNNMFLINSNHHLSILYKKQSILENHHWAFSLSVLRQTNLFLHFDKDLWKQVTNTCGSLIRATDISKQNAYLSDFNKILLSKDSPINEPLNEEQKILVLQMAIKCADICNPCRRWDICNCWAYLVTEEFFQQGDKEKALLLPISPIMDREKSKQAVVQRDFIKFLVLPLFTVWHQFIESNLSRNILDLIDSNKNMWQQLSDLSTPEFNSIILSSIQSVYDRIQLMQVMDYTEDHQLSHLQELLIDARNNKENENISREDSVDMDENPNMDNFCLYDLSAITEGQTNHYQQYRRGSLPITLQTCNRDSLFSSGVRKSIALNRPKLMIRRTSLQPGQGYTTSLMSTSISKNRNNSVQFVTPPSSDVQKFPTACRRKSAPAIKLNQTSLLESINYGRRGSLTGIFCSNKINTGLCSSQSQLYQPAHSLND 2344
            MFPFSTSIFMILRSFQED ENLKNLDPRFSIILETDHFSIAKLPDMSFNQFPTMSDSLRLSTSFLPLSTRKDRFKDRYAYTKMYSYKGLIDMKQYPSIKMILNSIDNWDFNIFALERFTSGTPLTYLSIHLFEKHNLIQHFQLDISMVFQFLVTIERSYHQSNPYHNALHAADVTQAINCIIQDKQIFGQLTSQDILCSLLSTICHDVDHPGLNNMFLINSNHHLSILYKKQS+LENHHWAFSLSVLRQTNLFLHFDKDLWKQVTNTCGSLIRATDISKQNAYLSDFNKILLSKDSPINEPLNEEQKILVLQMAIKCADICNPCRRWDICNCWAYLVTEEFFQQGDKEKALLLPISPIMDREKSKQAVVQRDFIKFLVLPLFTVWHQFIESNLSRNILDLIDSNKNMWQQLSDLSTPEFNSIILSSIQSVYDRIQLMQVMDYTEDHQLSHLQELLIDARNNKENENISREDSVDMDENPNMDNFCLYDLSAITEGQTNHYQQYRRGSLPITLQTCNRDSLFSSGVRKSIALNRPKLMIRRTSLQPGQGYTTSLMST                  +VQKFPTACRRKSAPAIKLNQTSLLESINYGRRGSLTGIFCSNKINTGLCSSQSQLYQPAHSLND
Sbjct:    1 MFPFSTSIFMILRSFQEDPENLKNLDPRFSIILETDHFSIAKLPDMSFNQFPTMSDSLRLSTSFLPLSTRKDRFKDRYAYTKMYSYKGLIDMKQYPSIKMILNSIDNWDFNIFALERFTSGTPLTYLSIHLFEKHNLIQHFQLDISMVFQFLVTIERSYHQSNPYHNALHAADVTQAINCIIQDKQIFGQLTSQDILCSLLSTICHDVDHPGLNNMFLINSNHHLSILYKKQSVLENHHWAFSLSVLRQTNLFLHFDKDLWKQVTNTCGSLIRATDISKQNAYLSDFNKILLSKDSPINEPLNEEQKILVLQMAIKCADICNPCRRWDICNCWAYLVTEEFFQQGDKEKALLLPISPIMDREKSKQAVVQRDFIKFLVLPLFTVWHQFIESNLSRNILDLIDSNKNMWQQLSDLSTPEFNSIILSSIQSVYDRIQLMQVMDYTEDHQLSHLQELLIDARNNKENENISREDSVDMDENPNMDNFCLYDLSAITEGQTNHYQQYRRGSLPITLQTCNRDSLFSSGVRKSIALNRPKLMIRRTSLQPGQGYTTSLMST------------------NVQKFPTACRRKSAPAIKLNQTSLLESINYGRRGSLTGIFCSNKINTGLCSSQSQLYQPAHSLND 621          
BLAST of Phosphodiesterase vs. Planmine SMEST
Match: SMESG000028250.1 (SMESG000028250.1)

HSP 1 Score: 1250.73 bits (3235), Expect = 0.000e+0
Identity = 609/630 (96.67%), Postives = 611/630 (96.98%), Query Frame = 2
Query:  455 MILRSFQEDTENLKNLDPRFSIILETDHFSIAKLPDMSFNQFPTMSDSLRLSTSFLPLSTRKDRFKDRYAYTKMYSYKGLIDMKQYPSIKMILNSIDNWDFNIFALERFTSGTPLTYLSIHLFEKHNLIQHFQLDISMVFQFLVTIERSYHQSNPYHNALHAADVTQAINCIIQDKQIFGQLTSQDILCSLLSTICHDVDHPGLNNMFLINSNHHLSILYKKQSILENHHWAFSLSVLRQTNLFLHFDKDLWKQVTNTCGSLIRATDISKQNAYLSDFNKILLSKDSPINEPLNEEQKILVLQMAIKCADICNPCRRWDICNCWAYLVTEEFFQQGDKEKALLLPISPIMDREKSKQAVVQRDFIKFLVLPLFTVWHQFIESNLSRNILDLIDSNKNMWQQLSDLSTPEFNSIILSSIQSVYDRIQLMQVMDYTEDHQLSHLQELLIDARNNKENENISREDSVDMDENPNMDNFCLYDLSAITEGQTNHYQQYRRGSLPITLQTCNRDSLFSSGVRKSIALNRPKLMIRRTSLQPGQGYTTSLMSTSISKNRNNSVQFVTPPSSDVQKFPTACRRKSAPAIKLNQTSLLESINYGRRGSLTGIFCSNKINTGLCSSQSQLYQPAHSLND 2344
            MILRSFQED ENLKNLDPRFSIILETDHFSIAKLPDMSFNQFPTMSDSLRLSTSFLPLSTRKDRFKDRYAYTKMYSYKGLIDMKQYPSIKMILNSIDNWDFNIFALERFTSGTPLTYLSIHLFEKHNLIQHFQLDISMVFQFLVTIERSYHQSNPYHNALHAADVTQAINCIIQDKQIFGQLTSQDILCSLLSTICHDVDHPGLNNMFLINSNHHLSILYKKQS+LENHHWAFSLSVLRQTNLFLHFDKDLWKQVTNTCGSLIRATDISKQNAYLSDFNKILLSKDSPINEPLNEEQKILVLQMAIKCADICNPCRRWDICNCWAYLVTEEFFQQGDKEKALLLPISPIMDREKSKQAVVQRDFIKFLVLPLFTVWHQFIESNLSRNILDLIDSNKNMWQQLSDLSTPEFNSIILSSIQSVYDRIQLMQVMDYTEDHQLSHLQELLIDARNNKENENISREDSVDMDENPNMDNFCLYDLSAITEGQTNHYQQYRRGSLPITLQTCNRDSLFSSGVRKSIALNRPKLMIRRTSLQPGQGYTTSLMST                  +VQKFPTACRRKSAPAIKLNQTSLLESINYGRRGSLTGIFCSNKINTGLCSSQSQLYQPAHSLND
Sbjct:    1 MILRSFQEDPENLKNLDPRFSIILETDHFSIAKLPDMSFNQFPTMSDSLRLSTSFLPLSTRKDRFKDRYAYTKMYSYKGLIDMKQYPSIKMILNSIDNWDFNIFALERFTSGTPLTYLSIHLFEKHNLIQHFQLDISMVFQFLVTIERSYHQSNPYHNALHAADVTQAINCIIQDKQIFGQLTSQDILCSLLSTICHDVDHPGLNNMFLINSNHHLSILYKKQSVLENHHWAFSLSVLRQTNLFLHFDKDLWKQVTNTCGSLIRATDISKQNAYLSDFNKILLSKDSPINEPLNEEQKILVLQMAIKCADICNPCRRWDICNCWAYLVTEEFFQQGDKEKALLLPISPIMDREKSKQAVVQRDFIKFLVLPLFTVWHQFIESNLSRNILDLIDSNKNMWQQLSDLSTPEFNSIILSSIQSVYDRIQLMQVMDYTEDHQLSHLQELLIDARNNKENENISREDSVDMDENPNMDNFCLYDLSAITEGQTNHYQQYRRGSLPITLQTCNRDSLFSSGVRKSIALNRPKLMIRRTSLQPGQGYTTSLMST------------------NVQKFPTACRRKSAPAIKLNQTSLLESINYGRRGSLTGIFCSNKINTGLCSSQSQLYQPAHSLND 612          
BLAST of Phosphodiesterase vs. Planmine SMEST
Match: SMESG000028250.1 (SMESG000028250.1)

HSP 1 Score: 876.315 bits (2263), Expect = 0.000e+0
Identity = 423/424 (99.76%), Postives = 424/424 (100.00%), Query Frame = 2
Query: 1073 MFLINSNHHLSILYKKQSILENHHWAFSLSVLRQTNLFLHFDKDLWKQVTNTCGSLIRATDISKQNAYLSDFNKILLSKDSPINEPLNEEQKILVLQMAIKCADICNPCRRWDICNCWAYLVTEEFFQQGDKEKALLLPISPIMDREKSKQAVVQRDFIKFLVLPLFTVWHQFIESNLSRNILDLIDSNKNMWQQLSDLSTPEFNSIILSSIQSVYDRIQLMQVMDYTEDHQLSHLQELLIDARNNKENENISREDSVDMDENPNMDNFCLYDLSAITEGQTNHYQQYRRGSLPITLQTCNRDSLFSSGVRKSIALNRPKLMIRRTSLQPGQGYTTSLMSTSISKNRNNSVQFVTPPSSDVQKFPTACRRKSAPAIKLNQTSLLESINYGRRGSLTGIFCSNKINTGLCSSQSQLYQPAHSLND 2344
            MFLINSNHHLSILYKKQS+LENHHWAFSLSVLRQTNLFLHFDKDLWKQVTNTCGSLIRATDISKQNAYLSDFNKILLSKDSPINEPLNEEQKILVLQMAIKCADICNPCRRWDICNCWAYLVTEEFFQQGDKEKALLLPISPIMDREKSKQAVVQRDFIKFLVLPLFTVWHQFIESNLSRNILDLIDSNKNMWQQLSDLSTPEFNSIILSSIQSVYDRIQLMQVMDYTEDHQLSHLQELLIDARNNKENENISREDSVDMDENPNMDNFCLYDLSAITEGQTNHYQQYRRGSLPITLQTCNRDSLFSSGVRKSIALNRPKLMIRRTSLQPGQGYTTSLMSTSISKNRNNSVQFVTPPSSDVQKFPTACRRKSAPAIKLNQTSLLESINYGRRGSLTGIFCSNKINTGLCSSQSQLYQPAHSLND
Sbjct:    1 MFLINSNHHLSILYKKQSVLENHHWAFSLSVLRQTNLFLHFDKDLWKQVTNTCGSLIRATDISKQNAYLSDFNKILLSKDSPINEPLNEEQKILVLQMAIKCADICNPCRRWDICNCWAYLVTEEFFQQGDKEKALLLPISPIMDREKSKQAVVQRDFIKFLVLPLFTVWHQFIESNLSRNILDLIDSNKNMWQQLSDLSTPEFNSIILSSIQSVYDRIQLMQVMDYTEDHQLSHLQELLIDARNNKENENISREDSVDMDENPNMDNFCLYDLSAITEGQTNHYQQYRRGSLPITLQTCNRDSLFSSGVRKSIALNRPKLMIRRTSLQPGQGYTTSLMSTSISKNRNNSVQFVTPPSSDVQKFPTACRRKSAPAIKLNQTSLLESINYGRRGSLTGIFCSNKINTGLCSSQSQLYQPAHSLND 424          
The following BLAST results are available for this feature:
BLAST of Phosphodiesterase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PDE7A6.404e-9346.33phosphodiesterase 7A [Source:HGNC Symbol;Acc:HGNC:... [more]
PDE7A7.695e-9346.33phosphodiesterase 7A [Source:HGNC Symbol;Acc:HGNC:... [more]
PDE7B8.199e-8741.98phosphodiesterase 7B [Source:HGNC Symbol;Acc:HGNC:... [more]
PDE7B1.457e-8641.98phosphodiesterase 7B [Source:HGNC Symbol;Acc:HGNC:... [more]
PDE7A1.155e-8147.43phosphodiesterase 7A [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of Phosphodiesterase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pde-41.622e-4831.23Probable 3',5'-cyclic phosphodiesterase pde-4 [So... [more]
pde-42.670e-4831.23Probable 3',5'-cyclic phosphodiesterase pde-4 [So... [more]
pde-43.659e-4831.23Probable 3',5'-cyclic phosphodiesterase pde-4 [So... [more]
pde-44.023e-4831.23Probable 3',5'-cyclic phosphodiesterase pde-4 [So... [more]
pde-44.378e-4831.23Probable 3',5'-cyclic phosphodiesterase pde-4 [So... [more]
back to top
BLAST of Phosphodiesterase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnc1.392e-5431.66gene:FBgn0000479 transcript:FBtr0070522[more]
dnc5.785e-5430.19gene:FBgn0000479 transcript:FBtr0070518[more]
dnc5.785e-5430.19gene:FBgn0000479 transcript:FBtr0333312[more]
dnc6.864e-5430.19gene:FBgn0000479 transcript:FBtr0333317[more]
dnc6.864e-5430.19gene:FBgn0000479 transcript:FBtr0333316[more]
back to top
BLAST of Phosphodiesterase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pde7a1.204e-9246.33phosphodiesterase 7A [Source:ZFIN;Acc:ZDB-GENE-031... [more]
pde4d1.108e-5331.63phosphodiesterase 4D, cAMP-specific [Source:ZFIN;A... [more]
BX510928.21.459e-5331.63phosphodiesterase 4D, cAMP-specific [Source:NCBI g... [more]
pde4d1.536e-5331.63phosphodiesterase 4D, cAMP-specific [Source:ZFIN;A... [more]
pde4cb3.133e-5230.77phosphodiesterase 4C, cAMP-specific b [Source:ZFIN... [more]
back to top
BLAST of Phosphodiesterase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PDE7A2.492e-9244.73phosphodiesterase 7A [Source:NCBI gene;Acc:1004985... [more]
PDE7A2.767e-9244.69phosphodiesterase 7A [Source:NCBI gene;Acc:1004985... [more]
PDE7A2.922e-9244.73phosphodiesterase 7A [Source:NCBI gene;Acc:1004985... [more]
PDE7A6.208e-9244.73phosphodiesterase 7A [Source:NCBI gene;Acc:1004985... [more]
PDE7A9.921e-9244.73phosphodiesterase 7A [Source:NCBI gene;Acc:1004985... [more]
back to top
BLAST of Phosphodiesterase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pde7a1.285e-9346.01phosphodiesterase 7A [Source:MGI Symbol;Acc:MGI:12... [more]
Pde7a1.590e-9346.01phosphodiesterase 7A [Source:MGI Symbol;Acc:MGI:12... [more]
Pde7b4.149e-8842.59phosphodiesterase 7B [Source:MGI Symbol;Acc:MGI:13... [more]
Pde7b4.228e-8842.59phosphodiesterase 7B [Source:MGI Symbol;Acc:MGI:13... [more]
Pde7b7.142e-8842.59phosphodiesterase 7B [Source:MGI Symbol;Acc:MGI:13... [more]
back to top
BLAST of Phosphodiesterase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P70453|PDE7A_MOUSE1.113e-9246.01High affinity cAMP-specific 3',5'-cyclic phosphodi... [more]
sp|Q13946|PDE7A_HUMAN3.696e-9246.33High affinity cAMP-specific 3',5'-cyclic phosphodi... [more]
sp|O08593|PDE7A_RAT7.618e-9245.69High affinity cAMP-specific 3',5'-cyclic phosphodi... [more]
sp|Q9QXQ1|PDE7B_MOUSE2.958e-8742.59cAMP-specific 3',5'-cyclic phosphodiesterase 7B OS... [more]
sp|Q9NP56|PDE7B_HUMAN3.937e-8641.98cAMP-specific 3',5'-cyclic phosphodiesterase 7B OS... [more]
back to top
BLAST of Phosphodiesterase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A452UEN96.894e-9344.78Phosphodiesterase OS=Ursus maritimus OX=29073 GN=P... [more]
A0A452UEP28.434e-9344.78Phosphodiesterase OS=Ursus maritimus OX=29073 GN=P... [more]
A0A384DDY41.042e-9244.78Phosphodiesterase OS=Ursus maritimus OX=29073 GN=P... [more]
A0A452Q9S21.305e-9244.78Phosphodiesterase OS=Ursus americanus OX=9643 GN=P... [more]
A0A452UET91.510e-9244.78Phosphodiesterase OS=Ursus maritimus OX=29073 GN=P... [more]
back to top
BLAST of Phosphodiesterase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pde7a1.002e-8843.65phosphodiesterase 7A [Source:NCBI gene;Acc:1030424... [more]
pde7a1.695e-8843.65phosphodiesterase 7A [Source:NCBI gene;Acc:1030424... [more]
pde7a5.886e-8844.73phosphodiesterase 7A [Source:NCBI gene;Acc:1030424... [more]
pde7a1.029e-8744.73phosphodiesterase 7A [Source:NCBI gene;Acc:1030424... [more]
pde7a1.374e-8743.65phosphodiesterase 7A [Source:NCBI gene;Acc:1030424... [more]
back to top
BLAST of Phosphodiesterase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pde7a1.859e-8744.41phosphodiesterase 7A [Source:ZFIN;Acc:ZDB-GENE-031... [more]
pde8a1.976e-5431.78phosphodiesterase 8A [Source:ZFIN;Acc:ZDB-GENE-070... [more]
PDE1C3.688e-4630.52phosphodiesterase 1C [Source:HGNC Symbol;Acc:HGNC:... [more]
pde1a6.869e-4027.83phosphodiesterase 1A, calmodulin-dependent [Source... [more]
ENSPMAT00000007435.12.250e-3134.41pep scaffold:Pmarinus_7.0:GL486982:1709:8825:-1 ge... [more]
back to top
BLAST of Phosphodiesterase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
PDE21.742e-1532.66High-affinity cyclic AMP phosphodiesterase; compon... [more]
back to top
BLAST of Phosphodiesterase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO461339.586e-5028.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO321422.938e-4731.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO373011.851e-4333.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO321793.750e-4131.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO437481.261e-3528.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Phosphodiesterase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pde7a6.974e-9145.25phosphodiesterase 7A [Source:NCBI gene;Acc:1011570... [more]
PDE7B3.596e-8039.82phosphodiesterase 7B [Source:NCBI gene;Acc:1011649... [more]
pde4d9.286e-5230.99phosphodiesterase 4D [Source:NCBI gene;Acc:1011677... [more]
pde4d1.560e-5130.99phosphodiesterase 4D [Source:NCBI gene;Acc:1011677... [more]
pde4d2.172e-5130.99phosphodiesterase 4D [Source:NCBI gene;Acc:1011677... [more]
back to top
BLAST of Phosphodiesterase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000028250.10.000e+099.69SMESG000028250.1[more]
SMESG000028250.10.000e+099.68SMESG000028250.1[more]
SMESG000028250.10.000e+096.71SMESG000028250.1[more]
SMESG000028250.10.000e+096.67SMESG000028250.1[more]
SMESG000028250.10.000e+099.76SMESG000028250.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011874 ID=SMED30011874|Name=Phosphodiesterase|organism=Schmidtea mediterranea sexual|type=transcript|length=2537bp
CCGATCTCTGGATTACTGTAAAATTAAGATTGGAAAATGCAGTAACAAAT
CGAAAAGTTCAACAAGTAAATTTCAAATATTCAAAGAGGAGTAAATTAAT
AACAGCAATTTTTTTACACACATTCTTCATTTTCTTACCAGGTACAATGT
CGATAGTAAAACTTGATTGGTTGAAATTTGGTCAAGTTGGTAGAGAAATT
ACTTGAGCCAGGTAGCTGCAATATGTGTGTTGGTAAACTTTCTGTACTGT
ACAACTGAACTGTGTTTCATTCATTACACAGGAAAAAGCATTTCGAAAAC
AATTCTAAACACCATCAATTCATTTTCGTGATTTATTCTTATTTAATCTT
TATCGTTGTATATGAATTTCGATTTTTAAATCATCTGATTGTATTAATGA
CTATCTATTGAAATTCTATAATCGGAAATGTTCCCGTTTTCTACCTCAAT
TTTTATGATTCTCAGAAGTTTCCAAGAAGACACAGAAAATCTCAAAAATC
TTGACCCAAGATTTTCAATTATTTTGGAAACCGATCATTTTTCCATTGCC
AAACTACCAGATATGAGTTTTAATCAATTTCCTACAATGTCTGATTCTCT
TCGATTATCAACATCATTTTTACCACTTTCTACTCGTAAAGACCGATTTA
AAGACCGATACGCATATACAAAAATGTATTCTTACAAAGGACTTATTGAC
ATGAAACAGTATCCATCAATCAAAATGATTTTAAATTCCATTGATAATTG
GGATTTCAATATCTTTGCCCTTGAACGATTTACGTCAGGTACCCCTTTGA
CATATCTATCAATTCATTTATTTGAAAAGCACAATTTAATCCAACATTTC
CAGCTTGACATATCGATGGTGTTTCAATTCCTTGTGACAATTGAACGGTC
TTATCACCAGTCGAATCCTTATCACAATGCCCTTCATGCAGCGGATGTAA
CTCAAGCTATCAATTGCATCATTCAAGATAAACAGATATTTGGCCAATTG
ACATCACAGGATATTCTATGTAGTTTACTTAGCACAATATGCCATGATGT
GGATCACCCAGGCCTCAATAATATGTTTCTGATCAATTCAAATCACCATT
TATCAATCTTATACAAGAAACAATCCATTCTTGAAAACCATCATTGGGCA
TTTAGTTTATCTGTTTTACGGCAAACCAATTTGTTTTTGCATTTTGACAA
AGATCTTTGGAAACAAGTCACTAACACTTGCGGAAGTCTGATAAGGGCGA
CTGATATATCAAAGCAAAATGCATATCTCAGTGATTTTAATAAAATTCTT
TTGTCTAAGGATTCGCCTATAAATGAACCTCTGAATGAAGAGCAAAAAAT
ATTGGTTCTCCAAATGGCAATCAAATGTGCTGATATATGTAATCCATGTC
GTCGTTGGGACATATGCAACTGCTGGGCTTATCTAGTTACCGAAGAATTT
TTTCAACAAGGTGATAAAGAAAAAGCATTATTGTTACCGATTTCGCCAAT
AATGGATAGAGAAAAATCCAAACAAGCTGTAGTTCAAAGAGATTTTATCA
AATTTCTTGTGCTACCTTTATTCACTGTATGGCATCAGTTTATTGAATCA
AATTTGTCTCGTAATATTCTTGATTTAATAGACTCCAATAAAAATATGTG
GCAACAGTTGAGTGATTTATCCACTCCTGAATTCAATAGCATCATTTTAT
CATCTATACAATCCGTTTATGATAGAATTCAATTGATGCAAGTCATGGAC
TACACGGAAGATCATCAGTTATCTCATTTGCAAGAGTTACTTATTGATGC
AAGAAATAATAAAGAAAACGAAAACATTTCCCGTGAAGATTCTGTAGACA
TGGACGAAAATCCTAATATGGACAACTTTTGTTTATATGATTTATCTGCA
ATTACAGAAGGCCAAACTAATCATTATCAACAATACCGTAGAGGATCACT
TCCTATTACTTTACAAACATGTAATCGGGATTCTCTGTTTTCTTCAGGTG
TCAGAAAAAGCATAGCATTAAACAGACCAAAGTTAATGATTCGCAGAACT
AGTCTACAGCCTGGGCAAGGATACACTACATCATTAATGTCAACAAGTAT
ATCTAAAAATAGAAATAATTCAGTTCAATTTGTAACACCTCCTTCATCAG
ACGTCCAGAAATTTCCTACTGCTTGTCGCCGCAAAAGTGCTCCAGCTATA
AAACTGAACCAAACCTCACTATTAGAGTCTATTAATTATGGTCGCAGGGG
TTCATTAACTGGAATTTTTTGCTCAAACAAAATTAATACTGGTTTATGTT
CAAGCCAATCTCAACTCTACCAACCTGCACATTCATTAAATGACATACAA
ATTCTCCAAATTGGGTAATTAATAATACCTAAATATCTTACGATTTTCAA
ATGTAAATGCTAATTTGTCATGATCATTAATTATTGTATATTATGCTTTT
ATTTTAGTGAATATAATAAATATATTGTGATTATTTATAAAGATTTAGAA
ACTAATGTTTTGTCTTTTGAAGTTTTTTGTATGTTGG
back to top

protein sequence of SMED30011874-orf-1

>SMED30011874-orf-1 ID=SMED30011874-orf-1|Name=SMED30011874-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=647bp
MFPFSTSIFMILRSFQEDTENLKNLDPRFSIILETDHFSIAKLPDMSFNQ
FPTMSDSLRLSTSFLPLSTRKDRFKDRYAYTKMYSYKGLIDMKQYPSIKM
ILNSIDNWDFNIFALERFTSGTPLTYLSIHLFEKHNLIQHFQLDISMVFQ
FLVTIERSYHQSNPYHNALHAADVTQAINCIIQDKQIFGQLTSQDILCSL
LSTICHDVDHPGLNNMFLINSNHHLSILYKKQSILENHHWAFSLSVLRQT
NLFLHFDKDLWKQVTNTCGSLIRATDISKQNAYLSDFNKILLSKDSPINE
PLNEEQKILVLQMAIKCADICNPCRRWDICNCWAYLVTEEFFQQGDKEKA
LLLPISPIMDREKSKQAVVQRDFIKFLVLPLFTVWHQFIESNLSRNILDL
IDSNKNMWQQLSDLSTPEFNSIILSSIQSVYDRIQLMQVMDYTEDHQLSH
LQELLIDARNNKENENISREDSVDMDENPNMDNFCLYDLSAITEGQTNHY
QQYRRGSLPITLQTCNRDSLFSSGVRKSIALNRPKLMIRRTSLQPGQGYT
TSLMSTSISKNRNNSVQFVTPPSSDVQKFPTACRRKSAPAIKLNQTSLLE
SINYGRRGSLTGIFCSNKINTGLCSSQSQLYQPAHSLNDIQILQIG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000101muscle cell
PLANA:0000418head
PLANA:0002032epidermal cell
PLANA:0003001lateral region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR036971PDEase_catalytic_dom_sf
IPR023088PDEase
IPR003607HD/PDEase_dom
IPR002073PDEase_catalytic_dom
IPR023174PDEase_CS
Vocabulary: molecular function
TermDefinition
GO:0008081phosphoric diester hydrolase activity
GO:00041143',5'-cyclic-nucleotide phosphodiesterase activity
GO:0016787hydrolase activity
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR0230883'5'-cyclic nucleotide phosphodiesterasePRINTSPR00387PDIESTERASE1coord: 233..249
score: 44.94
coord: 192..205
score: 20.71
coord: 206..221
score: 56.0
coord: 161..174
score: 53.0
coord: 315..328
score: 25.57
coord: 332..348
score: 54.71
IPR003607HD/PDEase domainSMARTSM00471hd_13coord: 163..333
e-value: 0.003
score: 26.8
IPR003607HD/PDEase domainCDDcd00077HDccoord: 165..342
e-value: 3.95607E-8
score: 50.8009
IPR0369713'5'-cyclic nucleotide phosphodiesterase, catalytic domain superfamilyGENE3DG3DSA:1.10.1300.10coord: 86..412
e-value: 1.8E-112
score: 377.6
IPR0020733'5'-cyclic nucleotide phosphodiesterase, catalytic domainPFAMPF00233PDEase_Icoord: 165..391
e-value: 5.6E-74
score: 248.9
IPR0020733'5'-cyclic nucleotide phosphodiesterase, catalytic domainPROSITEPS51845PDEASE_I_2coord: 90..415
score: 96.298
NoneNo IPR availablePANTHERPTHR11347CYCLIC NUCLEOTIDE PHOSPHODIESTERASEcoord: 73..413
NoneNo IPR availablePANTHERPTHR11347:SF203coord: 73..413
NoneNo IPR availableSUPERFAMILYSSF109604HD-domain/PDEase-likecoord: 100..415
IPR0231743'5'-cyclic nucleotide phosphodiesterase, conserved sitePROSITEPS00126PDEASE_I_1coord: 206..217