Serine/threonine-protein kinase Nek10

Overview
NameSerine/threonine-protein kinase Nek10
Smed IDSMED30011865
Length (bp)3167
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Serine/threonine-protein kinase Nek10 (SMED30011865) t-SNE clustered cells

Violin plots show distribution of expression levels for Serine/threonine-protein kinase Nek10 (SMED30011865) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Serine/threonine-protein kinase Nek10 (SMED30011865) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Serine/threonine-protein kinase Nek10 (SMED30011865) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011865

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30011865SMESG000037692.1 SMESG000037689.1 SmedASXL_013777SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
gutSMED30011865SMESG000037692.1 SMESG000037689.1 dd_Smed_v4_17530_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30011865SMESG000037692.1 SMESG000037689.1 dd_Smed_v6_17530_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30011865SMESG000037692.1 dd_Smed_v6_25617_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
zeta neoblastSMED30011865SMESG000037692.1 dd_Smed_v4_25617_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Serine/threonine-protein kinase Nek10 vs. Ensembl Human
Match: NEK10 (NIMA related kinase 10 [Source:HGNC Symbol;Acc:HGNC:18592])

HSP 1 Score: 352.829 bits (904), Expect = 1.699e-103
Identity = 192/463 (41.47%), Postives = 286/463 (61.77%), Query Frame = 3
Query: 1002 DVIEKYFQIIEVASTFISTLSKNENSSLEIVQKSGIYFLVQFLVKIPASYRNAF---ILQKHIFRALRFLFSLERNRKRFKNIFPAILFETFVDVGHFCENLESYDQLVLVYSNLSEIEKKSIRESIDCSSQ-KEETKCIRDYVIFELLGSGAFGSVYKAKRKKASAGSYCAIKEVNLSEYQIGSTSQERCDSIYQIASELDIIKKQLRHPHVVRYYRTFNDAQNLYIVMAFLEGISLGEQINCMKEKKENYEETRIWKIVLQLIQALRYLHKSKGIIHRDLTPYNIIIGDNDYVTITDFGLAKQRLLESRSRDARSILGTLTYVCPEVIQHHPYGEKADIWALGCIVYQICTLSPPFTAQSELDLVNKICQGEYKKVDQFISTFTRQRLEFSFKMKAFIENAIVVDPKYRYDVLGLSGILVEEILINLDQIE----HLLNKEIQSKKRLENQINESNANKLS 2366
            ++ E  F +       ++ L  N+ ++ ++VQ++G+Y + + +  +P   +NA    +LQ + FRALRFLFS+ERNR  FK +FP  LFE F+D+GH+  ++ +Y++LV   + L E E K I E+I+  +Q K   K I +Y I + LGSGAFG VYK +  K S  +  A+KEVNL     G   ++R  S+  I SEL IIK+QL HP++VRYY+TF +   LYIVM  +EG  LGE  + +KEK  ++ E R+WKI +QL  ALRYLHK K I+HRDLTP NI++GD D VT+TDFGLAKQ+   S+     S++GT+ Y CPEV++  PYGEKAD+WA+GCI+YQ+ TLSPPF + + L L  KI +  Y+ V + I         +S K+   I   +  D + R D++ +S ++ + ++  LD +      L  K  + ++R +    E+N N ++
Sbjct:  379 EIQENTFSLQAACCAALTELVLNDTNAHQVVQENGVYTIAKLI--LPNKQKNAAKSNLLQCYAFRALRFLFSMERNRPLFKRLFPTDLFEIFIDIGHYVRDISAYEELVSKLNLLVEDELKQIAENIESINQNKAPLKYIGNYAILDHLGSGAFGCVYKVR--KHSGQNLLAMKEVNLHNPAFGKDKKDRDSSVRNIVSELTIIKEQLYHPNIVRYYKTFLENDRLYIVMELIEGAPLGEHFSSLKEKHHHFTEERLWKIFIQLCLALRYLHKEKRIVHRDLTPNNIMLGDKDKVTVTDFGLAKQKQENSK---LTSVVGTILYSCPEVLKSEPYGEKADVWAVGCILYQMATLSPPFYSTNMLSLATKIVEAVYEPVPEGI---------YSEKVTDTISRCLTPDAEARPDIVEVSSMISDVMMKYLDNLSTSQLSLEKKLERERRRTQRYFMEANRNTVT 825          
BLAST of Serine/threonine-protein kinase Nek10 vs. Ensembl Human
Match: NEK10 (NIMA related kinase 10 [Source:HGNC Symbol;Acc:HGNC:18592])

HSP 1 Score: 275.404 bits (703), Expect = 4.794e-79
Identity = 149/332 (44.88%), Postives = 213/332 (64.16%), Query Frame = 3
Query: 1002 DVIEKYFQIIEVASTFISTLSKNENSSLEIVQKSGIYFLVQFLVKIPASYRNAF---ILQKHIFRALRFLFSLERNRKRFKNIFPAILFETFVDVGHFCENLESYDQLVLVYSNLSEIEKKSIRESIDCSSQ-KEETKCIRDYVIFELLGSGAFGSVYKAKRKKASAGSYCAIKEVNLSEYQIGSTSQERCDSIYQIASELDIIKKQLRHPHVVRYYRTFNDAQNLYIVMAFLEGISLGEQINCMKEKKENYEETRIWKIVLQLIQALRYLHKSKGIIHRDLTPYNIIIGDNDYVTITDFGLAKQRLLESRSRDARSILGTLTYVCPEVIQH 1985
            ++ E  F +       ++ L  N+ ++ ++VQ++G+Y + + +  +P   +NA    +LQ + FRALRFLFS+ERNR  FK +FP  LFE F+D+GH+  ++ +Y++LV   + L E E K I E+I+  +Q K   K I +Y I + LGSGAFG VYK +  K S  +  A+KEVNL     G   ++R  S+  I SEL IIK+QL HP++VRYY+TF +   LYIVM  +EG  LGE  + +KEK  ++ E R+WKI +QL  ALRYLHK K I+HRDLTP NI++GD D VT+TDFGLAKQ+   S+     S++GT+ Y C   +QH
Sbjct:  379 EIQENTFSLQAACCAALTELVLNDTNAHQVVQENGVYTIAKLI--LPNKQKNAAKSNLLQCYAFRALRFLFSMERNRPLFKRLFPTDLFEIFIDIGHYVRDISAYEELVSKLNLLVEDELKQIAENIESINQNKAPLKYIGNYAILDHLGSGAFGCVYKVR--KHSGQNLLAMKEVNLHNPAFGKDKKDRDSSVRNIVSELTIIKEQLYHPNIVRYYKTFLENDRLYIVMELIEGAPLGEHFSSLKEKHHHFTEERLWKIFIQLCLALRYLHKEKRIVHRDLTPNNIMLGDKDKVTVTDFGLAKQKQENSK---LTSVVGTILYSC---VQH 700          
BLAST of Serine/threonine-protein kinase Nek10 vs. Ensembl Human
Match: NEK10 (NIMA related kinase 10 [Source:HGNC Symbol;Acc:HGNC:18592])

HSP 1 Score: 167.162 bits (422), Expect = 6.026e-47
Identity = 82/155 (52.90%), Postives = 107/155 (69.03%), Query Frame = 3
Query: 1503 AIKEVNLSEYQIGSTSQERCDSIYQIASELDIIKKQLRHPHVVRYYRTFNDAQNLYIVMAFLEGISLGEQINCMKEKKENYEETRIWKIVLQLIQALRYLHKSKGIIHRDLTPYNIIIGDNDYVTITDFGLAKQRLLESRSRDARSILGTLTYVC 1967
            A+KEVNL     G   ++R  S+  I SEL IIK+QL HP++VRYY+TF +   LYIVM  +EG  LGE  + +KEK  ++ E R+WKI +QL  ALRYLHK K I+HRDLTP NI++GD D VT+TDFGLAKQ+   S+     S++GT+ Y C
Sbjct:    3 AMKEVNLHNPAFGKDKKDRDSSVRNIVSELTIIKEQLYHPNIVRYYKTFLENDRLYIVMELIEGAPLGEHFSSLKEKHHHFTEERLWKIFIQLCLALRYLHKEKRIVHRDLTPNNIMLGDKDKVTVTDFGLAKQKQENSK---LTSVVGTILYSC 154          
BLAST of Serine/threonine-protein kinase Nek10 vs. Ensembl Human
Match: NEK10 (NIMA related kinase 10 [Source:HGNC Symbol;Acc:HGNC:18592])

HSP 1 Score: 162.54 bits (410), Expect = 5.518e-45
Identity = 94/234 (40.17%), Postives = 128/234 (54.70%), Query Frame = 3
Query: 1269 VDVGHFCENLESYDQLVLVYSNLSEIEKKSIRESIDCSSQ-KEETKCIRDYVIFELLGSGAFGSVYKAKRKKASAGSYCAIKEVNLSEYQIGSTSQERCDSIYQIASELDIIKKQLRHPHVVRYYRTFNDAQNLYIVMAFLEGISLGEQINCMKEKKENYEETRIWKIVLQLIQALRYLHKSKGIIHRDLTPYNIIIGDNDYVTITDFGLAKQRLLESRSRDARSILGTLTYVC 1967
            +D+GH+  ++ +Y++LV   + L E E K I E+I+  +Q K   K I +Y I + LGSGAFG VYK                                                L HP++VRYY+TF +   LYIVM  +EG  LGE  + +KEK  ++ E R+WKI +QL  ALRYLHK K I+HRDLTP NI++GD D VT+TDFGLAKQ+   S+     S++GT+ Y C
Sbjct:    2 IDIGHYVRDISAYEELVSKLNLLVEDELKQIAENIESINQNKAPLKYIGNYAILDHLGSGAFGCVYK------------------------------------------------LYHPNIVRYYKTFLENDRLYIVMELIEGAPLGEHFSSLKEKHHHFTEERLWKIFIQLCLALRYLHKEKRIVHRDLTPNNIMLGDKDKVTVTDFGLAKQKQENSK---LTSVVGTILYSC 184          
BLAST of Serine/threonine-protein kinase Nek10 vs. Ensembl Human
Match: NEK5 (NIMA related kinase 5 [Source:HGNC Symbol;Acc:HGNC:7748])

HSP 1 Score: 148.673 bits (374), Expect = 6.799e-39
Identity = 93/288 (32.29%), Postives = 154/288 (53.47%), Query Frame = 3
Query: 1416 YVIFELLGSGAFGSVYKAKRKKASAGSYCAIKEVNLSEYQIGSTSQERCDSIYQIASELDIIKKQLRHPHVVRYYRTFNDAQNLYIVMAFLEGISLGEQINCMKEKKENYEETRIWKIVLQLIQALRYLHKSKGIIHRDLTPYNIIIGDNDYVT-ITDFGLAKQRLLESRSRDARSILGTLTYVCPEVIQHHPYGEKADIWALGCIVYQICTLSPPFTAQSELDLVNKICQGEYKKVDQFISTFTRQRLEFSFKMKAFIENAIVVDPKYRYDVLGLSGILVEEILINL 2276
            Y + + +G GAFG  Y AK K  S   +C IKE+N  +  I    QE+  S  ++     I+ ++++HP++V ++ +F +   L+IVM + +G  L ++IN  +++   + E +I    +Q+   L+++H  K I+HRD+   NI +  N  V  + DFG+A  R+L +    AR+ +GT  Y+ PE+ Q+ PY  K DIW+LGC++Y++CTL  PF   +   LV KICQ  +  +             FS ++ + I     V P+ R  +   + IL    L NL
Sbjct:    4 YDVIKAIGQGAFGKAYLAKGK--SDSKHCVIKEINFEKMPI----QEKEASKKEV-----ILLEKMKHPNIVAFFNSFQENGRLFIVMEYCDGGDLMKRIN--RQRGVLFSEDQILGWFVQISLGLKHIHDRK-ILHRDIKAQNIFLSKNGMVAKLGDFGIA--RVLNNSMELARTCIGTPYYLSPEICQNKPYNNKTDIWSLGCVLYELCTLKHPFEGNNLQQLVLKICQAHFAPISP----------GFSRELHSLISQLFQVSPRDRPSI---NSILKRPFLENL 262          
BLAST of Serine/threonine-protein kinase Nek10 vs. Ensembl Celegans
Match: nekl-4 (Serine/threonine-protein kinase D1044.8 [Source:UniProtKB/Swiss-Prot;Acc:P84199])

HSP 1 Score: 284.648 bits (727), Expect = 8.665e-81
Identity = 170/525 (32.38%), Postives = 280/525 (53.33%), Query Frame = 3
Query:  729 DEMRVLIKDFDSIQILLNQVHFEHQEITTHHRFLVEKYTLITKYLLCLLQLVISNEEKRFFRDIGGIPIIXXXXXXXXXXXXXXHYTQESADVIEKYFQIIEVASTFISTLSKNENSSLEIVQKSGIYFLVQFL-----VKIPASYRNAFILQKHIFRALRFLFSLERNRKRFKNIFPAILFETFVDVGHFCENLESYDQLVLVYSNLSEIEKKSIRESIDCSSQKEETKCIRDYVIFELLGSGAFGSVYKAKRKKASAGSYCAIKEVNLSE-YQIGSTSQERCDSIYQIASELDIIKKQLRHPHVVRYYRTFNDAQNLYIVMAFLEGISLGEQINCMKEKKENYEETRIWKIVLQLIQALRYLHKSKGIIHRDLTPYNIIIGDNDYVTITDFGLAKQRLLESRSRDARSILGTLTYVCPEVIQHHPYGEKADIWALGCIVYQICTLSPPFTAQSELDLVNKICQGEYKKVDQFISTFTRQRLEFSFKMKAFIENAIVVDPKYRYDVLGLSGILVEEILINLDQI 2285
            ++ R  I+ +D +  LL  +  ++  +  H  +              L QL   +E       +GGI +I + +S            +     +  +  ++   +  ++ L++  ++   +   +G+Y L + L     V    +  +  +LQ  IFR LR +++ ER+R+  K + P  +FE FVDVG++   L  YDQ+  +Y NL E   + +++    + +++    + +Y + + LG+GAFG VY   RKKA + S    K + L E +      +E   S   + SE+ IIK+QLRHP++VRY R F +   LYIVM  ++G SL + I  MKEKK N+EE +IW +V+Q++ ALRYLHK K I+HRDL P NI++  ++ V ITDFGLAKQ+  E      +S  GT+ Y CPE++Q+ PYGEKADIW+ GC +Y++C L P F + + L L  +I + +Y  +++           +S  ++  I + +  DP  R D+L +SG+    +L  LD +
Sbjct:  242 EQAREQIRIYDGVPTLLGLLSIKNSRLQWHVAW-------------TLAQLAEQHETSLEIAQLGGISLIFAAISN----------PKPPGKAVGDWVAMLTGLTALLAQLAQASSNQQLMSNANGVYILGKLLAIKKNVTTDETIDSWDLLQCSIFRVLRLMYTFERSRQLLKKVLPTEIFEKFVDVGNYNSVLTDYDQIAKMYDNLIEENIEIMKDWETVNERRQAVGEVGEYELLDQLGAGAFGCVYTV-RKKAQSHSENPAKLLALKEIFMTNLNDRESDKSFGDMISEVKIIKQQLRHPNIVRYRRIFVENHRLYIVMDLIQGCSLRDLIITMKEKKGNFEEKKIWAMVVQMMLALRYLHKEKQIVHRDLKPNNIMMTTDERVVITDFGLAKQKGPEY----LKSAAGTIIYSCPEIVQNLPYGEKADIWSFGCCIYEMCQLQPVFHSTNMLTLAMQIVEAKYDPLNEM----------WSDDLRFLITSCLAPDPSARPDILKVSGMCGVRLLEYLDDV 728          
BLAST of Serine/threonine-protein kinase Nek10 vs. Ensembl Celegans
Match: cmk-1 (Calcium/calmodulin-dependent protein kinase type 1 [Source:UniProtKB/Swiss-Prot;Acc:Q9TXJ0])

HSP 1 Score: 126.331 bits (316), Expect = 3.004e-31
Identity = 84/273 (30.77%), Postives = 148/273 (54.21%), Query Frame = 3
Query: 1416 YVIFELLGSGAFGSVYKAKRKKASAGSYCAIKEVNLSEYQIGSTSQERCDSIYQIASELDIIKKQLRHPHVVRYYRTFNDAQNLYIVMAFLEGISLGEQINCMKEKKENYEETRIWKIVLQLIQALRYLHKSKGIIHRDLTPYNIIIGDND---YVTITDFGLAKQRLLESRSRDARSILGTLTYVCPEVIQHHPYGEKADIWALGCIVYQICTLSPPFTAQSELDLVNKICQGEYKKVDQFISTFTRQRLEFSFKMKAFIENAIVVDPKYRY 2225
            Y   ++LG+GAF  V+ A+  K+ AG   A+K ++    +    S E         +E+ +++K LRH ++V+ + T+++ Q +Y+VM  + G  L ++I      K +Y E     ++ Q+++A+ ++H + G++HRDL P N++  + D    + I+DFGL+K       S    +  GT  YV PEV+Q  PYG+  D+W++G I Y +    PPF  +S+ +L  +I +GEY    +F + +  Q    S   K FI + +  DP+ R+
Sbjct:   22 YDFRDVLGTGAFSKVFLAE-SKSDAGQMYAVKCIDKKALKGKEESLE---------NEIKVLRK-LRHNNIVQLFDTYDEKQFVYLVMELVTGGELFDRIVA----KGSYTEQDASNLIRQVLEAVGFMHDN-GVVHRDLKPENLLYYNQDEDSKIMISDFGLSKTE----DSGVMATACGTPGYVAPEVLQQKPYGKAVDVWSIGVIAYILLCGYPPFYDESDANLFAQIIKGEY----EFDAPYWDQ---ISDSAKDFITHLMCCDPEARF 267          
BLAST of Serine/threonine-protein kinase Nek10 vs. Ensembl Celegans
Match: nekl-1 (NEK (NEver in mitosis Kinase) Like [Source:UniProtKB/TrEMBL;Acc:A0A061AD48])

HSP 1 Score: 132.88 bits (333), Expect = 3.432e-31
Identity = 83/264 (31.44%), Postives = 145/264 (54.92%), Query Frame = 3
Query: 1434 LGSGAFGSVYKAKRKKASAGSYCAIKEVNLSEYQIGSTSQERCDSIYQIASELDIIKKQLRHPHVVRYYRTFNDAQNLYIVMAFLEGISLGEQINCMKEKKENY-EETRIWKIVLQLIQALRYLHKSKGIIHRDLTPYNIIIGDNDYVTITDFGLAKQRLLESRSRDARSILGTLTYVCPEVIQHHPYGEKADIWALGCIVYQICTLSPPFTAQSELDLVNKICQGEYKKVDQFISTFTRQRLEFSFKMKAFIENAIVVDPKYR 2222
            +G GAFGS    +R++ S  S   IKE+N+  Y + S SQ R        +E+ ++ + + HP+++ YY +F +   L I M + +G +L +    M  + +N  +E +I  +++Q+  A+ YLH++  ++HRDL   N+ +  + +V I DFG++K    E+ ++ A++++GT  Y+ PE+     Y EK+D+WALGCI+Y++C L   F   +   LVN I    Y  V          +  +S +MK  I   + +DP+ R
Sbjct:  139 VGKGAFGSAVLYRRREDS--SLVIIKEINM--YDLDS-SQRRL-----ALNEVSLLSR-IEHPNIIAYYDSFEEEGVLMIEMEYADGGTLAQ----MLSRTQNLLDEEQIGDMMIQMCSAVAYLHENS-VLHRDLKTANVFLTRDSFVKIGDFGISKIMGTETLAQGAKTVVGTPYYISPEMCSGVSYNEKSDMWALGCILYEMCCLKKAFEGDNLPALVNSIMTCAYTPV----------KGPYSAEMKMVIRELLQLDPQKR 376          
BLAST of Serine/threonine-protein kinase Nek10 vs. Ensembl Celegans
Match: nekl-1 (NEK (NEver in mitosis Kinase) Like [Source:UniProtKB/TrEMBL;Acc:A0A061AD48])

HSP 1 Score: 132.88 bits (333), Expect = 3.545e-31
Identity = 83/264 (31.44%), Postives = 145/264 (54.92%), Query Frame = 3
Query: 1434 LGSGAFGSVYKAKRKKASAGSYCAIKEVNLSEYQIGSTSQERCDSIYQIASELDIIKKQLRHPHVVRYYRTFNDAQNLYIVMAFLEGISLGEQINCMKEKKENY-EETRIWKIVLQLIQALRYLHKSKGIIHRDLTPYNIIIGDNDYVTITDFGLAKQRLLESRSRDARSILGTLTYVCPEVIQHHPYGEKADIWALGCIVYQICTLSPPFTAQSELDLVNKICQGEYKKVDQFISTFTRQRLEFSFKMKAFIENAIVVDPKYR 2222
            +G GAFGS    +R++ S  S   IKE+N+  Y + S SQ R        +E+ ++ + + HP+++ YY +F +   L I M + +G +L +    M  + +N  +E +I  +++Q+  A+ YLH++  ++HRDL   N+ +  + +V I DFG++K    E+ ++ A++++GT  Y+ PE+     Y EK+D+WALGCI+Y++C L   F   +   LVN I    Y  V          +  +S +MK  I   + +DP+ R
Sbjct:  177 VGKGAFGSAVLYRRREDS--SLVIIKEINM--YDLDS-SQRRL-----ALNEVSLLSR-IEHPNIIAYYDSFEEEGVLMIEMEYADGGTLAQ----MLSRTQNLLDEEQIGDMMIQMCSAVAYLHENS-VLHRDLKTANVFLTRDSFVKIGDFGISKIMGTETLAQGAKTVVGTPYYISPEMCSGVSYNEKSDMWALGCILYEMCCLKKAFEGDNLPALVNSIMTCAYTPV----------KGPYSAEMKMVIRELLQLDPQKR 414          
BLAST of Serine/threonine-protein kinase Nek10 vs. Ensembl Celegans
Match: nekl-3 (Serine/threonine-protein kinase nekl-3 [Source:UniProtKB/Swiss-Prot;Acc:G5EFM9])

HSP 1 Score: 123.635 bits (309), Expect = 1.208e-30
Identity = 72/216 (33.33%), Postives = 117/216 (54.17%), Query Frame = 3
Query: 1416 YVIFELLGSGAFGSVYKAKRKKASAGSYCAIKEVNLSEYQIGSTSQERCDSIYQIASELDIIKKQLRHPHVVRYYRTFNDAQNLYIVMAFLEGISLGEQINCMKEKKENYEETRIWKIVLQLIQALRYLHKSKGIIHRDLTPYNIIIGDNDYVTITDFGLAKQRLLESRSRDARSILGTLTYVCPEVIQHHPYGEKADIWALGCIVYQICTLSPPF 2063
            ++I + +G G F  V++A+        + A+K++ + E  +   +++ C        E+D++K QL H +V+RYY +F D   L IV+   E   +   I   K+      E  IWK  +QL +AL ++H SK I+HRD+ P N+ I  N  V + D GL   R   S++  A S++GT  Y+ PE IQ   Y  K+D+W+ GC++Y++  L  PF
Sbjct:   23 FIIEKKIGKGQFSEVFRAQCTWVDL--HVALKKIQVFE-MVDQKARQDC------LKEIDLLK-QLNHVNVIRYYASFIDNNQLNIVLELAEAGDMSRMIKHFKKGGRLIPEKTIWKYFVQLARALAHMH-SKRIMHRDIKPANVFITGNGIVKLGDLGLG--RFFSSKTTAAHSLVGTPYYMSPERIQESGYNFKSDLWSTGCLLYEMAALQSPF 225          
BLAST of Serine/threonine-protein kinase Nek10 vs. Ensembl Fly
Match: Nek2 (gene:FBgn0029970 transcript:FBtr0071142)

HSP 1 Score: 166.392 bits (420), Expect = 4.269e-42
Identity = 86/252 (34.13%), Postives = 146/252 (57.94%), Query Frame = 3
Query: 1401 KCIRDYVIFELLGSGAFGSVYKAKRKKASAGSYCAIKEVNLSEYQIGSTSQERCDSIYQIASELDIIKKQLRHPHVVRYYRTF--NDAQNLYIVMAFLEGISLGEQINCMKEKKENYEETRIWKIVLQLIQALRYLH---KSKGIIHRDLTPYNIIIGDNDYVTITDFGLAKQRLLESRSRDARSILGTLTYVCPEVIQHHPYGEKADIWALGCIVYQICTLSPPFTAQSELDLVNKICQGEYKKVDQFIST 2141
            K ++DY +  ++G+G+FG+ YK + K  S G   A K +N  E       + +CD++    SE+ +++ QL+HP++V+YY      +A+++YIVM    G  L + +   + +++ +EE  IW+++ QL +AL+  H    +  I+HRD+ P NI +       + DFGLA  R+L      A S +GT  Y+ PE+++   Y  K+D+WA+GC+VY++C L PPF  ++   L  KI QGE+ ++    ST
Sbjct:   14 KTLQDYEVLAVMGNGSFGTCYKVRDK--STGELFAWKGMNYDEL-----DEAKCDAL---VSEISVLR-QLQHPNIVQYYHHLVNREAKSVYIVMECCAGGDLAQIVQRARSQRQRFEEPYIWRVLFQLCRALQVCHNKIPNGTILHRDIKPANIFLDAAGNAKLGDFGLA--RMLRRDQSFAASFVGTPHYMSPELVKGRKYDRKSDVWAVGCLVYEMCALRPPFRGRAFDQLSEKIAQGEFSRIPAIYST 252          
BLAST of Serine/threonine-protein kinase Nek10 vs. Ensembl Fly
Match: CG12069 (gene:FBgn0039796 transcript:FBtr0085728)

HSP 1 Score: 123.635 bits (309), Expect = 4.402e-30
Identity = 98/341 (28.74%), Postives = 166/341 (48.68%), Query Frame = 3
Query: 1377 CSSQKEETKCIRDYVIFELLGSGAFGSVYKAKRKKASAGSYCAIKEVNLSEYQIGSTSQERCDSIYQIASELDIIKKQLRHPHVVRYYRTFNDAQNLYIVMAFLEGISLGEQINCMKEKKENYEETRIWKIVLQLIQALRYLHKSKGIIHRDLTPYNIIIGDNDYVTITDFGLAKQRLLESRSRDARSILGTLTYVCPEVIQHHPYGEKADIWALGCIVYQICTLSPPFTAQSE--LDLVNKICQGEYKKVDQFISTFTRQRLEFSFKMKAFIENAIVVDPKYRYDVLGLSGILVEEILINLDQIEHLLNKEIQSKKRLENQINE------SNANKLSMFD 2375
             ++    +  + DY I   LGSG+FG V   + +++  G Y A K+  LS+ QI  T Q     +  + SE ++++  +  P+ V    ++ D  +LY+V+  + G   GE     + K   + E +      Q+  AL YLH    +++RDL P NI++  N Y+ +TDFG AK+  +E+R+    ++ GT  Y+ PE+IQ  PYG   D WA G +V++      PF+A +   + + NKIC+ +YK     + ++      FS  ++  +++ + VD   R+  L         I  N D  EH   K+++    L   +N       SN   +S FD
Sbjct:   34 ATNTPSPSTGLDDYEIKATLGSGSFGKVQLVRERES--GVYYASKQ--LSKDQIVKTKQ-----VSHVMSEKNVLR-SMTFPNTVNLIASYKDFDSLYLVLPLIGG---GELFTYHR-KVRKFTEKQARFYAAQVFLALEYLHHC-SLLYRDLKPENIMMDKNGYLKVTDFGFAKK--VETRTM---TLCGTPEYLPPEIIQSKPYGTSVDWWAFGVLVFEFVAGHSPFSAHNRDVMSMYNKICEADYK-----MPSY------FSGALRHLVDHLLQVDLSKRFGNL---------INGNRDIKEHEWFKDVEWIPLLNQTVNAPYVPNISNPEDISNFD 334          
BLAST of Serine/threonine-protein kinase Nek10 vs. Ensembl Fly
Match: CG12069 (gene:FBgn0039796 transcript:FBtr0335455)

HSP 1 Score: 123.635 bits (309), Expect = 4.402e-30
Identity = 98/341 (28.74%), Postives = 166/341 (48.68%), Query Frame = 3
Query: 1377 CSSQKEETKCIRDYVIFELLGSGAFGSVYKAKRKKASAGSYCAIKEVNLSEYQIGSTSQERCDSIYQIASELDIIKKQLRHPHVVRYYRTFNDAQNLYIVMAFLEGISLGEQINCMKEKKENYEETRIWKIVLQLIQALRYLHKSKGIIHRDLTPYNIIIGDNDYVTITDFGLAKQRLLESRSRDARSILGTLTYVCPEVIQHHPYGEKADIWALGCIVYQICTLSPPFTAQSE--LDLVNKICQGEYKKVDQFISTFTRQRLEFSFKMKAFIENAIVVDPKYRYDVLGLSGILVEEILINLDQIEHLLNKEIQSKKRLENQINE------SNANKLSMFD 2375
             ++    +  + DY I   LGSG+FG V   + +++  G Y A K+  LS+ QI  T Q     +  + SE ++++  +  P+ V    ++ D  +LY+V+  + G   GE     + K   + E +      Q+  AL YLH    +++RDL P NI++  N Y+ +TDFG AK+  +E+R+    ++ GT  Y+ PE+IQ  PYG   D WA G +V++      PF+A +   + + NKIC+ +YK     + ++      FS  ++  +++ + VD   R+  L         I  N D  EH   K+++    L   +N       SN   +S FD
Sbjct:   34 ATNTPSPSTGLDDYEIKATLGSGSFGKVQLVRERES--GVYYASKQ--LSKDQIVKTKQ-----VSHVMSEKNVLR-SMTFPNTVNLIASYKDFDSLYLVLPLIGG---GELFTYHR-KVRKFTEKQARFYAAQVFLALEYLHHC-SLLYRDLKPENIMMDKNGYLKVTDFGFAKK--VETRTM---TLCGTPEYLPPEIIQSKPYGTSVDWWAFGVLVFEFVAGHSPFSAHNRDVMSMYNKICEADYK-----MPSY------FSGALRHLVDHLLQVDLSKRFGNL---------INGNRDIKEHEWFKDVEWIPLLNQTVNAPYVPNISNPEDISNFD 334          
BLAST of Serine/threonine-protein kinase Nek10 vs. Ensembl Fly
Match: CaMKI (gene:FBgn0016126 transcript:FBtr0333670)

HSP 1 Score: 122.094 bits (305), Expect = 2.461e-29
Identity = 83/273 (30.40%), Postives = 145/273 (53.11%), Query Frame = 3
Query: 1416 YVIFELLGSGAFGSVYKAKRKKASAGSYCAIKEVNLSEYQIGSTSQERCDSIYQIASELDIIKKQLRHPHVVRYYRTFNDAQNLYIVMAFLEGISLGEQINCMKEKKENYEETRIWKIVLQLIQALRYLHKSKGIIHRDLTPYNIII---GDNDYVTITDFGLAKQRLLESRSRDARSILGTLTYVCPEVIQHHPYGEKADIWALGCIVYQICTLSPPFTAQSELDLVNKICQGEYKKVDQFISTFTRQRLEFSFKMKAFIENAIVVDPKYRY 2225
            Y +  LLG+GAF  V  A+ K  S G + A+K ++    +    S E         +E+ ++++ L HP++V+   T+ D   +Y+VM  + G  L ++I     +K +Y E     ++ Q+++A+ Y+H+ +G++HRDL P N++     D+  + I+DFGL+K       S    +  GT  YV PEV+   PYG+  D+W++G I Y +    PPF  +++ +L  +I +G++    +F S +     E S   K FI+N + V  + RY
Sbjct:   31 YNLHGLLGTGAFSEVRLAESKD-SPGEHFAVKIIDKKALKGKEESLE---------NEIRVLRR-LTHPNIVQLLETYEDKSKVYLVMELVTGGELFDRI----VEKGSYTEKDASHLIRQILEAVDYMHE-QGVVHRDLKPENLLYYSPDDDSKIMISDFGLSKME----DSGIMATACGTPGYVAPEVLAQKPYGKAVDVWSIGVISYILLCGYPPFYDENDANLFAQILKGDF----EFDSPYWD---EISESAKHFIKNLMCVTVEKRY 276          
BLAST of Serine/threonine-protein kinase Nek10 vs. Ensembl Fly
Match: fu (gene:FBgn0001079 transcript:FBtr0074602)

HSP 1 Score: 126.716 bits (317), Expect = 2.515e-29
Identity = 86/269 (31.97%), Postives = 135/269 (50.19%), Query Frame = 3
Query: 1416 YVIFELLGSGAFGSVYKAKRKKASAGSYCAIKEVNLSEYQIGSTSQERCDSIYQIASELDIIKKQLRHPHVVRYYRTFNDAQNLYIVMAFLEGISLGEQINCMKEKKENYEETRIWKIVLQLIQALRYLHKSKGIIHRDLTPYNIIIGDNDYVTITDFGLAKQRLLESRSRDARSILGTLTYVCPEVIQHHPYGEKADIWALGCIVYQICTLSPPFTAQSELDLVNKICQGEYKKVDQFISTFTRQRLEFSFKMKAFIENAIVVDPKYR 2222
            Y +  ++G G+FG VYKA RK  S     AIK ++    + G  ++E    +  +  E DI + +L+HPHV+    +F    +L++V  F    +L +    +       EE    ++   L+ AL YLH ++ I+HRDL P N+++  N +  + DFGLA+   L +      SI GT  Y+ PE++   PY   AD+W+LGCI Y+     PPF A S L LV  I   + K    + ST T +        ++F++  +  DP  R
Sbjct:    4 YAVSSMVGQGSFGCVYKATRKDDS--KVVAIKVIS----KRGRATKE----LKNLRRECDI-QARLKHPHVIEMIESFESKTDLFVVTEF----ALMDLHRYLSYNGAMGEEP-ARRVTGHLVSALYYLHSNR-ILHRDLKPQNVLLDKNMHAKLCDFGLARNMTLGTHV--LTSIKGTPLYMAPELLAEQPYDHHADMWSLGCIAYESMAGQPPFCASSILHLVKMIKHEDVK----WPSTLTSE-------CRSFLQGLLEKDPGLR 242          
BLAST of Serine/threonine-protein kinase Nek10 vs. Ensembl Zebrafish
Match: nek10 (NIMA-related kinase 10 [Source:ZFIN;Acc:ZDB-GENE-130530-570])

HSP 1 Score: 321.627 bits (823), Expect = 4.135e-94
Identity = 177/471 (37.58%), Postives = 274/471 (58.17%), Query Frame = 3
Query:  981 HYTQESA-----DVIEKYFQIIEVASTFISTLSKNENSSLEIVQKSGIYFLVQFLVKIPASYRNAFILQKHIFRALRFLFSLERNRKRFKNIFPAILFETFVDVGHFCENLESYDQLVLVYSNLSEIEKKSIRESIDCSSQ-KEETKCIRDYVIFELLGSGAFGSVYKAKRKKASAGSYCAIKEVNLSEYQIGSTSQERCDSIYQIASELDIIKKQLRHPHVVRYYRTFNDAQNLYIVMAFLEGISLGEQINCMKEKKENYEETRIWKIVLQLIQALRYLHKSKGIIHRDLTPYNIIIGDNDYVTITDFGLAKQRLLESRSRDARSILGTLTYVCPEVIQHHPYGEKADIWALGCIVYQICTLSPPFTAQSELDLVNKICQGEYKKVDQFISTFTRQRLEFSFKMKAFIENAIVVDPKYRYDVLGLSGILVEEILINLDQ--IEH--LLNKEIQSKKRLENQINESNANKL 2363
            H  Q SA     +  E    +       I+ L  ++ ++  +VQ++G+Y + + ++        A  LQ + FRALRFLFS+ERNR  FK +F   LFE F+DVGH+  ++ +Y+ L      LS  E   +RESI+  +Q +   + +  Y + E LGSGAFGSV+K +  K +  +  A+KEVN      G   + R  S+ +I SE+ IIK+Q+ HP++V+Y++TF +   LYIVM  +EG  L E  + +KEKK+ + E R+W I +Q+  ALRYLHK K IIHRDLTP NI++G+ D VTITDFGLAKQ+   S+     S++GT+ Y CPE++++ PYGEKAD+WA GCI+YQ  TL+PPF + + L L  KI +  Y+ ++            FS ++   I+  +  +   R D++ +S  + + ++  +D   + H  L  +  + +KR +    ESN  ++
Sbjct:  354 HSQQVSAVVCAHETAENTISLQSACCAAITELVLDDTTAHNVVQENGVYIIAKLILPQNGKEPQAKSLQCYAFRALRFLFSMERNRHHFKRLFSPDLFEMFIDVGHYVRDITAYEPLQQKIMLLSPEELDILRESIETVNQNRPPIRVVNGYAVLEHLGSGAFGSVFKVR--KQNGQNILALKEVNFHNPAFGKDKRSRDSSVEKIVSEMTIIKEQMSHPNIVKYFKTFLEGDKLYIVMELIEGAPLAEHFSSLKEKKQTFTEERVWNIFIQICLALRYLHKEKRIIHRDLTPNNIMLGERDKVTITDFGLAKQKQENSK---LTSVVGTILYCCPEIVKNEPYGEKADVWAAGCILYQTVTLNPPFYSANMLSLATKIVEAVYEPLEDKT---------FSERVTDMIKWCLTPNADVRPDIIEVSSRISDIMMRFVDSLCVSHNALERRAERDRKRAQKYFLESNRTRM 810          
BLAST of Serine/threonine-protein kinase Nek10 vs. Ensembl Zebrafish
Match: nek2 (NIMA-related kinase 2 [Source:ZFIN;Acc:ZDB-GENE-040426-752])

HSP 1 Score: 145.206 bits (365), Expect = 1.783e-38
Identity = 87/243 (35.80%), Postives = 136/243 (55.97%), Query Frame = 3
Query: 1413 DYVIFELLGSGAFGSVYKAKRKKASAGSYCAIKEVNLSEYQIGSTSQERCDSIYQIASELDIIKKQLRHPHVVRYYRTFNDAQN--LYIVMAFLEGISLGEQINCMKEKKENYEETRIWKIVLQLIQALRYLH-KSKG---IIHRDLTPYNIIIGDNDYVTITDFGLAKQRLLESRSRDARSILGTLTYVCPEVIQHHPYGEKADIWALGCIVYQICTLSPPFTAQSELDLVNKICQGEYKKV 2123
            DY +   +G G++G   K KRK  S G       +   E Q+             + SE+++++ +L+HP++VRY+    D  N  LYIVM + EG  L   IN   + K   EE  I +++ QL  AL+  H +S G   ++HRDL P NI +     V + DFGLA  R+L   +  A++ +GT  Y+ PE +    Y EK+DIW+LGC++Y++C LSPPFTA ++ +L  KI +G ++++
Sbjct:    7 DYEVLLTIGCGSYGKCQKIKRK--SDGKVLDYGTMAEGEKQM-------------LVSEVNLLR-ELKHPNIVRYHDRIIDRTNTTLYIVMEYCEGGDLASLINRSIKDKRYLEEEFILRVMAQLSLALKECHGRSNGSSTVLHRDLKPANIFLDAKQNVKLGDFGLA--RILNHDTSFAKTFVGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALSPPFTAYNQTELARKIREGRFRRI 231          
BLAST of Serine/threonine-protein kinase Nek10 vs. Ensembl Zebrafish
Match: nek2 (NIMA-related kinase 2 [Source:ZFIN;Acc:ZDB-GENE-040426-752])

HSP 1 Score: 147.517 bits (371), Expect = 2.514e-37
Identity = 87/243 (35.80%), Postives = 136/243 (55.97%), Query Frame = 3
Query: 1413 DYVIFELLGSGAFGSVYKAKRKKASAGSYCAIKEVNLSEYQIGSTSQERCDSIYQIASELDIIKKQLRHPHVVRYYRTFNDAQN--LYIVMAFLEGISLGEQINCMKEKKENYEETRIWKIVLQLIQALRYLH-KSKG---IIHRDLTPYNIIIGDNDYVTITDFGLAKQRLLESRSRDARSILGTLTYVCPEVIQHHPYGEKADIWALGCIVYQICTLSPPFTAQSELDLVNKICQGEYKKV 2123
            DY +   +G G++G   K KRK  S G     K ++      G            + SE+++++ +L+HP++VRY+    D  N  LYIVM + EG  L   IN   + K   EE  I +++ QL  AL+  H +S G   ++HRDL P NI +     V + DFGLA  R+L   +  A++ +GT  Y+ PE +    Y EK+DIW+LGC++Y++C LSPPFTA ++ +L  KI +G ++++
Sbjct:    7 DYEVLLTIGCGSYGKCQKIKRK--SDGKILVWKVLDYGTMAEGEKQM--------LVSEVNLLR-ELKHPNIVRYHDRIIDRTNTTLYIVMEYCEGGDLASLINRSIKDKRYLEEEFILRVMAQLSLALKECHGRSNGSSTVLHRDLKPANIFLDAKQNVKLGDFGLA--RILNHDTSFAKTFVGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALSPPFTAYNQTELARKIREGRFRRI 236          
BLAST of Serine/threonine-protein kinase Nek10 vs. Ensembl Zebrafish
Match: nek2 (NIMA-related kinase 2 [Source:ZFIN;Acc:ZDB-GENE-040426-752])

HSP 1 Score: 147.517 bits (371), Expect = 2.514e-37
Identity = 87/243 (35.80%), Postives = 136/243 (55.97%), Query Frame = 3
Query: 1413 DYVIFELLGSGAFGSVYKAKRKKASAGSYCAIKEVNLSEYQIGSTSQERCDSIYQIASELDIIKKQLRHPHVVRYYRTFNDAQN--LYIVMAFLEGISLGEQINCMKEKKENYEETRIWKIVLQLIQALRYLH-KSKG---IIHRDLTPYNIIIGDNDYVTITDFGLAKQRLLESRSRDARSILGTLTYVCPEVIQHHPYGEKADIWALGCIVYQICTLSPPFTAQSELDLVNKICQGEYKKV 2123
            DY +   +G G++G   K KRK  S G     K ++      G            + SE+++++ +L+HP++VRY+    D  N  LYIVM + EG  L   IN   + K   EE  I +++ QL  AL+  H +S G   ++HRDL P NI +     V + DFGLA  R+L   +  A++ +GT  Y+ PE +    Y EK+DIW+LGC++Y++C LSPPFTA ++ +L  KI +G ++++
Sbjct:    7 DYEVLLTIGCGSYGKCQKIKRK--SDGKILVWKVLDYGTMAEGEKQM--------LVSEVNLLR-ELKHPNIVRYHDRIIDRTNTTLYIVMEYCEGGDLASLINRSIKDKRYLEEEFILRVMAQLSLALKECHGRSNGSSTVLHRDLKPANIFLDAKQNVKLGDFGLA--RILNHDTSFAKTFVGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALSPPFTAYNQTELARKIREGRFRRI 236          
BLAST of Serine/threonine-protein kinase Nek10 vs. Ensembl Zebrafish
Match: nek12 (NIMA-related kinase 12 [Source:ZFIN;Acc:ZDB-GENE-050410-11])

HSP 1 Score: 144.821 bits (364), Expect = 3.901e-36
Identity = 83/239 (34.73%), Postives = 136/239 (56.90%), Query Frame = 3
Query: 1434 LGSGAFGSVYKAKRKKASAGSYCAIKEVNLSEYQIGSTSQERCDSIYQIASELDIIKKQLRHPHVVRYYRTFNDAQN--LYIVMAFLEGISLGEQINCMKEKK--ENYEETRIWKIVLQLIQALRYLHKSKGIIHRDLTPYNIIIGDNDYVTITDFGLAKQRLLESRSRDARSILGTLTYVCPEVIQHHPYGEKADIWALGCIVYQICTLSPPFTAQSELDLVNKICQGEYKKVDQFIS 2138
            LG G  G V  +  K       CA+K +++   +   T     D + Q A    I+ + L+HPH++ +  TF DA N  +YIVM + +G +L + I   KE+K  E++ E+ I    +Q++ A+ Y+H  K I+HRD+ P N+++     + + DFG++K  ++      A + +GT +Y+ PE+ Q  PY  K+DIWA+GC++Y++C L P F A++ L L  KI +GEY KV +  S
Sbjct:   10 LGQGGAGVV--SLMKHVDTKKLCAVKRIHVDSSRKTKTK----DVVLQEA----IVLRSLKHPHIITWIDTFFDATNESIYIVMDYCDGGTLDDHI---KEQKCGEHFTESNIMDWFVQVVMAVSYIHSEK-ILHRDIKPSNVLLTKRGVIKLGDFGISK--IMNHTLDMASTCVGTPSYLSPELCQDVPYSTKSDIWAVGCLLYELCALKPAFQAKNLLSLFYKIIKGEYIKVPEMYS 232          
BLAST of Serine/threonine-protein kinase Nek10 vs. Ensembl Xenopus
Match: NEK10 (NIMA-related kinase 10 [Source:NCBI gene;Acc:100489398])

HSP 1 Score: 337.035 bits (863), Expect = 1.245e-100
Identity = 185/467 (39.61%), Postives = 284/467 (60.81%), Query Frame = 3
Query:  981 HYTQESADVIEKYFQIIEVASTFISTLSKNENSSLEIVQKSGIYFLVQFLVKIPASYRNAFILQKHIFRALRFLFSLERNRKRFKNIFPAILFETFVDVGHFCENLESYDQLVLVYSNLSEIEKKSIRESIDCSSQ-KEETKCIRDYVIFELLGSGAFGSVYKAKRKKASAGSYCAIKEVNLSEYQIGSTSQERCDSIYQIASELDIIKKQLRHPHVVRYYRTFNDAQNLYIVMAFLEGISLGEQINCMKEKKENYEETRIWKIVLQLIQALRYLHKSKGIIHRDLTPYNIIIGDNDYVTITDFGLAKQRLLESRSRDARSILGTLTYVCPEVIQHHPYGEKADIWALGCIVYQICTLSPPFTAQSELDLVNKICQGEYKKVDQFISTFTRQRLEFSFKMKAFIENAIVVDPKYRYDVLGLSGILVEEILINLD-------QIEHLLNKEIQSKKRLENQINESNAN 2357
            H     +++ E    +       ++ L  N+ ++ +IVQ++G+Y + + +  +P     +   + + FRALRFLFS+ERNR  FK  FP  LFE F+D+GH+  ++++Y+ LVL  +++ E E K I +SI+  +Q K  TK I +Y I + LGSGAFGSV K K++  S  +  A+KE+NL     G   ++R +S   I SEL II++QL HP++VRYY+TF ++  LYI+M  +EG  LGE    +KEKK+ + E RIW I +QL  ALRYLHK K I+HRDLTP NI++G+ D VT+TDFGLAKQ+   S+     S++GT+ Y CPEV++  PYGEKAD+WA GCI+Y++  L PPF + + L L +KI +  Y+ V + I         +S K+K  I   +  D + R D++ +  ++ + ++  +D        +E  L +E   +KR +  + E+N N
Sbjct:  293 HEDLSPSEIQENKLSLQAACCAALTELVLNDTNAHQIVQENGVYIIGRLI--LPNKQHESIRNKCYAFRALRFLFSMERNRDLFKRFFPPNLFEVFIDIGHYIRDIKAYEDLVLKLNSVMEAELKQIADSIESINQNKTPTKFIGNYAILDHLGSGAFGSVCKVKKR--SGQNLFAMKEINLHNPAFGKDKKDRDNSAESIVSELTIIREQLCHPNIVRYYKTFLESDKLYILMELIEGAPLGEHFKSLKEKKQIFSEERIWNIFIQLCLALRYLHKEKRIVHRDLTPNNIMLGERDKVTVTDFGLAKQKQENSK---LTSVVGTILYSCPEVVKSEPYGEKADVWAAGCILYEMAALIPPFHSTNMLSLASKIVEAVYEPVPEGI---------YSEKVKHVITRCLTSDAELRPDIVEVCSLISDVMMKYVDGLSSCQLTMERKLERE---RKRAQKYLMETNKN 740          
BLAST of Serine/threonine-protein kinase Nek10 vs. Ensembl Xenopus
Match: mmp9.1 (matrix metallopeptidase 9 gene 1 [Source:Xenbase;Acc:XB-GENE-876295])

HSP 1 Score: 155.606 bits (392), Expect = 5.667e-40
Identity = 93/247 (37.65%), Postives = 146/247 (59.11%), Query Frame = 3
Query: 1407 IRDYVIFELLGSGAFGSVYKAKRKKASAGSYCAIKEVNLSEYQIGSTSQERCDSIYQIASELDIIKKQLRHPHVVRYYRTFNDAQN--LYIVMAFLEGISLGEQI-NCMKEKKENY-EETRIWKIVLQLIQALRYLHK-SKG---IIHRDLTPYNIIIGDNDYVTITDFGLAKQRLLESRSRDARSILGTLTYVCPEVIQHHPYGEKADIWALGCIVYQICTLSPPFTAQSELDLVNKICQGEYKKV 2123
            + DY +   +GSG++G   K +R+  S G     KE++   Y   + ++++      + SE+++++ +L+HP++VRYY    D  N  LYIVM + EG  L   I  C KE+   Y EE  I +I  QL  AL+  HK S G   ++HRDL P NI +   + V + DFGLA  R+L   S  A++ +GT  Y+ PE +    Y EK+DIW+LGC++Y++C LSPPFTA ++ +L  KI +G ++++
Sbjct:    5 VEDYEVLYTIGSGSYGKCQKIRRR--SDGKLLVWKELD---YGTMTEAEKQ-----MLVSEVNLLR-ELKHPNIVRYYDRIIDRTNTTLYIVMEYCEGGDLASLIAKCTKERYRQYLEEDFILRIFSQLALALKDCHKRSDGGHTVLHRDLKPANIFLDAKNNVKLGDFGLA--RILHHDSSFAKTFVGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALSPPFTAYNQKELAEKIREGRFRRI 238          
BLAST of Serine/threonine-protein kinase Nek10 vs. Ensembl Xenopus
Match: sez6l2 (seizure related 6 homolog like 2 [Source:Xenbase;Acc:XB-GENE-921456])

HSP 1 Score: 149.058 bits (375), Expect = 5.232e-39
Identity = 82/237 (34.60%), Postives = 140/237 (59.07%), Query Frame = 3
Query: 1416 YVIFELLGSGAFGSVYKAKRKKASAGSYCAIKEVNLSEYQIGSTSQERCDSIYQIASELDIIKKQLRHPHVVRYYRTFNDAQNLYIVMAFLEGISLGEQINCMKEKKENYEETRIWKIVLQLIQALRYLHKSKGIIHRDLTPYNIIIGDNDYVT-ITDFGLAKQRLLESRSRDARSILGTLTYVCPEVIQHHPYGEKADIWALGCIVYQICTLSPPFTAQSELDLVNKICQGEYKKV 2123
            Y I  ++G GAFG  Y AK K  S    C IKE+NLS+      ++E+  S  ++     ++  +++HP++V ++ +  +   LYIVM + +G  L +++N  K++   +EE +I    +Q+   L+++H  K ++HRD+   NI + +N  +  + DFG+A  R+L +    AR+ +GT  Y+ PE+ ++ PY  K DIW+LGC++Y++C L  PF A S   LV KIC+G Y+ +
Sbjct:    4 YDIVRMIGEGAFGKAYLAKGK--SDNMQCVIKEINLSKM----PTKEKEASHKEV-----VLLAKMKHPNIVTFFSSIEERNKLYIVMEYCDGGDLMKRVN--KQRGVLFEEDQILSWFVQISLGLKHIHDRK-VLHRDIKAQNIFLSNNGTLAKLGDFGIA--RMLNNTMELARTCVGTPYYLSPEICENKPYNNKTDIWSLGCVLYELCALKHPFEASSLRQLVLKICRGRYEPI 224          
BLAST of Serine/threonine-protein kinase Nek10 vs. Ensembl Xenopus
Match: nek7 (NIMA-related kinase 7 [Source:NCBI gene;Acc:780029])

HSP 1 Score: 131.724 bits (330), Expect = 4.965e-33
Identity = 92/307 (29.97%), Postives = 152/307 (49.51%), Query Frame = 3
Query: 1329 SNLSEIEKKSIRESIDCSSQKEETKC----IRDYVIFELLGSGAFGSVYKAKRKKASAGSYCAIKEVNLSEYQIGSTSQERCDSIYQIASELDIIKKQLRHPHVVRYYRTFNDAQNLYIVMAFLEGISLGEQINCMKEKKENYEETRIWKIVLQLIQALRYLHKSKGIIHRDLTPYNIIIGDNDYVTITDFGLAKQRLLESRSRDARSILGTLTYVCPEVIQHHPYGEKADIWALGCIVYQICTLSPPFTAQSE--LDLVNKICQGEYKKVDQFISTFTRQRLEFSFKMKAFIENAIVVDPKYRYDV 2231
            S+LSE     +  ++DC S+          + ++ I +++G G F  VY+A       G   A+K+V + +      ++ R D I     E+D++K QL HP+V++YY +F +   L IV+   +   L   I   K++K    E  +WK  +QL  AL ++H S+ ++HRD+ P N+ I     V + D GL   R   S++  A S++GT  Y+ PE I  + Y  K+DIW+LGC++Y++  L  PF         L  KI Q +Y  +             +S +++  +   I  DP+ R DV
Sbjct:    4 SSLSEQTPGPL--AVDCHSKALRPDMGYNILANFQIGKMIGRGQFSEVYRAT--CLLDGVPVALKKVQIFDLM---DAKARADCI----KEIDLLK-QLNHPNVIKYYASFIEDNELNIVLELADAGDLSRMIKHFKKQKRLIPEKTVWKYFVQLCSALEHMH-SRRVMHRDIKPANVFITATGVVKLGDLGLG--RFFSSKTTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLYSLCKKIEQCDYPPLPSD---------HYSEELRMLVNTCINPDPEKRPDV 286          
BLAST of Serine/threonine-protein kinase Nek10 vs. Ensembl Xenopus
Match: nek1 (NIMA-related kinase 1 [Source:NCBI gene;Acc:100036653])

HSP 1 Score: 139.813 bits (351), Expect = 7.248e-33
Identity = 89/253 (35.18%), Postives = 140/253 (55.34%), Query Frame = 3
Query: 1416 YVIFELLGSGAFGSVYKAKRKKASAGSYCAIKEVNLSEYQIGSTSQERCDSIYQIASELDIIKKQLRHPHVVRYYRTFNDAQNLYIVMAFLEGISLGEQINCMKEKKENYEETRIWKIVLQLIQALRYLHKSKGIIHRDLTPYNIIIGDNDYVTITDFGLAKQRLLESRSRDARSILGTLTYVCPEVIQHHPYGEKADIWALGCIVYQICTLSPPFTAQSELDLVNKICQGEYKKVDQFISTFTRQRLEFSFK 2174
            YV    +G G+FG     K K    G    IKE+ +S+     +++ER +S  ++A     +   ++HP++V+Y  +F ++  LYIVM + EG  L ++IN   +K   + E +I    +QL  AL+++H  K I+HRD+   NI +     + + DFG+A  R+L S    AR+ +GT  Y+ PE+ ++ PY  K+DIWALGC++Y++CTL   F A +  +LV KI +G Y  V    S   R  L   FK
Sbjct:    4 YVRVSKIGEGSFGKAILVKSK--DDGKQYVIKEIGISKM----SNKEREESRREVA-----VLANMKHPNIVQYQESFEESGCLYIVMDYCEGGDLFKRINS--QKGVLFSEDQILDWFVQLCLALKHVHDRK-ILHRDIKSQNIFLTKGGTIQLGDFGIA--RVLNSTVELARTCIGTPYYLSPEICENRPYNNKSDIWALGCVLYEMCTLKHAFEAGNMKNLVLKIIRGSYPPVSVHYSYDLRNLLSMLFK 240          
BLAST of Serine/threonine-protein kinase Nek10 vs. Ensembl Mouse
Match: Nek10 (NIMA (never in mitosis gene a)- related kinase 10 [Source:MGI Symbol;Acc:MGI:2685128])

HSP 1 Score: 352.829 bits (904), Expect = 5.259e-104
Identity = 186/434 (42.86%), Postives = 271/434 (62.44%), Query Frame = 3
Query:  996 SADVIEKYFQIIEVASTFISTLSKNENSSLEIVQKSGIYFLVQFLVKIPASYRNAF---ILQKHIFRALRFLFSLERNRKRFKNIFPAILFETFVDVGHFCENLESYDQLVLVYSNLSEIEKKSIRESIDCSSQKEET-KCIRDYVIFELLGSGAFGSVYKAKRKKASAGSYCAIKEVNLSEYQIGSTSQERCDSIYQIASELDIIKKQLRHPHVVRYYRTFNDAQNLYIVMAFLEGISLGEQINCMKEKKENYEETRIWKIVLQLIQALRYLHKSKGIIHRDLTPYNIIIGDNDYVTITDFGLAKQRLLESRSRDARSILGTLTYVCPEVIQHHPYGEKADIWALGCIVYQICTLSPPFTAQSELDLVNKICQGEYKKVDQFISTFTRQRLEFSFKMKAFIENAIVVDPKYRYDVLGLSGILVEEILINLDQI 2285
              ++ E    +       ++ L+ N+ ++ ++VQ++G+Y + + +  +P    NA    +LQ + FR LRFLFS+ERNR  FK +FP  LFETF+D+GH+  ++ +Y  LV   + L E E K I E+I+  +QK+   K I DY + + LGSGAFG VYK +++  S  +  A+KEVNL     G   ++R  S+  I SEL IIK+QL HP+VVRYY+TF +   LYIVM  +EG  LGE  N +KEK  ++ E R+WKI +QL  ALRYLHK K I+HRDLTP NI++GD D VT+TDFGLAKQ+     S    S++GT+ Y CPEV++  PYGEKAD+WA GCI+YQ+ TLSPPF + + L L  KI +  Y+ V + I         +S K+   I   +  D + R D++ +S ++ + ++  LD++
Sbjct:  377 PGEIEENTVSLQAACCAALTELALNDTNAHQVVQENGVYTIAKLI--LPNKQSNAAQTNLLQCYAFRTLRFLFSMERNRPLFKRLFPTDLFETFIDIGHYVRDIGAYKDLVSQLNLLLEDELKQIAENIESINQKKAPLKYIGDYAVLDHLGSGAFGCVYKVRKR--SGQNLLAMKEVNLHNPAFGKDKKDRDSSVKNIVSELTIIKEQLYHPNVVRYYKTFLENDRLYIVMELIEGAPLGEHFNSLKEKHHHFSEERLWKIFIQLCLALRYLHKEKRIVHRDLTPNNIMLGDKDKVTVTDFGLAKQK---QESSKLTSMVGTILYSCPEVLKSEPYGEKADVWAAGCILYQMATLSPPFCSTNMLSLATKIVEAVYEPVPEGI---------YSEKVTDTIRRCLTPDAEARPDIVEVSSMISDVMMKYLDRL 794          
BLAST of Serine/threonine-protein kinase Nek10 vs. Ensembl Mouse
Match: Nek10 (NIMA (never in mitosis gene a)- related kinase 10 [Source:MGI Symbol;Acc:MGI:2685128])

HSP 1 Score: 352.829 bits (904), Expect = 5.720e-104
Identity = 186/434 (42.86%), Postives = 271/434 (62.44%), Query Frame = 3
Query:  996 SADVIEKYFQIIEVASTFISTLSKNENSSLEIVQKSGIYFLVQFLVKIPASYRNAF---ILQKHIFRALRFLFSLERNRKRFKNIFPAILFETFVDVGHFCENLESYDQLVLVYSNLSEIEKKSIRESIDCSSQKEET-KCIRDYVIFELLGSGAFGSVYKAKRKKASAGSYCAIKEVNLSEYQIGSTSQERCDSIYQIASELDIIKKQLRHPHVVRYYRTFNDAQNLYIVMAFLEGISLGEQINCMKEKKENYEETRIWKIVLQLIQALRYLHKSKGIIHRDLTPYNIIIGDNDYVTITDFGLAKQRLLESRSRDARSILGTLTYVCPEVIQHHPYGEKADIWALGCIVYQICTLSPPFTAQSELDLVNKICQGEYKKVDQFISTFTRQRLEFSFKMKAFIENAIVVDPKYRYDVLGLSGILVEEILINLDQI 2285
              ++ E    +       ++ L+ N+ ++ ++VQ++G+Y + + +  +P    NA    +LQ + FR LRFLFS+ERNR  FK +FP  LFETF+D+GH+  ++ +Y  LV   + L E E K I E+I+  +QK+   K I DY + + LGSGAFG VYK +++  S  +  A+KEVNL     G   ++R  S+  I SEL IIK+QL HP+VVRYY+TF +   LYIVM  +EG  LGE  N +KEK  ++ E R+WKI +QL  ALRYLHK K I+HRDLTP NI++GD D VT+TDFGLAKQ+     S    S++GT+ Y CPEV++  PYGEKAD+WA GCI+YQ+ TLSPPF + + L L  KI +  Y+ V + I         +S K+   I   +  D + R D++ +S ++ + ++  LD++
Sbjct:  377 PGEIEENTVSLQAACCAALTELALNDTNAHQVVQENGVYTIAKLI--LPNKQSNAAQTNLLQCYAFRTLRFLFSMERNRPLFKRLFPTDLFETFIDIGHYVRDIGAYKDLVSQLNLLLEDELKQIAENIESINQKKAPLKYIGDYAVLDHLGSGAFGCVYKVRKR--SGQNLLAMKEVNLHNPAFGKDKKDRDSSVKNIVSELTIIKEQLYHPNVVRYYKTFLENDRLYIVMELIEGAPLGEHFNSLKEKHHHFSEERLWKIFIQLCLALRYLHKEKRIVHRDLTPNNIMLGDKDKVTVTDFGLAKQK---QESSKLTSMVGTILYSCPEVLKSEPYGEKADVWAAGCILYQMATLSPPFCSTNMLSLATKIVEAVYEPVPEGI---------YSEKVTDTIRRCLTPDAEARPDIVEVSSMISDVMMKYLDRL 794          
BLAST of Serine/threonine-protein kinase Nek10 vs. Ensembl Mouse
Match: Nek10 (NIMA (never in mitosis gene a)- related kinase 10 [Source:MGI Symbol;Acc:MGI:2685128])

HSP 1 Score: 352.829 bits (904), Expect = 5.720e-104
Identity = 186/434 (42.86%), Postives = 271/434 (62.44%), Query Frame = 3
Query:  996 SADVIEKYFQIIEVASTFISTLSKNENSSLEIVQKSGIYFLVQFLVKIPASYRNAF---ILQKHIFRALRFLFSLERNRKRFKNIFPAILFETFVDVGHFCENLESYDQLVLVYSNLSEIEKKSIRESIDCSSQKEET-KCIRDYVIFELLGSGAFGSVYKAKRKKASAGSYCAIKEVNLSEYQIGSTSQERCDSIYQIASELDIIKKQLRHPHVVRYYRTFNDAQNLYIVMAFLEGISLGEQINCMKEKKENYEETRIWKIVLQLIQALRYLHKSKGIIHRDLTPYNIIIGDNDYVTITDFGLAKQRLLESRSRDARSILGTLTYVCPEVIQHHPYGEKADIWALGCIVYQICTLSPPFTAQSELDLVNKICQGEYKKVDQFISTFTRQRLEFSFKMKAFIENAIVVDPKYRYDVLGLSGILVEEILINLDQI 2285
              ++ E    +       ++ L+ N+ ++ ++VQ++G+Y + + +  +P    NA    +LQ + FR LRFLFS+ERNR  FK +FP  LFETF+D+GH+  ++ +Y  LV   + L E E K I E+I+  +QK+   K I DY + + LGSGAFG VYK +++  S  +  A+KEVNL     G   ++R  S+  I SEL IIK+QL HP+VVRYY+TF +   LYIVM  +EG  LGE  N +KEK  ++ E R+WKI +QL  ALRYLHK K I+HRDLTP NI++GD D VT+TDFGLAKQ+     S    S++GT+ Y CPEV++  PYGEKAD+WA GCI+YQ+ TLSPPF + + L L  KI +  Y+ V + I         +S K+   I   +  D + R D++ +S ++ + ++  LD++
Sbjct:  377 PGEIEENTVSLQAACCAALTELALNDTNAHQVVQENGVYTIAKLI--LPNKQSNAAQTNLLQCYAFRTLRFLFSMERNRPLFKRLFPTDLFETFIDIGHYVRDIGAYKDLVSQLNLLLEDELKQIAENIESINQKKAPLKYIGDYAVLDHLGSGAFGCVYKVRKR--SGQNLLAMKEVNLHNPAFGKDKKDRDSSVKNIVSELTIIKEQLYHPNVVRYYKTFLENDRLYIVMELIEGAPLGEHFNSLKEKHHHFSEERLWKIFIQLCLALRYLHKEKRIVHRDLTPNNIMLGDKDKVTVTDFGLAKQK---QESSKLTSMVGTILYSCPEVLKSEPYGEKADVWAAGCILYQMATLSPPFCSTNMLSLATKIVEAVYEPVPEGI---------YSEKVTDTIRRCLTPDAEARPDIVEVSSMISDVMMKYLDRL 794          
BLAST of Serine/threonine-protein kinase Nek10 vs. Ensembl Mouse
Match: Nek2 (NIMA (never in mitosis gene a)-related expressed kinase 2 [Source:MGI Symbol;Acc:MGI:109359])

HSP 1 Score: 142.124 bits (357), Expect = 1.651e-35
Identity = 83/245 (33.88%), Postives = 141/245 (57.55%), Query Frame = 3
Query: 1407 IRDYVIFELLGSGAFGSVYKAKRKKASAGSYCAIKEVNLSEYQIGSTSQERCDSIYQIASELDIIKKQLRHPHVVRYYRTFNDAQN--LYIVMAFLEGISLGEQINCMKEKKENYEETRIWKIVLQLIQALRYLHK-SKG---IIHRDLTPYNIIIGDNDYVTITDFGLAKQRLLESRSRDARSILGTLTYVCPEVIQHHPYGEKADIWALGCIVYQICTLSPPFTAQSELDLVNKICQGEYKKV 2123
            + DY +   +G+G++G   K +RK  S G     KE++      GS ++        + SE+++++ +L+HP++V YY    D  N  LYIVM + EG  L   I+   + ++  EE  + +++ QL  AL+  H+ S G   ++HRDL P N+ +     V + DFGLA  R+L   +  A++ +GT  Y+ PE +    Y EK+DIW+LGC++Y++C L PPFTA ++ +L  KI +G ++++
Sbjct:    5 VEDYEVLHSIGTGSYGRCQKIRRK--SDGKILVWKELD-----YGSMTEV---EKQMLVSEVNLLR-ELKHPNIVSYYDRIIDRTNTTLYIVMEYCEGGDLASVISKGTKDRQYLEEEFVLRVMTQLTLALKECHRRSDGGHTVLHRDLKPANVFLDSKHNVKLGDFGLA--RILNHDTSFAKTFVGTPYYMSPEQMSCLSYNEKSDIWSLGCLLYELCALMPPFTAFNQKELAGKIREGRFRRI 236          
BLAST of Serine/threonine-protein kinase Nek10 vs. Ensembl Mouse
Match: Nek2 (NIMA (never in mitosis gene a)-related expressed kinase 2 [Source:MGI Symbol;Acc:MGI:109359])

HSP 1 Score: 142.124 bits (357), Expect = 1.651e-35
Identity = 83/245 (33.88%), Postives = 141/245 (57.55%), Query Frame = 3
Query: 1407 IRDYVIFELLGSGAFGSVYKAKRKKASAGSYCAIKEVNLSEYQIGSTSQERCDSIYQIASELDIIKKQLRHPHVVRYYRTFNDAQN--LYIVMAFLEGISLGEQINCMKEKKENYEETRIWKIVLQLIQALRYLHK-SKG---IIHRDLTPYNIIIGDNDYVTITDFGLAKQRLLESRSRDARSILGTLTYVCPEVIQHHPYGEKADIWALGCIVYQICTLSPPFTAQSELDLVNKICQGEYKKV 2123
            + DY +   +G+G++G   K +RK  S G     KE++      GS ++        + SE+++++ +L+HP++V YY    D  N  LYIVM + EG  L   I+   + ++  EE  + +++ QL  AL+  H+ S G   ++HRDL P N+ +     V + DFGLA  R+L   +  A++ +GT  Y+ PE +    Y EK+DIW+LGC++Y++C L PPFTA ++ +L  KI +G ++++
Sbjct:    5 VEDYEVLHSIGTGSYGRCQKIRRK--SDGKILVWKELD-----YGSMTEV---EKQMLVSEVNLLR-ELKHPNIVSYYDRIIDRTNTTLYIVMEYCEGGDLASVISKGTKDRQYLEEEFVLRVMTQLTLALKECHRRSDGGHTVLHRDLKPANVFLDSKHNVKLGDFGLA--RILNHDTSFAKTFVGTPYYMSPEQMSCLSYNEKSDIWSLGCLLYELCALMPPFTAFNQKELAGKIREGRFRRI 236          
BLAST of Serine/threonine-protein kinase Nek10 vs. UniProt/SwissProt
Match: sp|Q3UGM2|NEK10_MOUSE (Serine/threonine-protein kinase Nek10 OS=Mus musculus OX=10090 GN=Nek10 PE=2 SV=2)

HSP 1 Score: 352.829 bits (904), Expect = 3.678e-103
Identity = 186/434 (42.86%), Postives = 271/434 (62.44%), Query Frame = 3
Query:  996 SADVIEKYFQIIEVASTFISTLSKNENSSLEIVQKSGIYFLVQFLVKIPASYRNAF---ILQKHIFRALRFLFSLERNRKRFKNIFPAILFETFVDVGHFCENLESYDQLVLVYSNLSEIEKKSIRESIDCSSQKEET-KCIRDYVIFELLGSGAFGSVYKAKRKKASAGSYCAIKEVNLSEYQIGSTSQERCDSIYQIASELDIIKKQLRHPHVVRYYRTFNDAQNLYIVMAFLEGISLGEQINCMKEKKENYEETRIWKIVLQLIQALRYLHKSKGIIHRDLTPYNIIIGDNDYVTITDFGLAKQRLLESRSRDARSILGTLTYVCPEVIQHHPYGEKADIWALGCIVYQICTLSPPFTAQSELDLVNKICQGEYKKVDQFISTFTRQRLEFSFKMKAFIENAIVVDPKYRYDVLGLSGILVEEILINLDQI 2285
              ++ E    +       ++ L+ N+ ++ ++VQ++G+Y + + +  +P    NA    +LQ + FR LRFLFS+ERNR  FK +FP  LFETF+D+GH+  ++ +Y  LV   + L E E K I E+I+  +QK+   K I DY + + LGSGAFG VYK +++  S  +  A+KEVNL     G   ++R  S+  I SEL IIK+QL HP+VVRYY+TF +   LYIVM  +EG  LGE  N +KEK  ++ E R+WKI +QL  ALRYLHK K I+HRDLTP NI++GD D VT+TDFGLAKQ+     S    S++GT+ Y CPEV++  PYGEKAD+WA GCI+YQ+ TLSPPF + + L L  KI +  Y+ V + I         +S K+   I   +  D + R D++ +S ++ + ++  LD++
Sbjct:  377 PGEIEENTVSLQAACCAALTELALNDTNAHQVVQENGVYTIAKLI--LPNKQSNAAQTNLLQCYAFRTLRFLFSMERNRPLFKRLFPTDLFETFIDIGHYVRDIGAYKDLVSQLNLLLEDELKQIAENIESINQKKAPLKYIGDYAVLDHLGSGAFGCVYKVRKR--SGQNLLAMKEVNLHNPAFGKDKKDRDSSVKNIVSELTIIKEQLYHPNVVRYYKTFLENDRLYIVMELIEGAPLGEHFNSLKEKHHHFSEERLWKIFIQLCLALRYLHKEKRIVHRDLTPNNIMLGDKDKVTVTDFGLAKQK---QESSKLTSMVGTILYSCPEVLKSEPYGEKADVWAAGCILYQMATLSPPFCSTNMLSLATKIVEAVYEPVPEGI---------YSEKVTDTIRRCLTPDAEARPDIVEVSSMISDVMMKYLDRL 794          
BLAST of Serine/threonine-protein kinase Nek10 vs. UniProt/SwissProt
Match: sp|Q6ZWH5|NEK10_HUMAN (Serine/threonine-protein kinase Nek10 OS=Homo sapiens OX=9606 GN=NEK10 PE=1 SV=3)

HSP 1 Score: 352.829 bits (904), Expect = 8.161e-103
Identity = 192/463 (41.47%), Postives = 286/463 (61.77%), Query Frame = 3
Query: 1002 DVIEKYFQIIEVASTFISTLSKNENSSLEIVQKSGIYFLVQFLVKIPASYRNAF---ILQKHIFRALRFLFSLERNRKRFKNIFPAILFETFVDVGHFCENLESYDQLVLVYSNLSEIEKKSIRESIDCSSQ-KEETKCIRDYVIFELLGSGAFGSVYKAKRKKASAGSYCAIKEVNLSEYQIGSTSQERCDSIYQIASELDIIKKQLRHPHVVRYYRTFNDAQNLYIVMAFLEGISLGEQINCMKEKKENYEETRIWKIVLQLIQALRYLHKSKGIIHRDLTPYNIIIGDNDYVTITDFGLAKQRLLESRSRDARSILGTLTYVCPEVIQHHPYGEKADIWALGCIVYQICTLSPPFTAQSELDLVNKICQGEYKKVDQFISTFTRQRLEFSFKMKAFIENAIVVDPKYRYDVLGLSGILVEEILINLDQIE----HLLNKEIQSKKRLENQINESNANKLS 2366
            ++ E  F +       ++ L  N+ ++ ++VQ++G+Y + + +  +P   +NA    +LQ + FRALRFLFS+ERNR  FK +FP  LFE F+D+GH+  ++ +Y++LV   + L E E K I E+I+  +Q K   K I +Y I + LGSGAFG VYK +  K S  +  A+KEVNL     G   ++R  S+  I SEL IIK+QL HP++VRYY+TF +   LYIVM  +EG  LGE  + +KEK  ++ E R+WKI +QL  ALRYLHK K I+HRDLTP NI++GD D VT+TDFGLAKQ+   S+     S++GT+ Y CPEV++  PYGEKAD+WA+GCI+YQ+ TLSPPF + + L L  KI +  Y+ V + I         +S K+   I   +  D + R D++ +S ++ + ++  LD +      L  K  + ++R +    E+N N ++
Sbjct:  379 EIQENTFSLQAACCAALTELVLNDTNAHQVVQENGVYTIAKLI--LPNKQKNAAKSNLLQCYAFRALRFLFSMERNRPLFKRLFPTDLFEIFIDIGHYVRDISAYEELVSKLNLLVEDELKQIAENIESINQNKAPLKYIGNYAILDHLGSGAFGCVYKVR--KHSGQNLLAMKEVNLHNPAFGKDKKDRDSSVRNIVSELTIIKEQLYHPNIVRYYKTFLENDRLYIVMELIEGAPLGEHFSSLKEKHHHFTEERLWKIFIQLCLALRYLHKEKRIVHRDLTPNNIMLGDKDKVTVTDFGLAKQKQENSK---LTSVVGTILYSCPEVLKSEPYGEKADVWAVGCILYQMATLSPPFYSTNMLSLATKIVEAVYEPVPEGI---------YSEKVTDTISRCLTPDAEARPDIVEVSSMISDVMMKYLDNLSTSQLSLEKKLERERRRTQRYFMEANRNTVT 825          
BLAST of Serine/threonine-protein kinase Nek10 vs. UniProt/SwissProt
Match: sp|P84199|NEKL4_CAEEL (Serine/threonine-protein kinase D1044.8 OS=Caenorhabditis elegans OX=6239 GN=nekl-4 PE=3 SV=2)

HSP 1 Score: 284.648 bits (727), Expect = 1.102e-79
Identity = 170/525 (32.38%), Postives = 280/525 (53.33%), Query Frame = 3
Query:  729 DEMRVLIKDFDSIQILLNQVHFEHQEITTHHRFLVEKYTLITKYLLCLLQLVISNEEKRFFRDIGGIPIIXXXXXXXXXXXXXXHYTQESADVIEKYFQIIEVASTFISTLSKNENSSLEIVQKSGIYFLVQFL-----VKIPASYRNAFILQKHIFRALRFLFSLERNRKRFKNIFPAILFETFVDVGHFCENLESYDQLVLVYSNLSEIEKKSIRESIDCSSQKEETKCIRDYVIFELLGSGAFGSVYKAKRKKASAGSYCAIKEVNLSE-YQIGSTSQERCDSIYQIASELDIIKKQLRHPHVVRYYRTFNDAQNLYIVMAFLEGISLGEQINCMKEKKENYEETRIWKIVLQLIQALRYLHKSKGIIHRDLTPYNIIIGDNDYVTITDFGLAKQRLLESRSRDARSILGTLTYVCPEVIQHHPYGEKADIWALGCIVYQICTLSPPFTAQSELDLVNKICQGEYKKVDQFISTFTRQRLEFSFKMKAFIENAIVVDPKYRYDVLGLSGILVEEILINLDQI 2285
            ++ R  I+ +D +  LL  +  ++  +  H  +              L QL   +E       +GGI +I + +S            +     +  +  ++   +  ++ L++  ++   +   +G+Y L + L     V    +  +  +LQ  IFR LR +++ ER+R+  K + P  +FE FVDVG++   L  YDQ+  +Y NL E   + +++    + +++    + +Y + + LG+GAFG VY   RKKA + S    K + L E +      +E   S   + SE+ IIK+QLRHP++VRY R F +   LYIVM  ++G SL + I  MKEKK N+EE +IW +V+Q++ ALRYLHK K I+HRDL P NI++  ++ V ITDFGLAKQ+  E      +S  GT+ Y CPE++Q+ PYGEKADIW+ GC +Y++C L P F + + L L  +I + +Y  +++           +S  ++  I + +  DP  R D+L +SG+    +L  LD +
Sbjct:  242 EQAREQIRIYDGVPTLLGLLSIKNSRLQWHVAW-------------TLAQLAEQHETSLEIAQLGGISLIFAAISN----------PKPPGKAVGDWVAMLTGLTALLAQLAQASSNQQLMSNANGVYILGKLLAIKKNVTTDETIDSWDLLQCSIFRVLRLMYTFERSRQLLKKVLPTEIFEKFVDVGNYNSVLTDYDQIAKMYDNLIEENIEIMKDWETVNERRQAVGEVGEYELLDQLGAGAFGCVYTV-RKKAQSHSENPAKLLALKEIFMTNLNDRESDKSFGDMISEVKIIKQQLRHPNIVRYRRIFVENHRLYIVMDLIQGCSLRDLIITMKEKKGNFEEKKIWAMVVQMMLALRYLHKEKQIVHRDLKPNNIMMTTDERVVITDFGLAKQKGPEY----LKSAAGTIIYSCPEIVQNLPYGEKADIWSFGCCIYEMCQLQPVFHSTNMLTLAMQIVEAKYDPLNEM----------WSDDLRFLITSCLAPDPSARPDILKVSGMCGVRLLEYLDDV 728          
BLAST of Serine/threonine-protein kinase Nek10 vs. UniProt/SwissProt
Match: sp|P51955|NEK2_HUMAN (Serine/threonine-protein kinase Nek2 OS=Homo sapiens OX=9606 GN=NEK2 PE=1 SV=1)

HSP 1 Score: 148.673 bits (374), Expect = 7.777e-37
Identity = 84/243 (34.57%), Postives = 142/243 (58.44%), Query Frame = 3
Query: 1413 DYVIFELLGSGAFGSVYKAKRKKASAGSYCAIKEVNLSEYQIGSTSQERCDSIYQIASELDIIKKQLRHPHVVRYYRTFNDAQN--LYIVMAFLEGISLGEQINCMKEKKENYEETRIWKIVLQLIQALRYLHK-SKG---IIHRDLTPYNIIIGDNDYVTITDFGLAKQRLLESRSRDARSILGTLTYVCPEVIQHHPYGEKADIWALGCIVYQICTLSPPFTAQSELDLVNKICQGEYKKV 2123
            DY +   +G+G++G   K +RK  S G     KE++      GS ++        + SE+++++ +L+HP++VRYY    D  N  LYIVM + EG  L   I    ++++  +E  + +++ QL  AL+  H+ S G   ++HRDL P N+ +     V + DFGLA  R+L   +  A++ +GT  Y+ PE +    Y EK+DIW+LGC++Y++C L PPFTA S+ +L  KI +G+++++
Sbjct:    7 DYEVLYTIGTGSYGRCQKIRRK--SDGKILVWKELD-----YGSMTEA---EKQMLVSEVNLLR-ELKHPNIVRYYDRIIDRTNTTLYIVMEYCEGGDLASVITKGTKERQYLDEEFVLRVMTQLTLALKECHRRSDGGHTVLHRDLKPANVFLDGKQNVKLGDFGLA--RILNHDTSFAKTFVGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRRI 236          
BLAST of Serine/threonine-protein kinase Nek10 vs. UniProt/SwissProt
Match: sp|Q55BN8|NEK2_DICDI (Probable serine/threonine-protein kinase nek2 OS=Dictyostelium discoideum OX=44689 GN=nek2 PE=1 SV=1)

HSP 1 Score: 145.976 bits (367), Expect = 3.247e-36
Identity = 94/281 (33.45%), Postives = 150/281 (53.38%), Query Frame = 3
Query: 1416 YVIFELLGSGAFGSVYKAKRKKASAGSYCAIKEVNLSEYQIGSTSQERCDSIYQIASELDIIKKQLRHPHVVRYYRTFND--AQNLYIVMAFLEGISLGEQINCMKEKKENYEETRIWKIVLQLIQALRYLHKSKG--IIHRDLTPYNIIIGDNDYVTITDFGLAKQRLLESRSRDARSILGTLTYVCPEVIQHHPYGEKADIWALGCIVYQICTLSPPFTAQSELDLVNKICQGEYKKVDQFISTFTRQRLEFSFKMKAFIENAIVVDPKYRYDVLGLSG 2246
            Y I   LG G+FG V K KRK+   G     KE+           QE+   +  + +E++I++K L+H ++VRYY    D  +  LYI+M    G  L + I   + ++   +E  IW+ +LQ++ AL+ +H  K   I+HRD+ P N+ + +N  + + DFGLAK   + + S  A + +GT  Y+ PE I    Y E++D+W++GC++Y++ TLSPPF A ++  L +KI  G Y  +            ++S  +   I   I VDPK R +V  L G
Sbjct:    4 YEILGALGKGSFGVVSKIKRKED--GRVLVWKEI------CYENMQEKEKQL--LVNEVNILQK-LKHQNIVRYYDRIIDKPSSRLYIIMEHCSGGDLSQLIKKCRNERTYMDEEVIWRTLLQILSALQEIHNRKDGVILHRDIKPGNLFLDENKNIKLGDFGLAK---ILNESLYAHTFVGTPYYMSPEQIHGLKYNERSDVWSVGCLIYEMATLSPPFEATNQAQLTSKIQVGRYNPIPS----------QYSEHLSKVISLMINVDPKSRPNVNELLG 260          
BLAST of Serine/threonine-protein kinase Nek10 vs. TrEMBL
Match: A0A433T9R1 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_013910 PE=4 SV=1)

HSP 1 Score: 394.43 bits (1012), Expect = 1.803e-117
Identity = 234/574 (40.77%), Postives = 342/574 (59.58%), Query Frame = 3
Query:  726 NDEMRVLIKDFDSIQILLNQVHFEHQEITTHHRFLVEKYTLITKYLLCLLQLVISNEEKRFFRDIGGIPIIXXXXXXXXXXXXXXHYTQE---SADVIEK-------------YFQIIEVASTFISTLSKNENSSLEIVQKSGIYFLVQFL----VKIPASYRNAFILQKHIFRALRFLFSLERNRKRFKNIFPAILFETFVDVGHFCENLESYDQLVLVYSNLSEIEKKSIRESIDCSSQKEETKCIR-DYVIFELLGSGAFGSVYKAKRKKASAGSYCAIKEVNLSEYQIGSTSQERCDSIYQIASELDIIKKQLRHPHVVRYYRTFNDAQNLYIVMAFLEGISLGEQINCMKEKKENYEETRIWKIVLQLIQALRYLHKSKGIIHRDLTPYNIIIGDNDYVTITDFGLAKQRLLESRSRDAR--SILGTLTYVCPEVIQHHPYGEKADIWALGCIVYQICTLSPPFTAQSELDLVNKICQGEYKKVDQFISTFTRQRLEFSFKMKAFIENAIVVDPKYRYDVLGLSGIL-------VEEILINLDQIEHLLNKEIQSKKRLENQINESNAN 2357
            + + R  +K  D + ILL+Q+             + +  +L+   + CL+QL    + +   R +GGIP+ILSLL       + +  +     SA V  K              + + +     ++ L  N+ ++ +IVQ +G+Y L   +    V      + A  LQ++ FRALRFLFS+ERNR+ FK +FP+ LFE F+DVGH+   L +Y  L    ++L +     I E+I  ++Q +E    + +Y +FELLGSGAFGSVYK K KK    S+ A+KEVNL     G ++ E+  S+ +I +EL I+K+++RHP++VRYY+TF     LYIVM F+EG  LGE  N ++EKKE ++E+RIW I+LQLI ALRYLHK KGI+HRDLTP NI++G+ND VTITDFGLAKQ+    RS  +R  S++GT+ Y CPEV+Q+H YGEKADIWALGCI+YQ+C L PPF + + L LVNKI  G+Y  + Q          E+S ++   I++ + V P  R D+L LSG L       ++++ I+   +E  L++E   +KR +    E+N N
Sbjct:  320 DSQSREHVKFQDGVPILLSQL-------------ISDNVSLLWHVVWCLVQLCGDADCRDDIRQMGGIPLILSLLHDRKFVSERTEASDSAVASAGVHRKPVSNEEHEEFFEHQYSLRKACCAALAELVLNDTNAQQIVQANGVYSLGLLILPQDVASEKEKKRAVKLQQNAFRALRFLFSMERNRRLFKQLFPSDLFEMFIDVGHYNRELSAYKPLAEKINSLPKEAVNEIAENISNTNQNKEPNSYKGEYAVFELLGSGAFGSVYKVK-KKTGRQSFLALKEVNLQNTAFGKSNTEKAMSVGEITNELKIMKEEMRHPNIVRYYKTFELDDKLYIVMEFIEGAHLGEHFNSLREKKEKFQESRIWDILLQLILALRYLHKEKGIVHRDLTPSNIMLGENDKVTITDFGLAKQK----RSDCSRMTSVVGTILYSCPEVVQNHAYGEKADIWALGCILYQMCVLLPPFNSTNMLTLVNKIVAGDYIPIPQG---------EYSSRLLQTIKSCLSVQPDDRPDILDLSGQLSNILLTKIDDLRISRTALEKKLDRE---RKRTQKHFVEANKN 863          
BLAST of Serine/threonine-protein kinase Nek10 vs. TrEMBL
Match: A0A2T7P8W1 (Protein kinase domain-containing protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_09112 PE=4 SV=1)

HSP 1 Score: 397.127 bits (1019), Expect = 4.130e-116
Identity = 223/567 (39.33%), Postives = 330/567 (58.20%), Query Frame = 3
Query:  732 EMRVLIKDFDSIQILLNQVHFEHQEITTHHRFLVEKYTLITKYLLCLLQLVISNEEK-RFFRDIGGIPI----------------IXXXXXXXXXXXXXXHYTQESADVIEKYFQIIEVASTFISTLSKNENSSLEIVQKSGIYFLVQFLVKIPASYRN-----AFILQKHIFRALRFLFSLERNRKRFKNIFPAILFETFVDVGHFCENLESYDQLVLVYSNLSEIEKKSIRESIDCSSQK-EETKCIRDYVIFELLGSGAFGSVYKAKRKKASAGSYCAIKEVNLSEYQIGSTSQERCDSIYQIASELDIIKKQLRHPHVVRYYRTFNDAQNLYIVMAFLEGISLGEQINCMKEKKENYEETRIWKIVLQLIQALRYLHKSKGIIHRDLTPYNIIIGDNDYVTITDFGLAKQRLLESRSRDARSILGTLTYVCPEVIQHHPYGEKADIWALGCIVYQICTLSPPFTAQSELDLVNKICQGEYKKVDQFISTFTRQRLEFSFKMKAFIENAIVVDPKYRYDVLGLSGILVEEILINLDQIE----HLLNKEIQSKKRLENQINESN 2351
            + R L+K ++   +LL+Q+H E+ ++  H              + CL+ L + + +     R IG IP+                + +           +H T E   ++E+ + +       ++ L  N+ ++ +IVQ +G+Y L   ++  P + +      A  LQ + FRALRFLFS+ERNR+ FK +FPA LFE F+DVGH+ +NL +Y  LV   ++L E     IRE+I   +Q  +    I +Y +FELLG+GAFGSVYK +R  A + S+ A+KE+NL     G  ++E+  S+ +I +EL I+K+ L+HP+VVRY++TF +   LYIVM  +EG +L +  + +KEK   +EE RIW I LQLI ALRYLHK KGI+HRDLTP NI++G+ND VTITDFGLAKQ+   S      SI+GT+ Y CPE++Q+ PYGEKADIWALGCI+YQ+ TL PPF + + L LV KI   EYK +   +         +S ++   + + + V P+ R DVL LSG L + IL+ +D +      L  K  + +KR +    E+N
Sbjct:  285 QSRDLVKQYEGAAVLLSQLHSENVQLLFH-------------IVWCLVYLCMDDPDCCALMRQIGAIPLLLALLQEQKFVTERTDVSTGAISGTGTNGQTHPTPEDVKLVEQQYHLKSACCVVLTELVLNDTNAQQIVQANGMYVLGMLVLPPPPTLKERERKLAKKLQTNAFRALRFLFSMERNRRMFKQVFPAELFEMFIDVGHYNKNLSAYAPLVEKLNSLPENVLDEIRENIQGLNQCCKPNHYIGEYAVFELLGTGAFGSVYKVRRCTARS-SFLAMKELNLQNPAFGKNAREKAQSVGEITNELRIMKESLKHPNVVRYHKTFEENDRLYIVMELIEGATLADHFHSLKEKLTKFEEHRIWNIFLQLILALRYLHKEKGIVHRDLTPNNIMLGENDKVTITDFGLAKQK--RSDCSKMTSIVGTILYSCPEIVQNQPYGEKADIWALGCILYQMATLEPPFFSNNMLTLVKKIVASEYKPIPDGL---------YSERLTNTVRSCLTVSPEARPDVLELSGKLTDLILVYIDNLRITQAGLQRKLDRERKRTQKHFCEAN 826          
BLAST of Serine/threonine-protein kinase Nek10 vs. TrEMBL
Match: V3Z8Z3 (Protein kinase domain-containing protein (Fragment) OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_146005 PE=4 SV=1)

HSP 1 Score: 372.089 bits (954), Expect = 1.111e-112
Identity = 210/534 (39.33%), Postives = 313/534 (58.61%), Query Frame = 3
Query:  747 IKDFDSIQILLNQVHFEHQEITTHHRFLVEKYTLITKYLLCLLQLVISNEEKRFFRDIGGIPI-----------------IXXXXXXXXXXXXXXHYTQESADVIEKYFQIIEVASTFISTLSK---NENSSLEIVQKSGIYFLVQFLVKIPASYRNAFILQKHIFRALRFLFSLERNRKRFKNIFPAILFETFVDVGHFCENLESYDQLVLVYSNLSEIEKKSIRESIDCSSQ-KEETKCIRDYVIFELLGSGAFGSVYKAKRKKASAGSYCAIKEVNLSEYQIGSTSQERCDSIYQIASELDIIKKQLRHPHVVRYYRTFNDAQNLYIVMAFLEGISLGEQINCMKEKKENYEETRIWKIVLQLIQALRYLHKSKGIIHRDLTPYNIIIGDNDYVTITDFGLAKQRLLESRSRDARSILGTLTYVCPEVIQHHPYGEKADIWALGCIVYQICTLSPPFTAQSELDLVNKICQGEYKKVDQFISTFTRQRLEFSFKMKAFIENAIVVDPKYRYDVLGLSGILVEEILINLDQI 2285
            ++D+D I +LL+Q+H E+               L+ + + C++QL   +      R +GGIP+                 I +L         +  Y+ E   + +      E  +T  + L++   N+ ++ +I Q +GIY LV               L  + FR LRFLFS+ERNR  FK +FP  LFE F++VGH+ ++L +Y  LV + +NL + +   IRE++  ++Q +  +K I DY +FELLG+GAFGSVYK K K  S  S+ A+KEVN+     G  S E   S+  I +EL I+K++L+HP++VRYY+TF     LYIVM  +EG  L E +N +KEK+E + E RIW I LQ++ ALRYLHK K I+HRDLTP N+++G++D +TITDFGLAKQ+   +      S++GT+ Y CPE++QH PYGEKADIWA GCI+YQ+CTL PPF + + L LV KI + +YK +          R ++S ++   + + I+V P+ R D+L +S  +V+ ILI  D +
Sbjct:   97 VRDYDGIPVLLSQLHSEN-------------VNLLWQVVWCIVQLCEDSISSTEIRQLGGIPLLLYILVQTDSKLGRVSGIFALSIYLITTQVICLYSSERKLLNDNNENDNEAVATCCAALTELVLNDTNAQQIAQANGIYSLV---------------LCINAFRTLRFLFSMERNRCLFKRLFPVNLFECFINVGHYNKDLSAYIPLVDLINNLPKSKIDEIRENVQETNQNRNPSKYIGDYSVFELLGTGAFGSVYKVK-KTTSGQSFLALKEVNIQNAAFGKNSLEIESSLGDITNELQIMKEELKHPNIVRYYKTFLQGDKLYIVMDLIEGAPLSEHVNSLKEKQERFSEKRIWDIFLQMVLALRYLHKEKNIVHRDLTPGNVMLGEHDKITITDFGLAKQK--RNDCSKMTSVVGTILYSCPEIVQHKPYGEKADIWAFGCILYQLCTLQPPFYSSNMLSLVTKIVEADYKPI---------LRGDYSQRLVDTVNSLIIVKPEDRPDILQVSAKVVDLILIQTDNL 590          
BLAST of Serine/threonine-protein kinase Nek10 vs. TrEMBL
Match: A0A0L8I551 (Protein kinase domain-containing protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22034425mg PE=4 SV=1)

HSP 1 Score: 379.022 bits (972), Expect = 1.014e-109
Identity = 214/549 (38.98%), Postives = 331/549 (60.29%), Query Frame = 3
Query:  726 NDEMRVLIKDFDSIQILLNQVHFEHQEITTHHRFLVEKYTLITKYLLCLLQLVISNEEKRFFRDIGGIPIIXXXXXXXXXXXXXXHYTQESADVIEKYFQIIEVASTF-------ISTLSKNENSSLEIVQKSGIYFLVQFLVKIPASYRNA----FILQKHIFRALRFLFSLERNRKRFKNIFPAILFETFVDVGHFCENLESYDQLVLVYSNLSEIEKKSIRESIDCSSQ-KEETKCIRDYVIFELLGSGAFGSVYKAKRKKASAGSYCAIKEVNLSEYQIGSTSQERCDSIYQIASELDIIKKQLRHPHVVRYYRTFNDAQNLYIVMAFLEGISLGEQINCMKEKKENYEETRIWKIVLQLIQALRYLHKSKGIIHRDLTPYNIIIGDNDYVTITDFGLAKQRLLESRSRDARSILGTLTYVCPEVIQHHPYGEKADIWALGCIVYQICTLSPPFTAQSELDLVNKICQGEYKKVDQFISTFTRQRLEFSFKMKAFIENAIVVDPKYRYDVLGLSGILVEEILINLDQIEHLLNKEIQSKKRLENQ 2336
            + + R L+K+++ I +LL+Q+H  + E             L  + + CL+ L      +   + +GGIP++LSLL     +           +   +     E++ +        ++ L  ++ ++ +IV  +GIY L Q ++  P + R       ILQK+ FR LRFLFS+ERNR+ FK + PA L+E F+DVGH+ + L++Y+ L    +NL       I+ ++  + Q K+    I DY +FELLGSG FGSVYK K  KA+  S+ A+KE+NL     G    ER +SI ++ SEL+II++QLRH ++VRYY+TF   Q LYIVM  ++G  L E  N +KEK+  +EE+RIW I++Q++ ALRYLHK KGI+HRDLTP NI+IG+ D VT+TDFGLAK    + + R+  S++GT+ Y CPEVI++ PYGEK DIWALGCIVY++CTL PPF + + L L  KI + +YK V + +         +S ++   I + + V P+ R DV  L+ ++ +++L+++D ++    +E   K++LE +
Sbjct:  256 DQQSRELVKNYEGIPVLLSQLHNSNME-------------LQWQVIWCLVNLSEDANARHEIKQMGGIPLLLSLLQEKITETPSLENGTSGKEAEIQDLNTFELSCSLKSACCAALTELVLDDTNAHQIVLANGIYILGQLILPRPMNDRRKDLAIGILQKNSFRTLRFLFSVERNRRLFKRLLPAELYEMFIDVGHYNKKLDNYEFLGKKINNLPPETIADIKTNLQETDQNKKPNYYIGDYAVFELLGSGGFGSVYKVK--KATGQSFLALKEINLQNPVFGKNETERSNSIGKMISELNIIREQLRHQNIVRYYKTFQLGQKLYIVMELIDGAPLKEHFNSLKEKRCLFEESRIWNILIQMLLALRYLHKEKGIVHRDLTPNNIMIGEQDRVTVTDFGLAKHN--QGKQREMTSVVGTILYSCPEVIKNDPYGEKTDIWALGCIVYEMCTLQPPFFSTNMLTLAKKIVEADYKPVPEKL---------YSAQLLQVISSCLSVKPEDRPDVYQLTALISDKMLLHIDCLQL---RENSLKRKLEKE 775          
BLAST of Serine/threonine-protein kinase Nek10 vs. TrEMBL
Match: A0A1S3I8R1 (serine/threonine-protein kinase Nek10 isoform X4 OS=Lingula unguis OX=7574 GN=LOC106162076 PE=4 SV=1)

HSP 1 Score: 374.785 bits (961), Expect = 9.015e-107
Identity = 213/572 (37.24%), Postives = 329/572 (57.52%), Query Frame = 3
Query:  726 NDEMRVLIKDFDSIQILLNQVHFEHQEITTHHRFLVEKYTLITKYLLCLLQLVISNEEKRFFRDIGGIPII----------------XXXXXXXXXXXXXXHYTQ----ESADVIEKYFQIIEVASTFISTLSKNENSSLEIVQKSGIYFLVQFLVKIPASYRNAF---ILQKHIFRALRFLFSLERNRKRFKNIFPAILFETFVDVGHFCENLESYDQLVLVYSNLSEIEKKSIRESI-DCSSQKEETKCIRDYVIFELLGSGAFGSVYKAKRKKASAGSYCAIKEVNLSEYQIGSTSQERCDSIYQIASELDIIKKQLRHPHVVRYYRTFNDAQNLYIVMAFLEGISLGEQINCMKEKKENYEETRIWKIVLQLIQALRYLHKSKGIIHRDLTPYNIIIGDNDYVTITDFGLAKQRLLESRSRDARSILGTLTYVCPEVIQHHPYGEKADIWALGCIVYQICTLSPPFTAQSELDLVNKICQGEYKKVDQFISTFTRQRLEFSFKMKAFIENAIVVDPKYRYDVLGLSGILVEEILINLDQIE----HLLNKEIQSKKRLENQINESNAN 2357
            + ++R ++K +D + + L+ +H ++ +             L+   + CL+QL    +     R +GGIP+I                 + L+ +       H  Q    E  ++ E+   +       ++ L   + ++ +IVQ + IY L   ++   A+ R++     LQK+ FR LRFLFS+ERNR+ FK +FP  LFE F+D+GH+  ++ +Y  LV   + L   +   IRE+I   +  K   K + +Y + E LGSGAFGSVYK K+K A   S+ A+KEVNL     G +S+E+  S+ +I SEL IIK+QL+HP+VVRYY+TF + + LYIVM ++EG  +G+    +KEK   +EE RIW I +QL+ ALRYLHK + I+HRDL+P NI++G+ D VTITDFGLAKQ+  +  +    S++GT+ Y CPE++QH PYGEKAD+WA+GCI+YQ+CTL+ PF   S L L   I +  Y  + + +         +S K+   I+  +  DP  R D++ ++G++ EEIL +LD I+     L  K  + +KR +    E+N N
Sbjct:  269 DPQVREMVKVYDGVPLYLSLLHSDNIK-------------LLWNVVWCLVQLAEHPDTSDDIRMMGGIPLIISLLQDRKFVSDRTSVSTGLASAAVHGRTPHVVQMTIEEGDEMREQQLSLQAACCAALTELVLTDTNAQQIVQHNCIYLLGLLILPQQAAERDSKAVETLQKNAFRTLRFLFSVERNRRLFKRMFPPELFEMFIDIGHYVRDISAYKPLVDKLNGLPAEQIDEIRENILQTNKDKTPNKFVGEYALIEHLGSGAFGSVYKVKKKTAGQ-SFLALKEVNLQNQMFGRSSKEKDKSVGEIISELTIIKEQLKHPNVVRYYKTFVEEEKLYIVMEYIEGAPIGDHFISLKEKGARFEEARIWHIFIQLVLALRYLHKDRHIVHRDLSPNNILLGEGDQVTITDFGLAKQK--QKDASKMTSVVGTILYACPEIVQHQPYGEKADVWAIGCILYQMCTLNAPFYNTSMLSLAKAIVEASYAPLPEGL---------YSEKVSKTIKCCLTADPSQRPDIVQVAGVIAEEILQHLDLIKANQISLEKKLERERKRTQKHFVEANKN 815          
BLAST of Serine/threonine-protein kinase Nek10 vs. Ensembl Cavefish
Match: nek2 (NIMA related kinase 2 [Source:NCBI gene;Acc:103024375])

HSP 1 Score: 152.525 bits (384), Expect = 2.690e-39
Identity = 88/243 (36.21%), Postives = 148/243 (60.91%), Query Frame = 3
Query: 1416 YVIFELLGSGAFGSVYKAKRKKASAGSYCAIKEVNLSEYQIGSTSQERCDSIYQIASELDIIKKQLRHPHVVRYYRTFNDAQN--LYIVMAFLEGISLGEQIN-CMKEKKENYEETRIWKIVLQLIQALRYLH-KSKG---IIHRDLTPYNIIIGDNDYVTITDFGLAKQRLLESRSRDARSILGTLTYVCPEVIQHHPYGEKADIWALGCIVYQICTLSPPFTAQSELDLVNKICQGEYKKV 2123
            Y +   +GSG++G   K +RK  S G     KE++   Y   + ++++      + SE+++++ +L+HP++VRYY    D  N  LYIVM + EG  L   I+ C+K+++   EE  I +++ QL  AL+  H +S G   ++HRDL P NI +     + + DFGLA  R+L+  +  A++ +GT  Y+ PE +    Y EK+DIW+LGC++Y++C LSPPFTA ++ DL  KI +G+++++
Sbjct:    8 YEVLSTIGSGSYGKCQKIRRK--SDGKILVWKELD---YGTMAEAEKQ-----MLVSEVNLLR-ELKHPNIVRYYDRIIDRTNTTLYIVMEYCEGGDLASLISKCIKDRR-YLEEEFILRMMAQLALALKECHSRSNGGSTVLHRDLKPANIFLDAKQNIKLGDFGLA--RILKHETSFAKTFVGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALSPPFTAHNQRDLAEKIKEGKFRRI 236          
BLAST of Serine/threonine-protein kinase Nek10 vs. Ensembl Cavefish
Match: ENSAMXT00000049860.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000129.1:61559:73217:-1 gene:ENSAMXG00000043136.1 transcript:ENSAMXT00000049860.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 144.05 bits (362), Expect = 7.291e-35
Identity = 82/258 (31.78%), Postives = 149/258 (57.75%), Query Frame = 3
Query: 1407 IRDYVIFELLGSGAFGSVYKAKRKKASAGSYCAIKEVNLSEYQIGSTSQERCDSIYQIASELDIIKKQLRHPHVVRYYRTFNDAQNLYIVMAFLEGISLGEQINCMKEKKENYEETRIWKIVLQLIQALRYLHKSKGIIHRDLTPYNIIIGDN-DYVTITDFGLAKQRLLESRSRDARSILGTLTYVCPEVIQHHPYGEKADIWALGCIVYQICTLSPPFTAQSELDLVNKICQGEYKKVDQFISTFTRQRLEFSFKM 2177
            + +Y +   +G GA+G     + +  +A  +C IK+++ S      + +ER DS      E+ ++ K ++HP++V ++R+FN+  +LYIVM + +G  L ++I+   ++ + ++E +I    +Q+   L+++H  K ++HRD+   NI +      V + DFG+A  RLL +    AR+ +GT  Y+ PE+ ++ PY  K D+W+LGC++Y++CTL  PF   S   L+ +IC+G Y  V Q  S+  R  +   FK+
Sbjct:    1 MNEYELVRQIGHGAYGKALLVRERSGNA-RHCVIKQISWSRM----SPREREDS----KKEVTLLSK-MKHPNIVAFFRSFNERNSLYIVMEYCDGGDLMKKISM--QRGQPFKEQQIMDWFVQICLGLKHIHDRK-VLHRDIKAQNIFLTQGGSKVKLGDFGIA--RLLNNTVELARTCVGTPYYLSPEICENRPYNNKTDMWSLGCVLYELCTLRHPFEGSSLRQLIVRICKGYYTPVSQRYSSDLRTLVSQLFKI 243          
BLAST of Serine/threonine-protein kinase Nek10 vs. Ensembl Cavefish
Match: nek12 (serine/threonine-protein kinase Nek4-like [Source:NCBI gene;Acc:103035324])

HSP 1 Score: 134.035 bits (336), Expect = 9.596e-33
Identity = 87/275 (31.64%), Postives = 145/275 (52.73%), Query Frame = 3
Query: 1434 LGSGAFGSVYKAKRKKASAGSYCAIKEVNLSEYQIGSTSQERCDSIYQIASELDIIKKQLRHPHVVRYYRTFNDAQN--LYIVMAFLEGISLGEQINCMKEKKENYEETRIWKIVLQLIQALRYLHKSKGIIHRDLTPYNIIIGDNDYVTITDFGLAKQRLLESRSRD-ARSILGTLTYVCPEVIQHHPYGEKADIWALGCIVYQICTLSPPFTAQSELDLVNKICQGEYKKVDQFISTFTRQRLEFSFKMKAFIENAIVVDPKYRYDVLGLSGI 2249
            LGSG  G V   + K+ +     A+K + +   +   T +        +  E +I++  L+HPH+V +  TF D  N  +YI M + +G +L +QI   K   E + E    K  +Q++ A+ Y+H SK I+HRD+   NI++     + + DFG++K   + S + D A + +GT  Y+ PE+ Q  PY  K+DIWALGC++Y++CTL P F A++ L+L  KI +GEY               ++S  + + IE  + + P+ R     + G+
Sbjct:   10 LGSGGAGVVLLMRHKETN--KLYAVKRIQVDNSRKTKTKE-------AVLQEAEILR-NLKHPHIVTWSYTFYDTANELIYIAMDYCDGGTLDDQIKGRK-PDEYFSEHVTMKWFVQVLMAVSYIH-SKKILHRDIKTSNILLTKRGMIKLGDFGISK---IMSHTLDMASTCVGTPCYLSPELCQDIPYSTKSDIWALGCLLYELCTLKPAFWARNLLNLFYKILKGEYSPAPD----------QYSKDLHSLIEKMLCLVPENRPSASSILGM 259          
BLAST of Serine/threonine-protein kinase Nek10 vs. Ensembl Cavefish
Match: nek12 (serine/threonine-protein kinase Nek4-like [Source:NCBI gene;Acc:103035324])

HSP 1 Score: 133.65 bits (335), Expect = 1.914e-32
Identity = 87/275 (31.64%), Postives = 145/275 (52.73%), Query Frame = 3
Query: 1434 LGSGAFGSVYKAKRKKASAGSYCAIKEVNLSEYQIGSTSQERCDSIYQIASELDIIKKQLRHPHVVRYYRTFNDAQN--LYIVMAFLEGISLGEQINCMKEKKENYEETRIWKIVLQLIQALRYLHKSKGIIHRDLTPYNIIIGDNDYVTITDFGLAKQRLLESRSRD-ARSILGTLTYVCPEVIQHHPYGEKADIWALGCIVYQICTLSPPFTAQSELDLVNKICQGEYKKVDQFISTFTRQRLEFSFKMKAFIENAIVVDPKYRYDVLGLSGI 2249
            LGSG  G V   + K+ +     A+K + +   +   T +        +  E +I++  L+HPH+V +  TF D  N  +YI M + +G +L +QI   K   E + E    K  +Q++ A+ Y+H SK I+HRD+   NI++     + + DFG++K   + S + D A + +GT  Y+ PE+ Q  PY  K+DIWALGC++Y++CTL P F A++ L+L  KI +GEY               ++S  + + IE  + + P+ R     + G+
Sbjct:   10 LGSGGAGVVLLMRHKETN--KLYAVKRIQVDNSRKTKTKE-------AVLQEAEILR-NLKHPHIVTWSYTFYDTANELIYIAMDYCDGGTLDDQIKGRK-PDEYFSEHVTMKWFVQVLMAVSYIH-SKKILHRDIKTSNILLTKRGMIKLGDFGISK---IMSHTLDMASTCVGTPCYLSPELCQDIPYSTKSDIWALGCLLYELCTLKPAFWARNLLNLFYKILKGEYSPAPD----------QYSKDLHSLIEKMLCLVPENRPSASSILGM 259          
BLAST of Serine/threonine-protein kinase Nek10 vs. Ensembl Cavefish
Match: pdpk1a (3-phosphoinositide-dependent protein kinase 1 [Source:NCBI gene;Acc:103022926])

HSP 1 Score: 132.494 bits (332), Expect = 7.239e-32
Identity = 90/258 (34.88%), Postives = 137/258 (53.10%), Query Frame = 3
Query: 1365 ESIDCSSQKEETKCIRDYVIFELLGSGAFGSVYKAKRKKASAGSYCAIKEVNLSEYQIGSTSQERCDSIYQIASELDIIKKQLRHPHVVRYYRTFNDAQNLYIVMAFLEGISLGEQINCMKEKKENYEETRIWKIVLQLIQALRYLHKSKGIIHRDLTPYNIIIGDNDYVTITDFGLAKQRLLESRSRDARSILGTLTYVCPEVIQHHPYGEKADIWALGCIVYQICTLSPPFTAQSELDLVNKICQGEYKKVDQFIS 2138
            E    S Q +  K   D+   ++LG G+F +V  AK  + S G   AIK +         T   + +  + +  E DI+   L +P  V+ Y TF DA+ LY  +++ +    GE +  ++ K  +++ET       +L+ AL+YLH S GIIHRDL P NI++ +  ++ ITDFG AKQ   +S    A S +GT  YV PE++      + +D+WALGCIVYQ+    PPF A +E  +  KI + EY   ++F  
Sbjct:   49 EPAAPSPQPQRKKRAEDFKFGKILGEGSFSTVVLAK--ELSTGKEYAIKILE-------KTHIRKENKAHYVKRERDILS-SLDNPFFVKLYFTFQDAEKLYFGLSYAKN---GELLRYIR-KIGSFDETCTRFYTAELVSALQYLH-SVGIIHRDLKPENILLNEEMHIQITDFGTAKQFSSDSTQTRANSFVGTAQYVSPELLTKKSACKSSDLWALGCIVYQLVAGLPPFRAANEYLIFQKIIKLEYDFPEKFFP 291          
BLAST of Serine/threonine-protein kinase Nek10 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007414.1 (pep scaffold:Pmarinus_7.0:GL476981:230882:244405:1 gene:ENSPMAG00000006689.1 transcript:ENSPMAT00000007414.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 143.28 bits (360), Expect = 9.693e-38
Identity = 88/272 (32.35%), Postives = 148/272 (54.41%), Query Frame = 3
Query: 1416 YVIFELLGSGAFGSVYKAKRKKASAGSYCAIKEVNLSEYQIGSTSQERCDSIYQIASELDIIKKQLRHPHVVRYYRTFNDAQNLYIVMAFLEGISLGEQINCMKEKKENYEETRIWKIVLQLIQALRYLHKSKGIIHRDLTPYNIIIGDNDYVTITDFGLAKQRLLESRSRDARSILGTLTYVCPEVIQHHPYGEKADIWALGCIVYQICTLSPPFTAQSELDLVNKICQGEYKKVDQFISTFTRQRLEFSFKMKAFIENAIVVDPKYRYDV 2231
            Y +   +G G+FG     K K  + G    IKE+N+S      + +ER ++  ++      +   +RHP++V Y  +F +  NLYIVM + EG  L ++IN   +K   + E +I   ++QL  AL+++H  K I+HRD+   NI +     V + DFG+A  R+L S +  AR+ +GT  Y+ PE+ ++ PY  K+D+WALGC++Y++CTL   F A +  +LV KI +G +  V             +S ++++ +   +  DP+ R  V
Sbjct:    4 YTMVSQIGEGSFGKAMLVKSK--ADGHLYVIKEINISRM----SPKERDEARKEVC-----VLANMRHPNIVSYKESFEERGNLYIVMDYCEGGDLFKRIN--AQKGVLFSEDQILDWLVQLCLALKHVHDRK-ILHRDIKSQNIFLTKAGIVQLGDFGIA--RVLNSTTELARTCIGTPYYLSPEICENKPYNHKSDMWALGCVLYEMCTLRHAFEAGNMKNLVLKIIRGSFPPVSA----------HYSSELRSTLSGLLRRDPRARPPV 249          
BLAST of Serine/threonine-protein kinase Nek10 vs. Ensembl Sea Lamprey
Match: nek2 (NIMA-related kinase 2 [Source:ZFIN;Acc:ZDB-GENE-040426-752])

HSP 1 Score: 134.035 bits (336), Expect = 1.076e-33
Identity = 67/188 (35.64%), Postives = 115/188 (61.17%), Query Frame = 3
Query: 1578 IASELDIIKKQLRHPHVVRYYRTFNDAQN--LYIVMAFLEGISLGEQINCMKEKKENYEETRIWKIVLQLIQALRYLHK----SKGIIHRDLTPYNIIIGDNDYVTITDFGLAKQRLLESRSRDARSILGTLTYVCPEVIQHHPYGEKADIWALGCIVYQICTLSPPFTAQSELDLVNKICQGEYKKV 2123
            + SE+++++ +L+HP++VRY+    D  N  LYIVM + E   L   I+  +  +   EE  + +++ QL+ ALR  H+     + ++HRDL P N+ +     V + DFGLA  R+L+  +  A++ +GT  Y+ PE      Y EK+DIW+LGC++Y++C L PPFTA ++  L  KI +G+++++
Sbjct:   21 LVSEVNLLR-ELKHPNIVRYFDRIIDRSNTTLYIVMEYCECGDLASLISRCRRDRRFLEEEFVLRVLAQLVLALRECHRRTAGGRTVLHRDLKPANVFLDARHNVKLGDFGLA--RILQHDTSFAKTFVGTPYYMSPEQFSRMSYNEKSDIWSLGCLLYELCALVPPFTAMNQKQLAEKIKEGKFRRI 205          
BLAST of Serine/threonine-protein kinase Nek10 vs. Ensembl Sea Lamprey
Match: STK36 (serine/threonine kinase 36 [Source:HGNC Symbol;Acc:HGNC:17209])

HSP 1 Score: 134.035 bits (336), Expect = 5.921e-32
Identity = 92/323 (28.48%), Postives = 163/323 (50.46%), Query Frame = 3
Query: 1407 IRDYVIFELLGSGAFGSVYKAKRKKASAGSYCAIKEVNLSEYQIGSTSQERCDSIYQIASELDIIKKQLRHPHVVRYYRTFNDAQNLYIVMAFLEGISLGEQINCMKEKKENYEETRIWKIVLQLIQALRYLHKSKGIIHRDLTPYNIIIGDNDYVTITDFGLAKQRLLESRSRDARSILGTLTYVCPEVIQHHPYGEKADIWALGCIVYQICTLSPPFTAQSELDLVNKICQGEYKKVDQFISTFTRQRLEFSFKMKAFIENAIVVDPKYRYD---------VLGLSGILVEEILI-NLDQIEHLLNKEIQSKKRLENQINE 2345
            +  Y + E++G G+FG VYK +++    G   A+K +     ++G + +E    +  +  E+DI++  L+HP++V+   +F   + + +V  + EG     ++  + E   N  E ++ +I  QL+ AL YLH  + I+HRD+ P NI++G    V + DFG A  R +   +    SI GT  Y+ PE+++  PY   AD+W++GCI+Y++   +PPF   S   LV+ I +   K      S F           + F++  +  +PK R           V G S I++++I     + +   L+ E+Q++K  E Q  E
Sbjct:    1 MEKYHVLEMIGEGSFGKVYKGRKRYT--GQVVALKFIP----KVGRSDKE----LRNLRREIDIMRG-LQHPNIVQMLDSFETDKEVVVVTDYAEG-----ELFQILEDDGNLPEEQVREIACQLVSALYYLHSHR-ILHRDMKPQNILLGKGGVVKLCDFGFA--RAMSINTLVLTSIKGTPLYMSPELVEEKPYDHTADLWSMGCILYELFVGTPPFYTNSIFQLVSLIIKDPVKWPKNMSSEF-----------RNFLQGLLTKEPKLRLSWPALLHHPFVAGKSSIVLDDISAEETNPLTEDLSPELQAQK--EKQAAE 291          
BLAST of Serine/threonine-protein kinase Nek10 vs. Ensembl Sea Lamprey
Match: pdpk1b (3-phosphoinositide dependent protein kinase 1b [Source:ZFIN;Acc:ZDB-GENE-040426-1820])

HSP 1 Score: 123.25 bits (308), Expect = 1.077e-29
Identity = 89/278 (32.01%), Postives = 148/278 (53.24%), Query Frame = 3
Query: 1413 DYVIFELLGSGAFGSVYKAKRKKASAGSYCAIKEVN----LSEYQIGSTSQERCDSIYQIASELDIIKKQLRHPHVVRYYRTFNDAQNLYIVMAFLEGISLGEQINCMKEKKENYEE--TRIWKIVLQLIQALRYLHKSKGIIHRDLTPYNIIIGDNDYVTITDFGLAKQRLLESRSRDAR--SILGTLTYVCPEVIQHHPYGEKADIWALGCIVYQICTLSPPFTAQSELDLVNKICQGEYKKVDQFISTFTRQRLEFSFKMKAFIENAIVVDPKYR 2222
            D+   ++LG G+F +V  AK  + + G   AIK +     + E ++   ++E+     ++ S L+       HP  V+ + TF D + LY  +++ +    GE +  ++ K  +++E  TR +    Q++ +L +LH S GIIHRDL P NI++ ++ ++ ITDFG AK  +L   S+ AR  S +GT  YV PE++      + +D+WALGCI+YQ+    PPF A +E  +  KI + EY+  ++F             K K  +E  +V DP  R
Sbjct:   23 DFKFGKILGEGSFSTVVLAK--EVATGKEYAIKILEKRHIIKEKKVPYVNREK-----EVLSRLN-------HPFFVKLFFTFQDEEKLYFGLSYAKN---GEMLKYIR-KHRSFDENCTRFYSA--QIVSSLEHLH-SLGIIHRDLKPENILLNEDMHIQITDFGTAK--ILSDNSKHARANSFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAPNEYLIFQKIIKLEYEFPEKFFP-----------KAKDLVEKLLVSDPMQR 266          
BLAST of Serine/threonine-protein kinase Nek10 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002824.1 (pep scaffold:Pmarinus_7.0:GL476598:1893846:1903215:-1 gene:ENSPMAG00000002574.1 transcript:ENSPMAT00000002824.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 118.627 bits (296), Expect = 1.766e-29
Identity = 76/236 (32.20%), Postives = 118/236 (50.00%), Query Frame = 3
Query: 1371 IDCSSQKEETKCIRDYVIFELLGSGAFGSVYKAKRKKASAGSYCAIKEVNLSEYQIGSTSQERCDSIYQIASELDIIKKQLRHPHVVRYYRTFNDAQNLYIVMAFLEGISLGEQINCMKEKKENY-EETRIWKIVLQLIQALRYLHKSKGIIHRDLTPYNIIIGDNDYVTITDFGLAKQRLLESRSRDARSILGTLTYVCPEVIQHHPYGEKADIWALGCIVYQICTLSPPFTAQS 2075
            + CS +K      +D+ +  LLG G+F  VY+A+      G   AIK ++         +  R   + ++ +E++I   QL+HP ++  Y  F D   +Y+V   LE    GE    +K +   + EE    + + ++   L YLH + G+IHRDLT  N+++  +    I DFGLA +  L   SR   ++ GT  Y+ PEV    P+G  AD WALGC  Y +    PPF A +
Sbjct:    2 VTCSGKK----IPKDFQVMNLLGKGSFACVYRAR--SCHTGIEVAIKMID-------KQAMRRAGMVDRVRAEVEI-HSQLKHPAILEMYGCFEDDNYVYLV---LEMCHNGEMSRYLKNQGRPFTEEQEARQFLREISSGLLYLH-AHGVIHRDLTLANLLLASDMSTRIADFGLAARLPLPGESR--LTVCGTPNYMSPEVASRGPHGTPADAWALGCAAYAMLVGRPPFQASA 217          
BLAST of Serine/threonine-protein kinase Nek10 vs. Ensembl Yeast
Match: RAD53 (DNA damage response protein kinase; required for cell-cycle arrest, regulation of copper genes in response to DNA damage; phosphorylates nuclear pores to counteract gene gating, preventing aberrant transitions at forks approaching transcribed genes; activates downstream kinase Dun1p; differentially senses mtDNA depletion, mitochondrial ROS; relocalizes to cytosol under hypoxia; human homolog CHEK2 implicated in breast cancer can complement yeast null mutant [Source:SGD;Acc:S000006074])

HSP 1 Score: 124.405 bits (311), Expect = 1.705e-29
Identity = 92/313 (29.39%), Postives = 154/313 (49.20%), Query Frame = 3
Query: 1332 NLSEIEKKSIRESIDCSSQKEETKCIRDY-VIFELLGSGAFGSVYKAKRKKASAGSYCAIKEVNLSEYQIGSTSQERCDSIYQIASELDIIKKQLRHPHVVRYYRTFNDAQNLYIVMAFLEGISLGEQINCMKEKKENYEETRIWKIVLQLIQALRYLHKSKGIIHRDLTPYNIIIGDND--YVTITDFGLAKQRLLESRSRDARSILGTLTYVCPEVI-------------QHHPYGEKADIWALGCIVYQICTLSPPFTAQSELDLVNKICQGEYKKVDQFISTFTRQRLEFSFKMKAFIENAIVVDPKYR 2222
            N S+I    +  S   S    +T   +D+ +I E++G GAF +V KA  +  + G   A+K +         + ++   ++  +  EL++++K L HP +VR    + D ++ Y+VM F+ G  L + +       E+       +I  Q++ A++Y+H S GI HRDL P NI+I  +D   V ITDFGLAK   ++      ++  GTL YV PEVI             + + Y    D+W++GC+VY I T   PF+  ++  L  +I +G Y +          +    S + + FI++ + VDP  R
Sbjct:  169 NTSKIASPGLTSSTASSMVANKTGIFKDFSIIDEVVGQGAFATVKKAIER--TTGKTFAVKII---------SKRKVIGNMDGVTRELEVLQK-LNHPRIVRLKGFYEDTESYYMVMEFVSGGDLMDFVAAHGAVGEDAGR----EISRQILTAIKYIH-SMGISHRDLKPDNILIEQDDPVLVKITDFGLAK---VQGNGSFMKTFCGTLAYVAPEVIRGKDTSVSPDEYEERNEYSSLVDMWSMGCLVYVILTGHLPFSGSTQDQLYKQIGRGSYHE-------GPLKDFRISEEARDFIDSLLQVDPNNR 454          
BLAST of Serine/threonine-protein kinase Nek10 vs. Ensembl Yeast
Match: TPK2 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; partially redundant with Tpk1p and Tpk3p; localizes to P-bodies during stationary phase; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000006124])

HSP 1 Score: 118.242 bits (295), Expect = 7.100e-29
Identity = 75/240 (31.25%), Postives = 122/240 (50.83%), Query Frame = 3
Query: 1404 CIRDYVIFELLGSGAFGSVYKAKRKKASAGSYCAIKEVNLSEY----QIGSTSQERCDSIYQIASELDIIKKQLRHPHVVRYYRTFNDAQNLYIVMAFLEGISLGEQINCMKEKKENYEETRIWKIVLQLIQALRYLHKSKGIIHRDLTPYNIIIGDNDYVTITDFGLAKQRLLESRSRDARSILGTLTYVCPEVIQHHPYGEKADIWALGCIVYQICTLSPPFTAQSELDLVNKICQGE 2111
             + D+ I   LG+G+FG V+  +      G Y AIK +   +     Q+  T+ ER             + K + HP ++R + TF DA+N+++VM ++EG   GE  + ++ K + +          ++I AL YLH +  II+RDL P NI++  N ++ ITDFG AK+           ++ GT  Y+ PEVI   PY +  D W+LG ++Y++     PF   + +    KI QG+
Sbjct:   66 TLHDFQIMRTLGTGSFGRVHLVR--SVHNGRYYAIKVLKKQQVVKMKQVEHTNDERR------------MLKLVEHPFLIRMWGTFQDARNIFMVMDYIEG---GELFSLLR-KSQRFPNPVAKFYAAEVILALEYLH-AHNIIYRDLKPENILLDRNGHIKITDFGFAKEV-----QTVTWTLCGTPDYIAPEVITTKPYNKSVDWWSLGVLIYEMLAGYTPFYDTTPMKTYEKILQGK 281          
BLAST of Serine/threonine-protein kinase Nek10 vs. Ensembl Yeast
Match: PKH3 (Protein kinase with similarity to mammalian PDK1 and yeast Pkh1p/Phk2p; yeast Pkh1p and Pkh2p are two redundant upstream activators of Pkc1p; identified as a multicopy suppressor of a pkh1 pkh2 double mutant [Source:SGD;Acc:S000002874])

HSP 1 Score: 119.013 bits (297), Expect = 1.183e-27
Identity = 80/258 (31.01%), Postives = 131/258 (50.78%), Query Frame = 3
Query: 1401 KCIRDYVIFELLGSGAFGSVYKAKRKKASAGSY----CAIKEVNLSEYQIGSTSQERCDSIYQIASELDIIKKQLRHPHVVRYYRTFNDAQNLYIVMAFLEGISLGEQINCMKEKKENYEETRIWKIVLQLIQALRYLHKSKGIIHRDLTPYNIIIGDNDYVTITDFGLAKQRLLESRSRDAR----------------SILGTLTYVCPEVIQHHPYGEKADIWALGCIVYQICTLSPPFTAQSELDLVNKICQGEY 2114
            +   D++  E LG G++ +V+KA  KK+    Y    C+ K + + E ++   + E+        + ++++  Q  H  +++ Y TF+D +NLY V+ F  G   GE ++ +  K   + +        QLI AL ++H S GIIHRDL P N+++  +  + ITDFG A   +  S S D+                 S +GT  YV PE++ ++  G  +DIWALGC++YQ     PPF  ++EL    KI   +Y
Sbjct:    6 RSPHDFIFKEELGHGSYSTVFKALDKKSPNKIYAIKVCSKKHI-IKEAKVKYVTIEK--------NTMNLLA-QKHHAGIIKLYYTFHDEENLYFVLDFAPG---GELLSLL-HKMGTFNDIWTRHFTAQLIDALEFIH-SHGIIHRDLKPENVLLDRDGRLMITDFGAAAT-IDPSLSGDSAKFNSDSNGSKDNQNCASFVGTAEYVSPELLLYNQCGYGSDIWALGCMIYQFVQGQPPFRGENELKTFEKIVALDY 247          
BLAST of Serine/threonine-protein kinase Nek10 vs. Ensembl Yeast
Match: CMK1 (Calmodulin-dependent protein kinase; may play a role in stress response, many Ca++/calmodulin dependent phosphorylation substrates demonstrated in vitro, amino acid sequence similar to mammalian Cam Kinase II; CMK1 has a paralog, CMK2, that arose from the whole genome duplication [Source:SGD;Acc:S000001910])

HSP 1 Score: 112.849 bits (281), Expect = 1.162e-26
Identity = 84/275 (30.55%), Postives = 139/275 (50.55%), Query Frame = 3
Query: 1410 RDYVIFELLGSGAFGSVYKAKRKKASAGSYCAIKEVNLSEYQIGSTSQERCDSIYQIASELDIIKKQLRHPHVVRYYRTFNDAQNLYIVMAFLEGISLGEQINCMKEKKENYEETRIWKIVLQLIQALRYLHKSKGIIHRDLTPYNIII---GDNDYVTITDFGLAKQRLLESRSRDARSILGTLTYVCPEVIQHHPYGEKADIWALGCIVYQICTLSPPFTAQSELDLVNKICQGEYKKVDQFISTFTRQRLE-FSFKMKAFIENAIVVDPKYR 2222
            + YV  + LG+G FG V +AK      G   A+K + + +   G+  Q   +++Y    ELDI+++ L HP++V +   F      YI+    +G  L ++I     KK  + E    +I+++++ A++Y+H S+ I+HRDL P N++     D   + + DFG+AK+  L+S         G+L YV PEV+    +G+  DIW++G I Y +      F A+   D +++   GEY         F R   +  S K K FI  A+ +DP  R
Sbjct:   35 KKYVFGKTLGAGTFGVVRQAKN--TETGEDVAVK-ILIKKALKGNKVQ--LEALY---DELDILQR-LHHPNIVAFKDWFESKDKFYIITQLAKGGELFDRIL----KKGKFTEEDAVRILVEILSAVKYMH-SQNIVHRDLKPENLLYIDKSDESPLVVADFGIAKR--LKSDEELLYKPAGSLGYVAPEVLTQDGHGKPCDIWSIGVITYTLLCGYSAFRAERVQDFLDECTTGEYP------VKFHRPYWDSVSNKAKQFILKALNLDPSKR 287          
BLAST of Serine/threonine-protein kinase Nek10 vs. Ensembl Yeast
Match: TPK1 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; inhibited by regulatory subunit Bcy1p in the absence of cAMP; phosphorylates and inhibits Whi3p to promote G1/S phase passage; partially redundant with Tpk2p and Tpk3p; phosphorylates pre-Tom40p, which impairs its import into mitochondria under non-respiratory conditions; TPK1 has a paralog, TPK3, that arose from the whole genome duplication [Source:SGD;Acc:S000003700])

HSP 1 Score: 110.923 bits (276), Expect = 2.254e-26
Identity = 73/240 (30.42%), Postives = 120/240 (50.00%), Query Frame = 3
Query: 1404 CIRDYVIFELLGSGAFGSVYKAKRKKASAGSYCAIK----EVNLSEYQIGSTSQERCDSIYQIASELDIIKKQLRHPHVVRYYRTFNDAQNLYIVMAFLEGISLGEQINCMKEKKENYEETRIWKIVLQLIQALRYLHKSKGIIHRDLTPYNIIIGDNDYVTITDFGLAKQRLLESRSRDARSILGTLTYVCPEVIQHHPYGEKADIWALGCIVYQICTLSPPFTAQSELDLVNKICQGE 2111
             ++D+ I   LG+G+FG V+  + +    G Y A+K    E+ +   Q+  T+ ER          L I+     HP ++R + TF DAQ ++++M ++EG   GE  + ++ K + +          ++  AL YLH SK II+RDL P NI++  N ++ ITDFG AK            ++ GT  Y+ PEV+   PY +  D W+ G ++Y++     PF   + +    KI   E
Sbjct:   83 SLQDFQILRTLGTGSFGRVHLIRSR--HNGRYYAMKVLKKEIVVRLKQVEHTNDERL--------MLSIVT----HPFIIRMWGTFQDAQQIFMIMDYIEG---GELFSLLR-KSQRFPNPVAKFYAAEVCLALEYLH-SKDIIYRDLKPENILLDKNGHIKITDFGFAK-----YVPDVTYTLCGTPDYIAPEVVSTKPYNKSIDWWSFGILIYEMLAGYTPFYDSNTMKTYEKILNAE 298          
BLAST of Serine/threonine-protein kinase Nek10 vs. Ensembl Nematostella
Match: EDO29162 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T4E9])

HSP 1 Score: 342.428 bits (877), Expect = 2.560e-106
Identity = 191/479 (39.87%), Postives = 282/479 (58.87%), Query Frame = 3
Query:  726 NDEMRVLIKDFDSIQILLNQVHFEHQEITTHHRFLVEKYTLITKYLLCLLQLVISNEEKRFFRDIGGIPIIXXXXXXXX----------XXXXXXHYTQESADVI---EKYFQIIEVASTFISTLSKNENSSLEIVQKSGIYFLVQFLVKI-------PASYRNAFILQKHIFRALRFLFSLERNRKRFKNIFPAILFETFVDVGHFCENLESYDQLVLVYSNLSEIEKKSIRESIDCSSQ-KEETKCIRDYVIFELLGSGAFGSVYKAKRKKASAGSYCAIKEVNLSEYQIGSTSQERCDSIYQIASELDIIKKQLRHPHVVRYYRTFNDAQNLYIVMAFLEGISLGEQINCMKEKKENYEETRIWKIVLQLIQALRYLHKSKGIIHRDLTPYNIIIGDNDYVTITDFGLAKQRLLESRSRDARSILGTLTYVCPEVIQHHPYGEKADIWALGCIVYQICTLSPPFTAQSELDLVNKI 2099
            +  +R  +K F+ I I L+ +H+++ +             L+   +  ++QL    +     R +GGIP++L+LL                     + Q   + I   E    I       ++ L  N+ +  +IVQ +G+Y L   ++          A+  N   LQK  FRALRFLFS+ERNR+ FK +FP  LFE F+DVGH+  +L +Y  LV   ++L E +   IR +I   +Q K  T  I  Y + ELLGSGAFGSVYK  RK+ S  S+ A+KEV++S + +G+T+++R  S+ +I +E  I+++QLRHP++VRY++ F + + LYI+M  +EG  LGE  N +KEK   + E RIW I +Q++  LRY+HK K I+HRDLTP NI++G+ND VTITDFGLAKQ+     +    S++GT+ Y CPEV+Q  PYGEKAD+WA GCI+YQ+ TL PPF + + L L  K+
Sbjct:   76 DSSIREQVKVFEGIPICLSLLHYDNLK-------------LLWNLVWIIVQLAEDPDSSNDVRLLGGIPLLLALLQGKALHHHGAGGGRPSWRTLQFAQRKRNSILRGENMAHIYTAVCAALTELVLNDTNGQQIVQHNGVYLLGVLILPQQRETGDEAAAVDN---LQKSAFRALRFLFSMERNRQLFKRVFPPKLFEKFIDVGHYVRDLNAYKGLVEQVNHLPEEDIDIIRNNILAINQNKSATHLIGSYEVLELLGSGAFGSVYKV-RKRHSGQSFLAMKEVSISIHSLGNTAKDRGTSVGEIVNETTIMREQLRHPNIVRYFKAFEEKEKLYIIMELVEGAPLGEHFNSLKEKGTRFSEERIWHIFIQIVLGLRYIHKEKHIVHRDLTPNNIMLGENDKVTITDFGLAKQK--NPDASKMTSVVGTILYSCPEVVQSQPYGEKADVWAAGCILYQMATLQPPFYSSNMLALATKV 535          
BLAST of Serine/threonine-protein kinase Nek10 vs. Ensembl Nematostella
Match: EDO46234 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQV3])

HSP 1 Score: 287.73 bits (735), Expect = 7.457e-85
Identity = 155/366 (42.35%), Postives = 234/366 (63.93%), Query Frame = 3
Query: 1050 ISTLSKNENSSLEIVQKSGIYFLVQFLVKI-------PASYRNAFILQKHIFRALRFLFSLERNRKRFKNIFPAILFETFVDVGHFCENLESYDQLVLVYSNLSEIEKKSIRESIDCSSQ-KEETKCIRDYVIFELLGSGAFGSVYKAKRKKASAGSYCAIKEVNLSEYQIGSTSQERCDSIYQIASELDIIKKQLRHPHVVRYYRTFNDAQNL------YIVMAFLEGISLGEQINCMKEKKENYEETRIWKIVL--QLIQALRYLHKSKGIIHRDLTPYNIIIGDNDYVTITDFGLAKQRLLESRSRDARSILGTLTYVCPEVIQHHPYGEKADIWALGCIVYQICTLSPPFTAQSELDLVNKI 2099
            ++ L  N+ +  +IVQ +G+Y L   ++          A+  N   LQK  FRALRFLFS+ERNR+ FK +FP  LFE F+DVGH+  +L +Y  LV   ++L E +   IR +I   +Q K  T  I  Y + ELLGSGAFGSVYK  RK+ S  S+ A+KEV++S + +G+T+++R  S+ +I +E  I+++QLRHP++VRY++ F +++ +      ++ + + + +    ++  +K+K  N      + I L  +++  LRY+HK K I+HRDLTP NI++G+ND VTITDFGLAKQ+     +    S++GT+ Y CPEV+Q  PYGEKAD+WA GCI+YQ+ TL PPF + + L L  K+
Sbjct:  294 LTELVLNDTNGQQIVQHNGVYLLGVLILPQQRETGDEAAAVDN---LQKSAFRALRFLFSMERNRQLFKRVFPPKLFEKFIDVGHYVRDLNAYKGLVEQVNHLPEEDIDIIRNNILAINQNKSATHLIGSYEVLELLGSGAFGSVYKV-RKRHSGQSFLAMKEVSISIHSLGNTAKDRGTSVGEIVNETTIMREQLRHPNIVRYFKAFEESKFMMMMQVDFVPLRYYKDLYEEFKLKTLKKKMSNQLFCSYYLITLNFRIVLGLRYIHKEKHIVHRDLTPNNIMLGENDKVTITDFGLAKQK--NPDASKMTSVVGTILYSCPEVVQSQPYGEKADVWAAGCILYQMATLQPPFYSSNMLALATKV 653          
BLAST of Serine/threonine-protein kinase Nek10 vs. Ensembl Nematostella
Match: EDO37413 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFU9])

HSP 1 Score: 157.918 bits (398), Expect = 6.004e-43
Identity = 91/254 (35.83%), Postives = 143/254 (56.30%), Query Frame = 3
Query: 1407 IRDYVIFELLGSGAFGSVYKAKRKKASAGSYCAIKEVNLSEYQIGSTSQERCDSIYQIASELDIIKKQLRHPHVVRYYRTFNDAQN--LYIVMAFLEGISLGEQINCMKEKKENYEETRIWKIVLQLIQALRYLHKSKG---IIHRDLTPYNIIIGDNDYVTITDFGLAKQRLLESRSRDARSILGTLTYVCPEVIQHHPYGEKADIWALGCIVYQICTLSPPFTAQSELDLVNKICQGEYKKVDQFISTFTRQ 2153
            + DY   E +GSG++G   K +RKK +       KE++    Q+  T ++       + SE+++++ +L+HPH+VRYY    D  N  +YIVM F E   LG  I   K +K    E  +WK++ QL+ A++  H+ K    ++HRDL P N+ +  N  V + DFGLA  R+L   +  A++ +GT  Y+ PE +    Y EK+DIW+LGC++Y++C LSPPFTA  ++ L  KI  G +  +    S+   Q
Sbjct:    6 LHDYEELERIGSGSYGICKKIRRKKDN--KVLVWKELDYG--QMSETEKQ------MLVSEVNLLR-ELKHPHIVRYYDRIIDRTNTTIYIVMEFCENGDLGALIKKHKREKRYTAEDLVWKLLYQLVLAVQECHRRKDGGHVLHRDLKPANVFLDANMNVKLGDFGLA--RVLSHDTSFAKTFVGTPYYMSPEQVNKRSYNEKSDIWSLGCLMYELCALSPPFTAMDQIRLEAKIKVGRFHPIPSHYSSSLSQ 246          
BLAST of Serine/threonine-protein kinase Nek10 vs. Ensembl Nematostella
Match: EDO49138 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RH03])

HSP 1 Score: 144.821 bits (364), Expect = 1.015e-38
Identity = 84/239 (35.15%), Postives = 135/239 (56.49%), Query Frame = 3
Query: 1416 YVIFELLGSGAFGSVYKAKRKKASAGSYCAIKEVNLSEYQIGSTSQERCDSIYQIASELDIIKKQLRHPHVVRYYRTFNDAQNLYIVMAFLEGISLGEQINCMKEKKENYEETRIWKIVLQLIQALRYLHKSKGIIHRDLTPYNIIIGDNDYVTITDFGLAKQRLLESRSRDARSILGTLTYVCPEVIQHHPYGEKADIWALGCIVYQICTLSPPFTAQSELDLVNKICQGEYKKVDQF 2132
            Y   +++G G FGS +  + +++      A+KE+N +       S++R  ++ ++      I   L+H ++VRY   F +    YIVM + EG  L  +I   K+  E +   RI   + QL+ AL+++H  + I+HRDL   NI +  +D V I DFG+A  R+L+S    AR+ +GT  Y+ PE+ Q  PY  K+DIWALGC++Y++ T + PFTA +  +LV KI  G Y  + +F
Sbjct:    4 YQKIDIIGKGTFGSAWLVESRQSK--RLYALKELNAT----AMPSEDRHLALNEVK-----ILSTLKHRNIVRYRDAFEETGRFYIVMEYAEGGDLHTKI---KQAVEPFSSERILNWLAQLLLALKHIH-GQNILHRDLKTQNIFLTKDDVVKIGDFGIA--RILDSTCDHARTTVGTPYYLSPEICQRQPYNNKSDIWALGCVLYELTTRTHPFTADNLTNLVVKILHGNYPPIPRF 225          
BLAST of Serine/threonine-protein kinase Nek10 vs. Ensembl Nematostella
Match: EDO49822 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG20])

HSP 1 Score: 135.961 bits (341), Expect = 1.905e-35
Identity = 77/236 (32.63%), Postives = 137/236 (58.05%), Query Frame = 3
Query: 1416 YVIFELLGSGAFGSVYKAKRKKASAGSYCAIKEVNLSEYQIGSTSQERCDSIYQIASELDIIKKQLRHPHVVRYYRTFNDAQNLYIVMAFLEGISLGEQINCMKEKKENYEETRIWKIVLQLIQALRYLHKSKGIIHRDLTPYNIIIGDNDYVTITDFGLAKQRLLESRSRDARSILGTLTYVCPEVIQHHPYGEKADIWALGCIVYQICTLSPPFTAQSELDLVNKICQGEYKKV 2123
            YV  + +G G+FG     K++  + G +  IKE+N+   +     +ER +S  ++      +  QL+HP++V Y  +F ++ NLYIVM + +G  L ++IN   ++   + E ++    +Q+   L+++H  K I+HRD+   NI +  +  + + DFG+A  R+L S    AR+ +GT  Y+ PE++++ PY  K+DIW+LGC++Y++ TL   F A +  +LV KI +G Y  +
Sbjct:    4 YVRVKKIGEGSFGKALLVKKR--NDGKHYVIKEINICRMK----PREREESRKEVK-----VLSQLKHPNIVSYQESFEESGNLYIVMDYCDGGDLYKKIN--GQRGIAFSEDQVMDWFVQICLGLKHVHDRK-ILHRDIKSQNIFLTRHGIIKMGDFGIA--RVLHSTVELARTCIGTPYYLSPEIVENRPYNNKSDIWSLGCVLYEMLTLKHAFEAGNMKNLVLKIIRGSYPPI 223          
BLAST of Serine/threonine-protein kinase Nek10 vs. Ensembl Medaka
Match: nek10 (NIMA related kinase 10 [Source:NCBI gene;Acc:101166661])

HSP 1 Score: 339.347 bits (869), Expect = 5.072e-100
Identity = 175/401 (43.64%), Postives = 255/401 (63.59%), Query Frame = 3
Query: 1044 TFISTLSKNENSSLEIVQKSGIYFLVQFLVKIPASYRNAFILQKHIFRALRFLFSLERNRKRFKNIFPAILFETFVDVGHFCENLESYDQLVLVYSNLSEIEKKSIRESIDCSSQ-KEETKCIRDYVIFELLGSGAFGSVYKAKRKKASAGSYCAIKEVNLSEYQIGSTSQERCDSIYQIASELDIIKKQLRHPHVVRYYRTFNDAQNLYIVMAFLEGISLGEQINCMKEKKENYEETRIWKIVLQLIQALRYLHKSKGIIHRDLTPYNIIIGDNDYVTITDFGLAKQRLLESRSRDARSILGTLTYVCPEVIQHHPYGEKADIWALGCIVYQICTLSPPFTAQSELDLVNKICQGEYKKVDQFISTFTRQRLEFSFKMKAFIENAIVVDPKYRYDVLGLS 2243
            T ++ +S +++S+L I+Q++G+Y + + ++        A   Q + FR LRFLFS+ERNR  FK +FP  LFE F+DVGH+  +L +Y++L  V S  +E + + +RE I    Q +   K I  Y I + LG+GAFGSV+K +  K S  +  A+KEVNL     G   + R  ++ +I SEL IIK+Q+ HP++V+YY+TF +   LYIVM  +EG SL E    +KEK+  + E RIW + +Q+  ALRYLHK K I+HRDLTP NI++G+ D VTITDFGLAKQ+   S+     S++GT+ Y CPEV+++ PYGEKADIWALGCI+YQ+ TL PPF + + L L +KI + EY+ V++           FS ++   I   +  D + R DV+ +S
Sbjct:  372 TALTEMSLDDSSALHILQENGVYVIAKLILPEEGGA-TAASQQCYAFRTLRFLFSMERNRPLFKRLFPTDLFEMFIDVGHYVRDLAAYEELQTVVSLYTEEKLEGLREGIRSVDQSRPPVKVISGYSILDHLGTGAFGSVFKVQ--KQSGQNLLALKEVNLHNPAFGKDKRSRDSNVEKIISELTIIKEQMMHPNIVKYYKTFLEGDKLYIVMELIEGTSLAEHFTSLKEKQLQFTEDRIWNVFIQICLALRYLHKEKRIVHRDLTPNNIMLGEKDKVTITDFGLAKQKQENSK---LTSVVGTIVYSCPEVVKNEPYGEKADIWALGCILYQMATLKPPFYSSNMLSLASKIVEAEYEPVEEGA---------FSERVPQMIRWCLAPDAERRPDVVAVS 757          
BLAST of Serine/threonine-protein kinase Nek10 vs. Ensembl Medaka
Match: nek2 (NIMA related kinase 2 [Source:NCBI gene;Acc:101168418])

HSP 1 Score: 162.155 bits (409), Expect = 2.148e-42
Identity = 93/247 (37.65%), Postives = 152/247 (61.54%), Query Frame = 3
Query: 1404 CIRDYVIFELLGSGAFGSVYKAKRKKASAGSYCAIKEVNLSEYQIGSTSQERCDSIYQIASELDIIKKQLRHPHVVRYYRTFNDAQN--LYIVMAFLEGISLGEQIN-CMKEKKENYEETRIWKIVLQLIQALRYLHKSKG----IIHRDLTPYNIIIGDNDYVTITDFGLAKQRLLESRSRDARSILGTLTYVCPEVIQHHPYGEKADIWALGCIVYQICTLSPPFTAQSELDLVNKICQGEYKKV 2123
            C+ DY +   +GSG++G   K KRK  S G     KE++      G+ ++  C+    + SE+++++ +L+HP++VRYY    D +N  LYI+M + EG  L   I+ C+KE+K   EE  I ++++QL  AL+  H+ +     ++HRDL P NI +  N  V + DFGLA  R+L   +  A++ +GT  Y+ PE I    Y EK+DIW+LGC++Y++C LSPPFTA ++ +L  KI +G+++++
Sbjct:    4 CVDDYEVLYTIGSGSYGRCQKIKRK--SDGKILVWKELD-----YGTMAE--CEK-QMLVSEVNLLR-ELKHPNIVRYYDRIIDRRNTMLYIIMEYCEGGDLSCLISKCIKERK-YLEEQFILRVMVQLSLALKECHRRRDGRATVLHRDLKPANIFLDANQNVKLGDFGLA--RILNHDTSFAKTFVGTPYYMSPEQINRMSYNEKSDIWSLGCLLYELCALSPPFTAYNQKELAEKIREGKFRRI 236          
BLAST of Serine/threonine-protein kinase Nek10 vs. Ensembl Medaka
Match: ENSORLT00000034147.1 (serine/threonine-protein kinase Nek5 [Source:NCBI gene;Acc:101162253])

HSP 1 Score: 142.124 bits (357), Expect = 3.324e-34
Identity = 81/276 (29.35%), Postives = 148/276 (53.62%), Query Frame = 3
Query: 1407 IRDYVIFELLGSGAFGSVYKAKRKKASAGSYCAIKEVNLSEYQIGSTSQERCDSIYQIASELDIIKKQLRHPHVVRYYRTFNDAQNLYIVMAFLEGISLGEQINCMKEKKENYEETRIWKIVLQLIQALRYLHKSKGIIHRDLTPYNIIIGDNDY-VTITDFGLAKQRLLESRSRDARSILGTLTYVCPEVIQHHPYGEKADIWALGCIVYQICTLSPPFTAQSELDLVNKICQGEYKKVDQFISTFTRQRLEFSFKMKAFIENAIVVDPKYRYDV 2231
            + DY +   +G GAFG  +  + K     + C IK++NL +     +++ER  S  ++      +  ++RHP++V +  +F +  +L+IVM F +G  L ++IN   ++   + E  I  + +Q+   L+++H  K ++HRD+   NI + +      + DFG+A  R+L +    AR+ +GT  Y+ PE+ +  PY  K D+W+LGC++Y++CTL  PF   S   L+ KIC+G Y  V       TR    ++ +++  +     V+P+ R  +
Sbjct:    1 MNDYEVLWQIGEGAFGKAFLVRSKTGGGDTQCVIKQINLQKM----SAKERESSRKEV-----TLLSRMRHPNIVSFISSFLEKGSLFIVMEFCDGGDLLKKINM--QRGVPFREEEILDLFVQICLGLKHIHDKK-VLHRDIKCQNIFLTNGGMKAKLGDFGIA--RMLNNSMDLARTCVGTPYYLSPEICESRPYNNKTDVWSLGCVLYELCTLRHPFEGSSLRQLLGKICRGRYAPVP------TR----YTHELRLLVNQLFKVNPRDRPSI 252          
BLAST of Serine/threonine-protein kinase Nek10 vs. Ensembl Medaka
Match: nek6 (NIMA related kinase 6 [Source:NCBI gene;Acc:101173323])

HSP 1 Score: 130.954 bits (328), Expect = 5.174e-33
Identity = 88/299 (29.43%), Postives = 145/299 (48.49%), Query Frame = 3
Query: 1365 ESIDCSSQKEETKC-----IRDYVIFELLGSGAFGSVYKAKR--KKASAGSYCAIKEVNLSEYQIGSTSQERCDSIYQIASELDIIKKQLRHPHVVRYYRTFNDAQNLYIVMAFLEGISLGEQINCMKEKKENYEETRIWKIVLQLIQALRYLHKSKGIIHRDLTPYNIIIGDNDYVTITDFGLAKQRLLESRSRDARSILGTLTYVCPEVIQHHPYGEKADIWALGCIVYQICTLSPPFTAQSE--LDLVNKICQGEYKKVDQFISTFTRQRLEFSFKMKAFIENAIVVDPKYRYDVL 2234
            E +    QK  T C     + ++ +   +G G F  VY+A R   + S     A+K+V + E       Q+          E+D++K QL HP++++Y  +F +   L IV+   +   L + I   K+K+    E  IWK  +QL  AL ++H S+ ++HRD+ P N+ I     V + D GL   R   S++  A S++GT  Y+ PE I  + Y  K+DIW+LGC++Y++  L  PF       L L  KI Q +Y  +            ++S K++  +   I  +P  R D++
Sbjct:   19 EPVPPEDQKNPTGCGFRCSMANFRVERKIGRGQFSEVYRAVRLLDRQSV----ALKKVQIFEMMDAKARQD-------CIKEIDLLK-QLNHPNIIKYLDSFIEDNELNIVLELADAGDLSQMIKYFKKKRRLIPERTIWKYFVQLCSALEHMH-SRRVMHRDIKPANVFITATGEVKLGDLGLG--RFFSSKTTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLLSLCRKIEQCDYPPLPPD---------QYSDKLRELVSMCINSEPDQRPDII 293          
BLAST of Serine/threonine-protein kinase Nek10 vs. Ensembl Medaka
Match: nek4 (NIMA related kinase 4 [Source:NCBI gene;Acc:101169778])

HSP 1 Score: 131.339 bits (329), Expect = 1.078e-30
Identity = 94/278 (33.81%), Postives = 153/278 (55.04%), Query Frame = 3
Query: 1416 YVIFELLGSGAFGSV----YKAKRKKASAGSYCAIKEVNLSEYQIGSTSQERCDSIYQIASELDIIKKQLRHPHVVRYYRTF-NDAQNLYIVMAFLEGISLGEQINCMKEKK-ENYEETRIWKIVLQLIQALRYLHKSKGIIHRDLTPYNIIIGDNDYVTITDFGLAKQRLLESRSRDARSILGTLTYVCPEVIQHHPYGEKADIWALGCIVYQICTLSPPFTAQSELDLVNKICQGEYKKVDQFISTFTRQRLEFSFKMKAFIENAIVVDPKYRYDV 2231
            Y+   ++G G++G V    +K  RK+        IK++NLS     S+ +ER  S  Q A  L     QLRHP++V Y  ++  D + LYIVM F EG   G+  + +K++K E   E ++ +  +Q+  AL+YLH+ + I+HRDL   NI +   + + + D G+A  R+LE+++  A +++GT  Y+ PE+  + PY  K+D+WALGC VY++ TL   F A+    LV +I +G   K+ Q  S +  Q       +   I++ +   P+ R DV
Sbjct:    4 YIFIRVVGKGSYGEVNLVKHKTDRKQ------YVIKKLNLST----SSKRER-RSAEQEAQLL----SQLRHPNIVTYRESWEGDDRQLYIVMGFCEG---GDLYHRLKQRKGELLPERQVVEWFVQIAMALQYLHE-RNILHRDLKTQNIFLTKTNIIKVGDLGIA--RVLENQNDMASTLIGTPYYMSPELFSNKPYNHKSDVWALGCCVYEMSTLKHAFNAKDMNSLVYRIVEG---KLPQMPSRYDPQ-------LGDLIKSMLSKKPEERPDV 250          
BLAST of Serine/threonine-protein kinase Nek10 vs. Planmine SMEST
Match: SMESG000037692.1 (SMESG000037692.1)

HSP 1 Score: 1835.08 bits (4752), Expect = 0.000e+0
Identity = 999/1002 (99.70%), Postives = 999/1002 (99.70%), Query Frame = 3
Query:   69 MSLLEIPITRDDILICNDDEFVNNLNLICERIRNSSKDQLIVSSLHSILSRCLNIIEVKLKEMCPEDSLYSCVSVLKCVNEILKKCDFSIFNDLENIEQIFKLTAILNENELSTDIGIQIQCLQCLHIMISSNFDHFILLFVKFNEIELIKNFFGSVDIKVQSLSWKLIKRLLHKNVTFNIEKMKHLLLDNIFDSLDSDTNXXXXXXXXXXXXXXXXXXNDEMRVLIKDFDSIQILLNQVHFEHQEITTHHRFLVEKYTLITKYLLCLLQLVISNEEKRFFRDIGGIPIIXXXXXXXXXXXXXXHYTQESADVIEKYFQIIEVASTFISTLSKNENSSLEIVQKSGIYFLVQFLVKIPASYRNAFILQKHIFRALRFLFSLERNRKRFKNIFPAILFETFVDVGHFCENLESYDQLVLVYSNLSEIEKKSIRESIDCSSQKEETKCIRDYVIFELLGSGAFGSVYKAKRKKASAGSYCAIKEVNLSEYQIGSTSQERCDSIYQIASELDIIKKQLRHPHVVRYYRTFNDAQNLYIVMAFLEGISLGEQINCMKEKKENYEETRIWKIVLQLIQALRYLHKSKGIIHRDLTPYNIIIGDNDYVTITDFGLAKQRLLESRSRDARSILGTLTYVCPEVIQHHPYGEKADIWALGCIVYQICTLSPPFTAQSELDLVNKICQGEYKKVDQFISTFTRQRLEFSFKMKAFIENAIVVDPKYRYDVLGLSGILVEEILINLDQIEHLLNKEIQSKKRLENQINESNANKLSMFDMQFLSLQGXXXXXXXXXXXVNNQNFDDSNTDSNSLEKSIQTXXXXXXXXXXXXXXXXXXXXXXXXXXRIAKLSSLDNSNNGTGNLSEVNLRRLHLQTSNNEAVRMRPLNTKSLMSISQKSLRHITEDPITRILTWLHKIYFLSRADLRVLKSQWHSESDFIQTKRLFKMIFKSIFNLQPNQMKIELNNMISGREXXXXXXXXXXXXXERLSKVSPEKLHYLMDDLLEKLNYSN 3074
            MSLLEIPITRDDILICNDDEFVNNLNLICERIRNSSKDQLIVSSLHSILSRCLNIIEVKLKEMCPEDSLYSCVSVLKCVNEILKKCDFSIFNDLENIEQIFKLTAILNENELSTDIGIQIQCLQCLHIMISSNFDHFILLFVKFNEIELIKNFFGSVDIKVQSLSWKLIKRLLHKNVTFNIEKMKHLLLDNIFDSLDSDTNIKIKITITDLLLHILYHYNDEMRV IKDFDSIQILLNQVHFEHQEITTHHRFLVEKYTLITKYLLCLLQLVISNEEKRFFRDIGGIPIILSLLSLSNDQLDLSHYTQESADVIEKYFQIIEVASTFISTLSKNENSSLEIVQKSGIYF VQFLVKIPASYRNAFILQKHIFRALRFLFSLERNRKRFKNIFPAILFETFVDVGHFCENLESYDQLVLVYSNLSEIEKKSIRESIDCSSQKEETKCIRDYVIFELLGSGAFGSVYKAKRKKASAGSYCAIKEVNLSEYQIGSTSQERCDSIYQIASELDIIKKQLRHPHVVRYYRTFNDAQNLYIVMAFLEGISLGEQINCMKEKKENYEETRIWKIVLQLIQALRYLHKSKGIIHRDLTPYNIIIGDNDYVTITDFGLAKQRLLESRS DARSILGTLTYVCPEVIQHHPYGEKADIWALGCIVYQICTLSPPFTAQSELDLVNKICQGEYKKVDQFISTFTRQRLEFSFKMKAFIENAIVVDPKYRYDVLGLSGILVEEILINLDQIEHLLNKEIQSKKRLENQINESNANKLSMFDMQFLSLQGSSREASPSVSSVNNQNFDDSNTDSNSLEKSIQTNSLDLKSSDLCNNSNSNSLSLSLNRSRIAKLSSLDNSNNGTGNLSEVNLRRLHLQTSNNEAVRMRPLNTKSLMSISQKSLRHITEDPITRILTWLHKIYFLSRADLRVLKSQWHSESDFIQTKRLFKMIFKSIFNLQPNQMKIELNNMISGRESSLQLNLLSNNVNERLSKVSPEKLHYLMDDLLEKLNYSN
Sbjct:    1 MSLLEIPITRDDILICNDDEFVNNLNLICERIRNSSKDQLIVSSLHSILSRCLNIIEVKLKEMCPEDSLYSCVSVLKCVNEILKKCDFSIFNDLENIEQIFKLTAILNENELSTDIGIQIQCLQCLHIMISSNFDHFILLFVKFNEIELIKNFFGSVDIKVQSLSWKLIKRLLHKNVTFNIEKMKHLLLDNIFDSLDSDTNIKIKITITDLLLHILYHYNDEMRVFIKDFDSIQILLNQVHFEHQEITTHHRFLVEKYTLITKYLLCLLQLVISNEEKRFFRDIGGIPIILSLLSLSNDQLDLSHYTQESADVIEKYFQIIEVASTFISTLSKNENSSLEIVQKSGIYFFVQFLVKIPASYRNAFILQKHIFRALRFLFSLERNRKRFKNIFPAILFETFVDVGHFCENLESYDQLVLVYSNLSEIEKKSIRESIDCSSQKEETKCIRDYVIFELLGSGAFGSVYKAKRKKASAGSYCAIKEVNLSEYQIGSTSQERCDSIYQIASELDIIKKQLRHPHVVRYYRTFNDAQNLYIVMAFLEGISLGEQINCMKEKKENYEETRIWKIVLQLIQALRYLHKSKGIIHRDLTPYNIIIGDNDYVTITDFGLAKQRLLESRSGDARSILGTLTYVCPEVIQHHPYGEKADIWALGCIVYQICTLSPPFTAQSELDLVNKICQGEYKKVDQFISTFTRQRLEFSFKMKAFIENAIVVDPKYRYDVLGLSGILVEEILINLDQIEHLLNKEIQSKKRLENQINESNANKLSMFDMQFLSLQGSSREASPSVSSVNNQNFDDSNTDSNSLEKSIQTNSLDLKSSDLCNNSNSNSLSLSLNRSRIAKLSSLDNSNNGTGNLSEVNLRRLHLQTSNNEAVRMRPLNTKSLMSISQKSLRHITEDPITRILTWLHKIYFLSRADLRVLKSQWHSESDFIQTKRLFKMIFKSIFNLQPNQMKIELNNMISGRESSLQLNLLSNNVNERLSKVSPEKLHYLMDDLLEKLNYSN 1002          
BLAST of Serine/threonine-protein kinase Nek10 vs. Planmine SMEST
Match: SMESG000037692.1 (SMESG000037692.1)

HSP 1 Score: 1822.75 bits (4720), Expect = 0.000e+0
Identity = 999/1019 (98.04%), Postives = 999/1019 (98.04%), Query Frame = 3
Query:   69 MSLLEIPITRDDILICNDDEFVNNLNLICERIRNSSKDQLIVSSLHSILSRCLNIIEVKLKEMCPEDSLYSCVSVLKCVNEILKKCDFSIFNDLENIEQIFKLTAILNENELSTDIGIQIQCLQCLHIMISSNFDHFILLFVKFNEIELIKNFFGSVDIKVQSLSWKLIKRLLHKNVTFNIEKMKHLLLDNIFDSLDSDTNXXXXXXXXXXXXXXXXXXNDEMRVLIKDFDSIQILLNQVHFEHQEITTHHRFLVEKYTLITKYLLCLLQLVISNEEKRFFRDIGGIPIIXXXXXXXXXXXXXXHYTQESADVIEKYFQIIEVASTFISTLSKNENSSLEIVQKSGIYFLVQFLVKIPASYRNAFILQKHIFRALRFLFSLERNRKRFKNIFPAILFETFVDVGHFCENLESYDQLVLVYSNLSEIEKKSIRESIDCSSQKEETKCIRDYVIFELLGSGAFGSVYKAKRKKASAGSYCAIKEVNLSEYQIGSTSQERCDSIYQIASELDIIKKQLRHPHVVRYYRTFNDAQNLYIVMAFLEGISLGEQINCMKEKKENYEETRIWKIVLQLIQALRYLHKSKGIIHRDLTPYNIIIGDNDYVTITDFGLAKQRLLESRSRDARSILGTLTYVCPEVIQHHPYGEKADIWALGCIVYQICTLSPPFTAQSELDLVNKICQGEYKKVDQFISTFTRQRLEFSFKMKAFIENAIVVDPKYRYDVLGLSGILVEEILINLDQIEHLLNKEIQSKKRLENQINESNANKLSMFDMQFLSLQGXXXXXXXXXXXVNNQNFDDSNTDSNSLEKSIQTXXXXXXXXXXXXXXXXXXXXXXXXXXRIAKLSSLDNSNNGTGNLSEVNLRRLHLQTSNNE-----------------AVRMRPLNTKSLMSISQKSLRHITEDPITRILTWLHKIYFLSRADLRVLKSQWHSESDFIQTKRLFKMIFKSIFNLQPNQMKIELNNMISGREXXXXXXXXXXXXXERLSKVSPEKLHYLMDDLLEKLNYSN 3074
            MSLLEIPITRDDILICNDDEFVNNLNLICERIRNSSKDQLIVSSLHSILSRCLNIIEVKLKEMCPEDSLYSCVSVLKCVNEILKKCDFSIFNDLENIEQIFKLTAILNENELSTDIGIQIQCLQCLHIMISSNFDHFILLFVKFNEIELIKNFFGSVDIKVQSLSWKLIKRLLHKNVTFNIEKMKHLLLDNIFDSLDSDTNIKIKITITDLLLHILYHYNDEMRV IKDFDSIQILLNQVHFEHQEITTHHRFLVEKYTLITKYLLCLLQLVISNEEKRFFRDIGGIPIILSLLSLSNDQLDLSHYTQESADVIEKYFQIIEVASTFISTLSKNENSSLEIVQKSGIYF VQFLVKIPASYRNAFILQKHIFRALRFLFSLERNRKRFKNIFPAILFETFVDVGHFCENLESYDQLVLVYSNLSEIEKKSIRESIDCSSQKEETKCIRDYVIFELLGSGAFGSVYKAKRKKASAGSYCAIKEVNLSEYQIGSTSQERCDSIYQIASELDIIKKQLRHPHVVRYYRTFNDAQNLYIVMAFLEGISLGEQINCMKEKKENYEETRIWKIVLQLIQALRYLHKSKGIIHRDLTPYNIIIGDNDYVTITDFGLAKQRLLESRS DARSILGTLTYVCPEVIQHHPYGEKADIWALGCIVYQICTLSPPFTAQSELDLVNKICQGEYKKVDQFISTFTRQRLEFSFKMKAFIENAIVVDPKYRYDVLGLSGILVEEILINLDQIEHLLNKEIQSKKRLENQINESNANKLSMFDMQFLSLQGSSREASPSVSSVNNQNFDDSNTDSNSLEKSIQTNSLDLKSSDLCNNSNSNSLSLSLNRSRIAKLSSLDNSNNGTGNLSEVNLRRLHLQTSNNE                 AVRMRPLNTKSLMSISQKSLRHITEDPITRILTWLHKIYFLSRADLRVLKSQWHSESDFIQTKRLFKMIFKSIFNLQPNQMKIELNNMISGRESSLQLNLLSNNVNERLSKVSPEKLHYLMDDLLEKLNYSN
Sbjct:    1 MSLLEIPITRDDILICNDDEFVNNLNLICERIRNSSKDQLIVSSLHSILSRCLNIIEVKLKEMCPEDSLYSCVSVLKCVNEILKKCDFSIFNDLENIEQIFKLTAILNENELSTDIGIQIQCLQCLHIMISSNFDHFILLFVKFNEIELIKNFFGSVDIKVQSLSWKLIKRLLHKNVTFNIEKMKHLLLDNIFDSLDSDTNIKIKITITDLLLHILYHYNDEMRVFIKDFDSIQILLNQVHFEHQEITTHHRFLVEKYTLITKYLLCLLQLVISNEEKRFFRDIGGIPIILSLLSLSNDQLDLSHYTQESADVIEKYFQIIEVASTFISTLSKNENSSLEIVQKSGIYFFVQFLVKIPASYRNAFILQKHIFRALRFLFSLERNRKRFKNIFPAILFETFVDVGHFCENLESYDQLVLVYSNLSEIEKKSIRESIDCSSQKEETKCIRDYVIFELLGSGAFGSVYKAKRKKASAGSYCAIKEVNLSEYQIGSTSQERCDSIYQIASELDIIKKQLRHPHVVRYYRTFNDAQNLYIVMAFLEGISLGEQINCMKEKKENYEETRIWKIVLQLIQALRYLHKSKGIIHRDLTPYNIIIGDNDYVTITDFGLAKQRLLESRSGDARSILGTLTYVCPEVIQHHPYGEKADIWALGCIVYQICTLSPPFTAQSELDLVNKICQGEYKKVDQFISTFTRQRLEFSFKMKAFIENAIVVDPKYRYDVLGLSGILVEEILINLDQIEHLLNKEIQSKKRLENQINESNANKLSMFDMQFLSLQGSSREASPSVSSVNNQNFDDSNTDSNSLEKSIQTNSLDLKSSDLCNNSNSNSLSLSLNRSRIAKLSSLDNSNNGTGNLSEVNLRRLHLQTSNNEEKNVLYTPFSLVNSIVLAVRMRPLNTKSLMSISQKSLRHITEDPITRILTWLHKIYFLSRADLRVLKSQWHSESDFIQTKRLFKMIFKSIFNLQPNQMKIELNNMISGRESSLQLNLLSNNVNERLSKVSPEKLHYLMDDLLEKLNYSN 1019          
BLAST of Serine/threonine-protein kinase Nek10 vs. Planmine SMEST
Match: SMESG000037689.1 (SMESG000037689.1)

HSP 1 Score: 233.802 bits (595), Expect = 1.375e-71
Identity = 129/129 (100.00%), Postives = 129/129 (100.00%), Query Frame = 3
Query: 2688 MRPLNTKSLMSISQKSLRHITEDPITRILTWLHKIYFLSRADLRVLKSQWHSESDFIQTKRLFKMIFKSIFNLQPNQMKIELNNMISGREXXXXXXXXXXXXXERLSKVSPEKLHYLMDDLLEKLNYSN 3074
            MRPLNTKSLMSISQKSLRHITEDPITRILTWLHKIYFLSRADLRVLKSQWHSESDFIQTKRLFKMIFKSIFNLQPNQMKIELNNMISGRESSLQLNLLSNNVNERLSKVSPEKLHYLMDDLLEKLNYSN
Sbjct:    1 MRPLNTKSLMSISQKSLRHITEDPITRILTWLHKIYFLSRADLRVLKSQWHSESDFIQTKRLFKMIFKSIFNLQPNQMKIELNNMISGRESSLQLNLLSNNVNERLSKVSPEKLHYLMDDLLEKLNYSN 129          
BLAST of Serine/threonine-protein kinase Nek10 vs. Planmine SMEST
Match: SMESG000055481.1 (SMESG000055481.1)

HSP 1 Score: 122.865 bits (307), Expect = 2.645e-30
Identity = 81/268 (30.22%), Postives = 135/268 (50.37%), Query Frame = 3
Query: 1434 LGSGAFGSVYKAKRKKASAGSYCAIKEVNLSEYQIGSTSQERCDSIYQIASELDIIKKQLRHPHVVRYYRTFNDAQNLYIVMAFLEGISLGEQINCMKEKKENYEETRIWKIVLQLIQALRYLHKSKGIIHRDLTPYNIIIGDNDYVTITDFGLAKQRLLESRSRDARSILGTLTYVCPEVIQHHPYGEKADIWALGCIVYQICTLSPPFTAQS--ELDLVNKICQGEYKKVDQFISTFTRQRLEFSFKMKAFIENAIVVDPKYRYDV 2231
            +G G F +VY+A   + +     A+K+V + E     T   R D I     E+D++KK L HPH+++   +F +   L IV+   +   L   I    ++K    E  IWK  +Q+  AL Y+H S+ I+HRD+ P N+ I     V + DFGL   R   +++ +  S++GT  Y+ PE I    Y  K+DIW+LGC++Y++  L  PF  +S     L  +I + +Y  +   I         +S +++  ++  I  DP  R ++
Sbjct:   28 IGRGQFSTVYQACCLEIN-DKIIALKKVKIFEMMDAKT---RRDCI----KEIDLLKK-LDHPHIIKLISSFIEDNELIIVLELADAGDLSRMIKHFNKQKRLIPERTIWKYFVQICSALEYMH-SQRIMHRDIKPANVFITSKGEVKLGDFGLG--RFFSTQTSNVHSLVGTPYYMSPERILETGYDMKSDIWSLGCVLYEMAALQSPFYGESLTLAILCQRIEESDYPPLPTRI---------YSSELRGLVDRCIQTDPNSRPNI 274          
BLAST of Serine/threonine-protein kinase Nek10 vs. Planmine SMEST
Match: SMESG000057044.1 (SMESG000057044.1)

HSP 1 Score: 126.716 bits (317), Expect = 8.785e-30
Identity = 96/308 (31.17%), Postives = 153/308 (49.68%), Query Frame = 3
Query: 1416 YVIFELLGSGAFGSVYKAKRKKASAG--SYCAIKEVNLSEYQIGSTSQERCDSIYQIASELDIIKKQLRHPHVVRYYRTFNDAQNLYIVMAFLEGISLGEQINCMKEKKENYEETRIWKIVLQLIQALRYLHKSKGIIHRDLTPYNIIIGDNDYVTITDFGLAKQRLLESRSRDARSILGTLTYVCPEVIQHHPYGEKADIWALGCIVYQICTLSPPFTAQSELDLVNKICQGEYKKVDQFISTFTRQRLEFSFKMKAFIENAIVVDPKYRY---DVLGLSGILVE------EILINLDQIEHLLNKE 2306
            Y+    +G G+FG+VYK K  +   G  S   +KEVN     + +  Q   D I +   E  ++ K L H ++V+++ +F    N  I+  + EG  L + I   K    + EE RI +  +Q+I+ L Y+HK K I+HRDL P NI +   D V I DFG++  R+L   +  A + LGT  Y+ PEV++H  Y   +DIW+ G I+Y++C L   F   + + ++  I +          S   R    +S  ++  +E  +V DP  R    ++L L  I  +      +I+ N D  E L+N E
Sbjct:   15 YIFLSGIGKGSFGTVYKVKDFRGPEGQESIKVLKEVN-----VDTMDQ---DQIEECTREGKLLSK-LNHSNIVKFFDSFRLENNYCIITEYCEGGDLKQVIEKTKRSGSHLEELRIIRWFIQVIEGLDYIHKRK-ILHRDLKPNNIFLK-YDSVKIGDFGIS--RILNFTNDLASTFLGTPYYMSPEVLKHDGYNTASDIWSSGVILYEMCALKHAFIGDNLMRVMVTILE----------SPCPRIPSNYSENLQEVLECILVKDPDNRPKACEILDLPFIKSKIRDPWIDIVENDDMSETLVNNE 299          
The following BLAST results are available for this feature:
BLAST of Serine/threonine-protein kinase Nek10 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NEK101.699e-10341.47NIMA related kinase 10 [Source:HGNC Symbol;Acc:HGN... [more]
NEK104.794e-7944.88NIMA related kinase 10 [Source:HGNC Symbol;Acc:HGN... [more]
NEK106.026e-4752.90NIMA related kinase 10 [Source:HGNC Symbol;Acc:HGN... [more]
NEK105.518e-4540.17NIMA related kinase 10 [Source:HGNC Symbol;Acc:HGN... [more]
NEK56.799e-3932.29NIMA related kinase 5 [Source:HGNC Symbol;Acc:HGNC... [more]
back to top
BLAST of Serine/threonine-protein kinase Nek10 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nekl-48.665e-8132.38Serine/threonine-protein kinase D1044.8 [Source:U... [more]
cmk-13.004e-3130.77Calcium/calmodulin-dependent protein kinase type 1... [more]
nekl-13.432e-3131.44NEK (NEver in mitosis Kinase) Like [Source:UniPro... [more]
nekl-13.545e-3131.44NEK (NEver in mitosis Kinase) Like [Source:UniPro... [more]
nekl-31.208e-3033.33Serine/threonine-protein kinase nekl-3 [Source:Un... [more]
back to top
BLAST of Serine/threonine-protein kinase Nek10 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nek24.269e-4234.13gene:FBgn0029970 transcript:FBtr0071142[more]
CG120694.402e-3028.74gene:FBgn0039796 transcript:FBtr0085728[more]
CG120694.402e-3028.74gene:FBgn0039796 transcript:FBtr0335455[more]
CaMKI2.461e-2930.40gene:FBgn0016126 transcript:FBtr0333670[more]
fu2.515e-2931.97gene:FBgn0001079 transcript:FBtr0074602[more]
back to top
BLAST of Serine/threonine-protein kinase Nek10 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nek104.135e-9437.58NIMA-related kinase 10 [Source:ZFIN;Acc:ZDB-GENE-1... [more]
nek21.783e-3835.80NIMA-related kinase 2 [Source:ZFIN;Acc:ZDB-GENE-04... [more]
nek22.514e-3735.80NIMA-related kinase 2 [Source:ZFIN;Acc:ZDB-GENE-04... [more]
nek22.514e-3735.80NIMA-related kinase 2 [Source:ZFIN;Acc:ZDB-GENE-04... [more]
nek123.901e-3634.73NIMA-related kinase 12 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
back to top
BLAST of Serine/threonine-protein kinase Nek10 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NEK101.245e-10039.61NIMA-related kinase 10 [Source:NCBI gene;Acc:10048... [more]
mmp9.15.667e-4037.65matrix metallopeptidase 9 gene 1 [Source:Xenbase;A... [more]
sez6l25.232e-3934.60seizure related 6 homolog like 2 [Source:Xenbase;A... [more]
nek74.965e-3329.97NIMA-related kinase 7 [Source:NCBI gene;Acc:780029... [more]
nek17.248e-3335.18NIMA-related kinase 1 [Source:NCBI gene;Acc:100036... [more]
back to top
BLAST of Serine/threonine-protein kinase Nek10 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nek105.259e-10442.86NIMA (never in mitosis gene a)- related kinase 10 ... [more]
Nek105.720e-10442.86NIMA (never in mitosis gene a)- related kinase 10 ... [more]
Nek105.720e-10442.86NIMA (never in mitosis gene a)- related kinase 10 ... [more]
Nek21.651e-3533.88NIMA (never in mitosis gene a)-related expressed k... [more]
Nek21.651e-3533.88NIMA (never in mitosis gene a)-related expressed k... [more]
back to top
BLAST of Serine/threonine-protein kinase Nek10 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q3UGM2|NEK10_MOUSE3.678e-10342.86Serine/threonine-protein kinase Nek10 OS=Mus muscu... [more]
sp|Q6ZWH5|NEK10_HUMAN8.161e-10341.47Serine/threonine-protein kinase Nek10 OS=Homo sapi... [more]
sp|P84199|NEKL4_CAEEL1.102e-7932.38Serine/threonine-protein kinase D1044.8 OS=Caenorh... [more]
sp|P51955|NEK2_HUMAN7.777e-3734.57Serine/threonine-protein kinase Nek2 OS=Homo sapie... [more]
sp|Q55BN8|NEK2_DICDI3.247e-3633.45Probable serine/threonine-protein kinase nek2 OS=D... [more]
back to top
BLAST of Serine/threonine-protein kinase Nek10 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A433T9R11.803e-11740.77Uncharacterized protein OS=Elysia chlorotica OX=18... [more]
A0A2T7P8W14.130e-11639.33Protein kinase domain-containing protein OS=Pomace... [more]
V3Z8Z31.111e-11239.33Protein kinase domain-containing protein (Fragment... [more]
A0A0L8I5511.014e-10938.98Protein kinase domain-containing protein OS=Octopu... [more]
A0A1S3I8R19.015e-10737.24serine/threonine-protein kinase Nek10 isoform X4 O... [more]
back to top
BLAST of Serine/threonine-protein kinase Nek10 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nek22.690e-3936.21NIMA related kinase 2 [Source:NCBI gene;Acc:103024... [more]
ENSAMXT00000049860.17.291e-3531.78pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
nek129.596e-3331.64serine/threonine-protein kinase Nek4-like [Source:... [more]
nek121.914e-3231.64serine/threonine-protein kinase Nek4-like [Source:... [more]
pdpk1a7.239e-3234.883-phosphoinositide-dependent protein kinase 1 [Sou... [more]
back to top
BLAST of Serine/threonine-protein kinase Nek10 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000007414.19.693e-3832.35pep scaffold:Pmarinus_7.0:GL476981:230882:244405:1... [more]
nek21.076e-3335.64NIMA-related kinase 2 [Source:ZFIN;Acc:ZDB-GENE-04... [more]
STK365.921e-3228.48serine/threonine kinase 36 [Source:HGNC Symbol;Acc... [more]
pdpk1b1.077e-2932.013-phosphoinositide dependent protein kinase 1b [So... [more]
ENSPMAT00000002824.11.766e-2932.20pep scaffold:Pmarinus_7.0:GL476598:1893846:1903215... [more]
back to top
BLAST of Serine/threonine-protein kinase Nek10 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
RAD531.705e-2929.39DNA damage response protein kinase; required for c... [more]
TPK27.100e-2931.25cAMP-dependent protein kinase catalytic subunit; p... [more]
PKH31.183e-2731.01Protein kinase with similarity to mammalian PDK1 a... [more]
CMK11.162e-2630.55Calmodulin-dependent protein kinase; may play a ro... [more]
TPK12.254e-2630.42cAMP-dependent protein kinase catalytic subunit; p... [more]
back to top
BLAST of Serine/threonine-protein kinase Nek10 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO291622.560e-10639.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO462347.457e-8542.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO374136.004e-4335.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO491381.015e-3835.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO498221.905e-3532.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Serine/threonine-protein kinase Nek10 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nek105.072e-10043.64NIMA related kinase 10 [Source:NCBI gene;Acc:10116... [more]
nek22.148e-4237.65NIMA related kinase 2 [Source:NCBI gene;Acc:101168... [more]
ENSORLT00000034147.13.324e-3429.35serine/threonine-protein kinase Nek5 [Source:NCBI ... [more]
nek65.174e-3329.43NIMA related kinase 6 [Source:NCBI gene;Acc:101173... [more]
nek41.078e-3033.81NIMA related kinase 4 [Source:NCBI gene;Acc:101169... [more]
back to top
BLAST of Serine/threonine-protein kinase Nek10 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000037692.10.000e+099.70SMESG000037692.1[more]
SMESG000037692.10.000e+098.04SMESG000037692.1[more]
SMESG000037689.11.375e-71100.00SMESG000037689.1[more]
SMESG000055481.12.645e-3030.22SMESG000055481.1[more]
SMESG000057044.18.785e-3031.17SMESG000057044.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011865 ID=SMED30011865|Name=Serine/threonine-protein kinase Nek10|organism=Schmidtea mediterranea sexual|type=transcript|length=3167bp
GTAATTAATAAAATTCAATAATTTTTAATATTTTTGTTAGAATTCTAAAT
TTTTTAAATCTTTACTAGATGTCTCTTCTTGAAATTCCTATCACACGTGA
TGATATTTTAATTTGCAATGATGATGAATTCGTTAATAATCTTAATTTGA
TTTGTGAACGTATTAGAAATTCTTCTAAAGATCAACTCATAGTTTCTAGT
CTCCATTCAATTTTATCACGGTGTCTTAATATTATCGAAGTCAAATTAAA
AGAAATGTGTCCTGAAGACTCACTCTATAGCTGTGTTAGTGTTTTGAAAT
GTGTAAACGAAATACTCAAAAAATGTGATTTTTCCATTTTTAATGATTTA
GAAAATATCGAGCAAATATTTAAACTGACTGCGATTCTGAATGAAAATGA
ACTCAGCACAGACATCGGCATTCAGATCCAATGTCTACAATGCTTGCACA
TCATGATCAGCTCAAATTTTGACCATTTCATTTTGCTGTTTGTAAAGTTC
AATGAAATAGAATTAATTAAGAATTTTTTCGGAAGTGTGGACATCAAAGT
TCAGTCATTATCCTGGAAATTGATTAAAAGACTATTGCACAAAAATGTGA
CATTCAATATTGAGAAAATGAAACATTTGCTCTTGGATAATATTTTCGAT
AGCCTCGATAGTGATACGAATATTAAGATAAAAATCACAATCACTGACCT
ATTATTGCACATTCTTTATCATTATAATGACGAAATGAGAGTTTTAATCA
AAGATTTTGATTCCATACAAATCTTGCTAAATCAAGTGCATTTCGAACAT
CAAGAGATAACTACGCATCACAGATTCCTCGTTGAAAAATATACTCTCAT
AACCAAATATCTCTTGTGTTTGTTACAGCTAGTTATTAGTAATGAAGAAA
AACGGTTCTTTCGAGATATCGGAGGAATTCCTATTATACTATCCCTTCTA
AGTCTTTCCAATGATCAGTTAGATCTCTCTCATTATACTCAAGAAAGTGC
TGATGTCATTGAGAAATATTTTCAAATTATTGAAGTTGCCAGTACTTTCA
TTTCGACATTGTCTAAGAATGAAAATAGTAGCTTGGAAATTGTTCAGAAA
TCGGGAATATATTTCTTGGTTCAATTTTTGGTGAAAATCCCTGCTTCCTA
CCGAAACGCATTTATTTTGCAGAAACACATATTTCGTGCACTTCGTTTCT
TGTTCAGTTTAGAAAGAAATAGAAAAAGATTCAAAAATATATTTCCAGCA
ATTCTTTTTGAAACCTTTGTCGATGTTGGTCATTTCTGTGAAAATTTAGA
ATCATACGATCAGTTGGTGTTAGTTTATAGCAATCTATCGGAAATAGAAA
AGAAAAGTATCAGAGAATCCATAGATTGTTCAAGTCAAAAAGAAGAGACT
AAGTGCATCCGTGATTATGTGATTTTTGAATTACTCGGCTCTGGAGCCTT
TGGGTCTGTGTACAAAGCAAAAAGGAAGAAAGCATCTGCTGGATCATATT
GTGCAATTAAAGAAGTGAATTTATCAGAATATCAAATTGGGTCCACCAGT
CAAGAAAGGTGTGACAGCATTTATCAAATTGCTTCCGAATTGGATATTAT
TAAAAAACAGCTTCGCCATCCACATGTTGTTAGATACTATCGGACCTTCA
ACGATGCTCAAAATCTTTATATTGTTATGGCATTTCTTGAAGGAATAAGC
TTGGGAGAACAAATTAATTGTATGAAAGAAAAGAAAGAAAATTATGAAGA
AACAAGAATTTGGAAAATAGTTCTACAGTTAATTCAAGCTTTGCGATATC
TTCACAAATCTAAAGGAATAATTCATCGTGATTTGACACCTTATAATATA
ATTATCGGCGATAATGATTATGTAACAATTACTGATTTTGGATTAGCTAA
ACAAAGATTGTTGGAATCAAGAAGTAGGGACGCTCGTTCAATTTTGGGAA
CACTCACATACGTTTGTCCCGAAGTAATTCAGCACCATCCTTATGGAGAA
AAGGCTGATATTTGGGCATTAGGATGCATTGTCTATCAGATTTGTACCTT
GTCACCACCCTTCACGGCTCAGTCAGAATTAGATTTGGTAAACAAAATCT
GTCAAGGAGAATATAAAAAAGTAGACCAATTCATTTCAACATTTACCCGG
CAGCGTTTGGAATTTTCGTTTAAAATGAAAGCATTTATTGAAAATGCAAT
AGTTGTTGATCCGAAATACAGATATGATGTGTTAGGATTATCTGGAATTC
TGGTTGAAGAAATACTGATAAATCTCGACCAAATCGAGCATTTACTCAAC
AAAGAAATTCAGAGTAAAAAACGGTTAGAAAATCAAATCAACGAATCCAA
CGCTAACAAGTTATCCATGTTTGATATGCAATTCCTTTCATTACAGGGCA
GCAGTCGGGAAGCATCACCGAGTGTTTCTTCGGTGAACAATCAGAATTTC
GACGATTCTAATACAGATTCCAATAGTTTAGAAAAAAGTATTCAGACAAA
CAGTTTGGACTTGAAGTCTTCAGATTTATGCAATAACTCTAATTCCAATT
CATTATCTCTTTCACTGAACCGGAGCAGAATTGCAAAGCTCTCCTCGCTT
GACAACTCGAATAACGGCACTGGCAATCTGTCGGAGGTAAATTTAAGGCG
TCTCCATTTGCAGACCTCCAACAACGAAGCTGTTAGAATGAGACCTCTGA
ATACTAAATCATTGATGTCGATTTCCCAGAAATCTCTTCGTCATATTACC
GAAGATCCTATAACAAGAATCTTAACTTGGTTACACAAAATATATTTTCT
AAGTCGTGCCGATCTTCGAGTCCTAAAGTCTCAATGGCATTCAGAAAGTG
ACTTCATACAAACAAAAAGATTATTTAAAATGATATTCAAGTCGATTTTC
AATTTACAACCAAACCAAATGAAAATTGAGCTTAATAACATGATATCCGG
TCGTGAGAGTTCTTTGCAATTAAATTTATTATCAAACAATGTCAATGAAA
GATTATCAAAAGTGTCACCAGAGAAACTTCATTATTTAATGGACGATTTA
TTAGAGAAACTCAACTATTCAAATTAACATATTTTAGATTTATATTTTGT
AAATAATTACCTTAAATGATGAGTTTTCATTTTTCGAACTCTATTTAGAT
CATGTTAATAGAAAATT
back to top

protein sequence of SMED30011865-orf-1

>SMED30011865-orf-1 ID=SMED30011865-orf-1|Name=SMED30011865-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1003bp
MSLLEIPITRDDILICNDDEFVNNLNLICERIRNSSKDQLIVSSLHSILS
RCLNIIEVKLKEMCPEDSLYSCVSVLKCVNEILKKCDFSIFNDLENIEQI
FKLTAILNENELSTDIGIQIQCLQCLHIMISSNFDHFILLFVKFNEIELI
KNFFGSVDIKVQSLSWKLIKRLLHKNVTFNIEKMKHLLLDNIFDSLDSDT
NIKIKITITDLLLHILYHYNDEMRVLIKDFDSIQILLNQVHFEHQEITTH
HRFLVEKYTLITKYLLCLLQLVISNEEKRFFRDIGGIPIILSLLSLSNDQ
LDLSHYTQESADVIEKYFQIIEVASTFISTLSKNENSSLEIVQKSGIYFL
VQFLVKIPASYRNAFILQKHIFRALRFLFSLERNRKRFKNIFPAILFETF
VDVGHFCENLESYDQLVLVYSNLSEIEKKSIRESIDCSSQKEETKCIRDY
VIFELLGSGAFGSVYKAKRKKASAGSYCAIKEVNLSEYQIGSTSQERCDS
IYQIASELDIIKKQLRHPHVVRYYRTFNDAQNLYIVMAFLEGISLGEQIN
CMKEKKENYEETRIWKIVLQLIQALRYLHKSKGIIHRDLTPYNIIIGDND
YVTITDFGLAKQRLLESRSRDARSILGTLTYVCPEVIQHHPYGEKADIWA
LGCIVYQICTLSPPFTAQSELDLVNKICQGEYKKVDQFISTFTRQRLEFS
FKMKAFIENAIVVDPKYRYDVLGLSGILVEEILINLDQIEHLLNKEIQSK
KRLENQINESNANKLSMFDMQFLSLQGSSREASPSVSSVNNQNFDDSNTD
SNSLEKSIQTNSLDLKSSDLCNNSNSNSLSLSLNRSRIAKLSSLDNSNNG
TGNLSEVNLRRLHLQTSNNEAVRMRPLNTKSLMSISQKSLRHITEDPITR
ILTWLHKIYFLSRADLRVLKSQWHSESDFIQTKRLFKMIFKSIFNLQPNQ
MKIELNNMISGRESSLQLNLLSNNVNERLSKVSPEKLHYLMDDLLEKLNY
SN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005452inorganic anion exchanger activity
GO:0008509anion transmembrane transporter activity
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0005488binding
GO:0000166nucleotide binding
GO:0004674protein serine/threonine kinase activity
GO:0016301kinase activity
GO:0016740transferase activity
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0006820anion transport
GO:0015698inorganic anion transport
GO:0098656anion transmembrane transport
GO:0006468protein phosphorylation
GO:0016310phosphorylation
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR008266Tyr_kinase_AS
IPR016024ARM-type_fold
IPR011009Kinase-like_dom_sf
IPR000719Prot_kinase_dom
IPR017441Protein_kinase_ATP_BS
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 736..763
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 439..799
e-value: 6.5E-68
score: 231.3
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 783..808
NoneNo IPR availablePANTHERPTHR43671FAMILY NOT NAMEDcoord: 454..888
NoneNo IPR availablePANTHERPTHR43671:SF18SERINE/THREONINE-PROTEIN KINASE NEK10coord: 454..888
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 450..719
e-value: 5.9E-54
score: 183.2
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 450..733
score: 43.933
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 456..481
IPR008266Tyrosine-protein kinase, active sitePROSITEPS00109PROTEIN_KINASE_TYRcoord: 584..596
IPR016024Armadillo-type foldSUPERFAMILYSSF48371ARM repeatcoord: 100..357
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 424..728