GLI pathogenesis related 1

Overview
NameGLI pathogenesis related 1
Smed IDSMED30011858
Length (bp)541
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of GLI pathogenesis related 1 (SMED30011858) t-SNE clustered cells

Violin plots show distribution of expression levels for GLI pathogenesis related 1 (SMED30011858) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of GLI pathogenesis related 1 (SMED30011858) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for GLI pathogenesis related 1 (SMED30011858) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011858

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymaSMED30011858SMESG000001227.1 dd_Smed_v4_5245_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
secretory systemSMED30011858SMESG000001227.1 dd_Smed_v6_5245_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of GLI pathogenesis related 1 vs. Ensembl Human
Match: GLIPR1L1 (GLIPR1 like 1 [Source:HGNC Symbol;Acc:HGNC:28392])

HSP 1 Score: 76.6406 bits (187), Expect = 6.441e-17
Identity = 46/117 (39.32%), Postives = 65/117 (55.56%), Query Frame = 1
Query:  196 LDAHNKYRALVASGKVPKQPTAANMLKMKWNSESATKAQKTANICKFSHDTVTDRK---YGKFEWVGQNIALFSDSNVVK--GVEMWYKENSVYIFSNNSCSLKTCGHFTQVLWADS 531
            ++AHN++R     GKV   P AA+M  M W+   A  A+  AN CKF H+   D+    Y  FE+VG+NI L    +      +  WY E   Y F + SCS + CGH+TQ++WA+S
Sbjct:   38 IEAHNEWR-----GKV--NPPAADMKYMIWDKGLAKMAKAWANQCKFEHNDCLDKSYKCYAAFEYVGENIWLGGIKSFTPRHAITAWYNETQFYDFDSLSCS-RVCGHYTQLVWANS 146          
BLAST of GLI pathogenesis related 1 vs. Ensembl Human
Match: GLIPR1L1 (GLIPR1 like 1 [Source:HGNC Symbol;Acc:HGNC:28392])

HSP 1 Score: 77.0258 bits (188), Expect = 6.680e-17
Identity = 46/117 (39.32%), Postives = 65/117 (55.56%), Query Frame = 1
Query:  196 LDAHNKYRALVASGKVPKQPTAANMLKMKWNSESATKAQKTANICKFSHDTVTDRK---YGKFEWVGQNIALFSDSNVVK--GVEMWYKENSVYIFSNNSCSLKTCGHFTQVLWADS 531
            ++AHN++R     GKV   P AA+M  M W+   A  A+  AN CKF H+   D+    Y  FE+VG+NI L    +      +  WY E   Y F + SCS + CGH+TQ++WA+S
Sbjct:   38 IEAHNEWR-----GKV--NPPAADMKYMIWDKGLAKMAKAWANQCKFEHNDCLDKSYKCYAAFEYVGENIWLGGIKSFTPRHAITAWYNETQFYDFDSLSCS-RVCGHYTQLVWANS 146          
BLAST of GLI pathogenesis related 1 vs. Ensembl Human
Match: PI16 (peptidase inhibitor 16 [Source:HGNC Symbol;Acc:HGNC:21245])

HSP 1 Score: 72.0182 bits (175), Expect = 1.320e-14
Identity = 41/127 (32.28%), Postives = 70/127 (55.12%), Query Frame = 1
Query:  169 LTEAQQKEILDAHNKYRALVASGKVPKQPTAANMLKMKWNSESATKAQKTANICKFSHDTVTDRKYGKFEWVGQNIALFSDS--NVVKGVEMWYKENSVYIFSNNSCSL-KTCGHFTQVLWADSQEL 540
            LT+ +++ +++ HN YRA V+       PTA++ML M+W+ E A  A+  A  C + H+    R+       G+N+   +D   +V   +E W+ E   Y  S  +CS  + CGH+TQV+WA ++ +
Sbjct:   28 LTDEEKRLMVELHNLYRAQVS-------PTASDMLHMRWDEELAAFAKAYARQCVWGHNKERGRR-------GENLFAITDEGMDVPLAMEEWHHEREHYNLSAATCSPGQMCGHYTQVVWAKTERI 140          
BLAST of GLI pathogenesis related 1 vs. Ensembl Human
Match: PI16 (peptidase inhibitor 16 [Source:HGNC Symbol;Acc:HGNC:21245])

HSP 1 Score: 72.0182 bits (175), Expect = 1.320e-14
Identity = 41/127 (32.28%), Postives = 70/127 (55.12%), Query Frame = 1
Query:  169 LTEAQQKEILDAHNKYRALVASGKVPKQPTAANMLKMKWNSESATKAQKTANICKFSHDTVTDRKYGKFEWVGQNIALFSDS--NVVKGVEMWYKENSVYIFSNNSCSL-KTCGHFTQVLWADSQEL 540
            LT+ +++ +++ HN YRA V+       PTA++ML M+W+ E A  A+  A  C + H+    R+       G+N+   +D   +V   +E W+ E   Y  S  +CS  + CGH+TQV+WA ++ +
Sbjct:   28 LTDEEKRLMVELHNLYRAQVS-------PTASDMLHMRWDEELAAFAKAYARQCVWGHNKERGRR-------GENLFAITDEGMDVPLAMEEWHHEREHYNLSAATCSPGQMCGHYTQVVWAKTERI 140          
BLAST of GLI pathogenesis related 1 vs. Ensembl Human
Match: PI16 (peptidase inhibitor 16 [Source:HGNC Symbol;Acc:HGNC:21245])

HSP 1 Score: 72.0182 bits (175), Expect = 1.320e-14
Identity = 41/127 (32.28%), Postives = 70/127 (55.12%), Query Frame = 1
Query:  169 LTEAQQKEILDAHNKYRALVASGKVPKQPTAANMLKMKWNSESATKAQKTANICKFSHDTVTDRKYGKFEWVGQNIALFSDS--NVVKGVEMWYKENSVYIFSNNSCSL-KTCGHFTQVLWADSQEL 540
            LT+ +++ +++ HN YRA V+       PTA++ML M+W+ E A  A+  A  C + H+    R+       G+N+   +D   +V   +E W+ E   Y  S  +CS  + CGH+TQV+WA ++ +
Sbjct:   28 LTDEEKRLMVELHNLYRAQVS-------PTASDMLHMRWDEELAAFAKAYARQCVWGHNKERGRR-------GENLFAITDEGMDVPLAMEEWHHEREHYNLSAATCSPGQMCGHYTQVVWAKTERI 140          
BLAST of GLI pathogenesis related 1 vs. Ensembl Celegans
Match: scl-15 (SCP-Like extracellular protein [Source:UniProtKB/TrEMBL;Acc:O16575])

HSP 1 Score: 65.0846 bits (157), Expect = 3.355e-13
Identity = 53/157 (33.76%), Postives = 73/157 (46.50%), Query Frame = 1
Query:  106 MNLLILISTLFFICFKSASSDLTEAQQKEILDAHNKYRALVASG-----KVPKQPTAANMLKMKWNSESATKAQKTANICKFSHDTVTDRKYGK---FEWVGQNIALFSDSNVVKGVEMWYKENSVYIFSNN---SCSLKT-CGHFTQVLWADSQEL 540
            M  LIL++ +  +   S     ++A QK I+DAHN  R+ +A G     K  K+P  +N+LKMKW+   A  AQ  AN C   H      KYG+   + W G  I    D   V+    W  E   Y +  N   S   KT  GH TQ+ WA +  +
Sbjct:    1 MRALILLAVVASV---SVYGQFSKAGQKAIVDAHNTLRSSIAKGTYVANKTRKEP-GSNILKMKWDPTIAKSAQAYANTCPTGHG---KSKYGENLYWRWSGAVIKSIDDYG-VRASGAWASEFQKYGWKTNKLDSALFKTGIGHATQMAWASTGSI 149          
BLAST of GLI pathogenesis related 1 vs. Ensembl Celegans
Match: scl-11 (SCP-Like extracellular protein [Source:UniProtKB/TrEMBL;Acc:Q93746])

HSP 1 Score: 62.7734 bits (151), Expect = 2.766e-12
Identity = 45/144 (31.25%), Postives = 65/144 (45.14%), Query Frame = 1
Query:  133 LFFICFKSASSDLTEAQQKEILDAHNKYRALVASG----KVPKQPTAANMLKMKWNSESATKAQKTANICKFSHDTVTDRKYGK---FEWVGQNIALFSDSNVVKGVEMWYKENSVYIFSNNSCSLKT----CGHFTQVLWADS 531
            L   C     S  T   Q+ I+DAHNK R+ +A G    K   Q + +NM K+KW++  AT AQ  AN C   H       YG+   + W    I    D+        W  E   Y +++N+  + T     GH TQ+ WA++
Sbjct:    6 LLVCCIAGVFSQFTSTGQQAIVDAHNKLRSSIAKGTYVAKGTTQKSGSNMRKIKWDATVATSAQNYANTCPTGHS--QGSGYGENLYWYWTSGTIGNL-DTFGPAASSSWESEFQQYGWTSNTLDMNTFNTGIGHATQMAWANT 146          
BLAST of GLI pathogenesis related 1 vs. Ensembl Celegans
Match: scl-7 (SCP-Like extracellular protein [Source:UniProtKB/TrEMBL;Acc:Q18539])

HSP 1 Score: 58.5362 bits (140), Expect = 8.453e-11
Identity = 43/146 (29.45%), Postives = 72/146 (49.32%), Query Frame = 1
Query:  133 LFFICFKSASSDLTEAQQKEILDAHNKYRALVASG----KVPKQPTAANMLKMKWNSESATKAQKTANICKFSHDTVTDRKYGK-FEWVGQNIALFS-DSNVVKGVEMWYKENSVYIFSNNSCSLK----TCGHFTQVLWADSQEL 540
            L  +C   A +  +E  ++ +++AHN  R+ +A G    K  K+ +A NMLKMKW++  A  AQ  AN C   H    D+ YG+   W   +  +   D  V   V+ W  E  ++ +++N  +        GH TQV W+ + ++
Sbjct:    7 LALVCV-GAHAQFSEGGKQSMVNAHNAVRSSIAKGEYVAKGTKKDSATNMLKMKWDNSLAQSAQNYANGCPMQHS--PDKSYGENLFWAYSSSPITDLDKYVQSAVDTWVSEFQMFGWNSNKFTTALWNTGIGHATQVAWSATGQV 149          
BLAST of GLI pathogenesis related 1 vs. Ensembl Celegans
Match: scl-2 (SCP-Like extracellular protein [Source:UniProtKB/TrEMBL;Acc:Q20603])

HSP 1 Score: 57.7658 bits (138), Expect = 1.986e-10
Identity = 46/153 (30.07%), Postives = 68/153 (44.44%), Query Frame = 1
Query:  106 MNLLILISTLFFICFKSASSDLTEAQQKEILDAHNKYRALVASG----KVPKQPTAANMLKMKWNSESATKAQKTANICKFSHDTVTDRKYGK---FEWVGQNIALFSDSNVVKGVEMWYKENSVYIFSNNSCSLK----TCGHFTQVLWADS 531
            MN L+L+  L   C    S+D   + Q  I++AHN  R+ +A G    K  ++    N+LKMKW+S  A  AQ  AN C   H    D   G+   + W   ++   +          W KE   Y + +N  ++       GH TQ+ WA S
Sbjct:    1 MNYLLLVVALAVGC----SADFGSSGQNGIINAHNTLRSKIAKGTYVAKGTQKSPGTNLLKMKWDSAVAASAQNYANGCPTGHS--GDAGLGENLYWYWTSGSLGDLNQYGSAASAS-WEKEFQDYGWKSNLMTIDLFNTGIGHATQMAWAKS 146          
BLAST of GLI pathogenesis related 1 vs. Ensembl Celegans
Match: scl-2 (SCP-Like extracellular protein [Source:UniProtKB/TrEMBL;Acc:Q20603])

HSP 1 Score: 57.7658 bits (138), Expect = 1.986e-10
Identity = 46/153 (30.07%), Postives = 68/153 (44.44%), Query Frame = 1
Query:  106 MNLLILISTLFFICFKSASSDLTEAQQKEILDAHNKYRALVASG----KVPKQPTAANMLKMKWNSESATKAQKTANICKFSHDTVTDRKYGK---FEWVGQNIALFSDSNVVKGVEMWYKENSVYIFSNNSCSLK----TCGHFTQVLWADS 531
            MN L+L+  L   C    S+D   + Q  I++AHN  R+ +A G    K  ++    N+LKMKW+S  A  AQ  AN C   H    D   G+   + W   ++   +          W KE   Y + +N  ++       GH TQ+ WA S
Sbjct:    1 MNYLLLVVALAVGC----SADFGSSGQNGIINAHNTLRSKIAKGTYVAKGTQKSPGTNLLKMKWDSAVAASAQNYANGCPTGHS--GDAGLGENLYWYWTSGSLGDLNQYGSAASAS-WEKEFQDYGWKSNLMTIDLFNTGIGHATQMAWAKS 146          
BLAST of GLI pathogenesis related 1 vs. Ensembl Fly
Match: CG8483 (gene:FBgn0038126 transcript:FBtr0082782)

HSP 1 Score: 83.1889 bits (204), Expect = 6.757e-19
Identity = 49/149 (32.89%), Postives = 83/149 (55.70%), Query Frame = 1
Query:  112 LLILISTLFFIC-FKSASSDLTEAQQKEILDAHNKYRALVASGKVPKQPTAANMLKMKWNSESATKAQKTANICKFSHDTVTDRKYGKFEWVGQNIALF--------SDSNVVKGVEMWYKENSVYIFSNNSCSLKTCGHFTQVLWADS 531
            ++I+   + F C  K  +S +T  ++  IL  HN+ R +VA+G+ P QP A NM ++ W+ E A +AQK A+ C+F HD    R   +F  +GQN+A+          D +    ++ W+ E   Y F  ++ S KT GH++Q++W ++
Sbjct:   12 IMIISCEVAFACNGKIIASGITAEERSIILQEHNRLRQIVATGRYPGQPGAENMREIVWDDELAARAQKWADNCQFRHD--PHRTINRFT-MGQNLAIIWSTAPLDADDGDFPSRIQSWFNEVQKYSF-GDAWSPKT-GHYSQLVWGET 155          
BLAST of GLI pathogenesis related 1 vs. Ensembl Fly
Match: CG9400 (gene:FBgn0030562 transcript:FBtr0073920)

HSP 1 Score: 55.0694 bits (131), Expect = 3.904e-9
Identity = 27/80 (33.75%), Postives = 48/80 (60.00%), Query Frame = 1
Query:  166 DLTEAQQKEILDAHNKYRALVASGKVPKQPTAANMLKMKWNSESATKAQKTANICKFSHDTVTDRKYGKFEWVGQNIALF 405
            +++E +++ +LD HN  R+ +ASG +    +AA+M  ++W++E    A   A  C+F+HD    R   +F++ GQNI  F
Sbjct:   90 EMSERRRQLLLDMHNLARSKIASGNLDGYRSAAHMPLLRWDTELEQMAALHAKRCQFAHDKC--RNTPRFKFSGQNIGYF 167          
BLAST of GLI pathogenesis related 1 vs. Ensembl Fly
Match: Ag5r (gene:FBgn0015010 transcript:FBtr0333658)

HSP 1 Score: 52.373 bits (124), Expect = 2.969e-8
Identity = 31/101 (30.69%), Postives = 45/101 (44.55%), Query Frame = 1
Query:  169 LTEAQQKEILDAHNKYRALVASGKVPKQPTAANMLKMKWNSESATKAQKTANICKFSHDTVTDRKYGKFEWVGQNIALFSDSNVVK-------GVEMWYKE 450
            L+ A++  ++   N+YR  +A G       A  M  +KWN E A  A      C+  HD   +     F+W GQN+A     N +        GV+MWY E
Sbjct:   54 LSSAEKDALVARTNEYRNHIAGGLNANLSAACRMATIKWNDELAYLASLNVKSCQMKHDGCHNTD--AFDWSGQNLAWMGYYNPLNVTHYLEWGVDMWYDE 152          
BLAST of GLI pathogenesis related 1 vs. Ensembl Fly
Match: Ag5r (gene:FBgn0015010 transcript:FBtr0073937)

HSP 1 Score: 52.373 bits (124), Expect = 2.969e-8
Identity = 31/101 (30.69%), Postives = 45/101 (44.55%), Query Frame = 1
Query:  169 LTEAQQKEILDAHNKYRALVASGKVPKQPTAANMLKMKWNSESATKAQKTANICKFSHDTVTDRKYGKFEWVGQNIALFSDSNVVK-------GVEMWYKE 450
            L+ A++  ++   N+YR  +A G       A  M  +KWN E A  A      C+  HD   +     F+W GQN+A     N +        GV+MWY E
Sbjct:   54 LSSAEKDALVARTNEYRNHIAGGLNANLSAACRMATIKWNDELAYLASLNVKSCQMKHDGCHNTD--AFDWSGQNLAWMGYYNPLNVTHYLEWGVDMWYDE 152          
BLAST of GLI pathogenesis related 1 vs. Ensembl Fly
Match: Ag5r (gene:FBgn0015010 transcript:FBtr0305582)

HSP 1 Score: 52.373 bits (124), Expect = 2.969e-8
Identity = 31/101 (30.69%), Postives = 45/101 (44.55%), Query Frame = 1
Query:  169 LTEAQQKEILDAHNKYRALVASGKVPKQPTAANMLKMKWNSESATKAQKTANICKFSHDTVTDRKYGKFEWVGQNIALFSDSNVVK-------GVEMWYKE 450
            L+ A++  ++   N+YR  +A G       A  M  +KWN E A  A      C+  HD   +     F+W GQN+A     N +        GV+MWY E
Sbjct:   54 LSSAEKDALVARTNEYRNHIAGGLNANLSAACRMATIKWNDELAYLASLNVKSCQMKHDGCHNTD--AFDWSGQNLAWMGYYNPLNVTHYLEWGVDMWYDE 152          
BLAST of GLI pathogenesis related 1 vs. Ensembl Zebrafish
Match: glipr1a (GLI pathogenesis-related 1a [Source:ZFIN;Acc:ZDB-GENE-110309-2])

HSP 1 Score: 71.2478 bits (173), Expect = 8.336e-15
Identity = 54/151 (35.76%), Postives = 77/151 (50.99%), Query Frame = 1
Query:  118 ILISTLFFICFKSASS--DLTE-AQQKEILDAHNKYRALVASGKVPKQPTAANMLKMKWNSESATKAQKTANICKFSHDT---VTDRKYGKFEWVGQNI---ALFSDSNVVKGVEMWYKENSVYIFSNNSCS-LKTCGHFTQVLWADSQEL 540
            +LIS  F +   S+    D+T+ A   E +  HN+ R+ V+       PTAANM  M W++  A  A+  A  C F H+       R +  F  VG+NI   A +S   V   V  W  E   Y ++NN C+  K CGH+TQV+WADS ++
Sbjct:   15 LLISACFLLGVFSSEYLFDITDRAFIDECVREHNQNRSSVS-------PTAANMRYMTWDAALAVTARAWARFCLFKHNIHLREAKRVHPTFTTVGENIWAGAPYSRFTVKSAVFSWVNELKDYNYNNNQCNDKKVCGHYTQVVWADSYKV 158          
BLAST of GLI pathogenesis related 1 vs. Ensembl Zebrafish
Match: glipr1a (GLI pathogenesis-related 1a [Source:ZFIN;Acc:ZDB-GENE-110309-2])

HSP 1 Score: 70.8626 bits (172), Expect = 8.864e-15
Identity = 54/151 (35.76%), Postives = 77/151 (50.99%), Query Frame = 1
Query:  118 ILISTLFFICFKSASS--DLTE-AQQKEILDAHNKYRALVASGKVPKQPTAANMLKMKWNSESATKAQKTANICKFSHDT---VTDRKYGKFEWVGQNI---ALFSDSNVVKGVEMWYKENSVYIFSNNSCS-LKTCGHFTQVLWADSQEL 540
            +LIS  F +   S+    D+T+ A   E +  HN+ R+ V+       PTAANM  M W++  A  A+  A  C F H+       R +  F  VG+NI   A +S   V   V  W  E   Y ++NN C+  K CGH+TQV+WADS ++
Sbjct:    7 LLISACFLLGVFSSEYLFDITDRAFIDECVREHNQNRSSVS-------PTAANMRYMTWDAALAVTARAWARFCLFKHNIHLREAKRVHPTFTTVGENIWAGAPYSRFTVKSAVFSWVNELKDYNYNNNQCNDKKVCGHYTQVVWADSYKV 150          
BLAST of GLI pathogenesis related 1 vs. Ensembl Zebrafish
Match: CABZ01068499.1 (cysteine-rich venom protein natrin-1-like [Source:NCBI gene;Acc:100536500])

HSP 1 Score: 67.781 bits (164), Expect = 6.953e-14
Identity = 43/129 (33.33%), Postives = 68/129 (52.71%), Query Frame = 1
Query:  163 SDLTEAQQKEILDAHNKYRALVASGKVPKQPTAANMLKMKWNSESATKAQKTANICKFSHDTVTDRKYGKFEWVGQNIALFSDSNV---VKGVEMWYKENSVYIFSNNSCSLKTCGHFTQVLWADSQEL 540
            ++L+  QQ EI+D HN +R  V       QP+A+NMLKM W+   A  A+   N C  +H   + R    +E +G+N  LF  + +      V+ W+ E + Y +   S + +  GH+TQV+W  S E+
Sbjct:    3 TELSSVQQ-EIVDVHNAFRRAV-------QPSASNMLKMSWSDAVAESARGWINKCNMTHGPPSSRMLNGYE-MGEN--LFKATGISSWTSVVDAWHSEVNNYKYPIGSINGQATGHYTQVVWYSSYEV 120          
BLAST of GLI pathogenesis related 1 vs. Ensembl Zebrafish
Match: glipr1b (GLI pathogenesis-related 1b [Source:ZFIN;Acc:ZDB-GENE-040426-1459])

HSP 1 Score: 67.781 bits (164), Expect = 1.078e-13
Identity = 49/151 (32.45%), Postives = 76/151 (50.33%), Query Frame = 1
Query:  109 NLLILISTLFF--ICFKSASSDLTEAQ-QKEILDAHNKYRALVASGKVPKQPTAANMLKMKWNSESATKAQKTANICKFSH-DTVTDRKYGKFEWVGQNIAL---FSDSNVVKGVEMWYKENSVYIFSNNSCSLKTCGHFTQVLWADSQEL 540
             LL+ IS + +      +    +TE +  +  + AHN +RA V+       P AA    M W+ E A  A+  A  CK SH  ++    +  F W+G+NI L   FS  +V   V  W KE + Y   NN+CS + CGH+ Q++W+ S ++
Sbjct:    6 GLLLRISVVLYGSCSVLALLPGITEPEFIRRCVKAHNTHRARVS-------PPAAGARSMSWDKELAKGARDRARHCKGSHYPSLGHFGHPLFGWMGENIWLGSPFSAFSVENAVHRWSKEGA-YSVKNNNCS-RLCGHYAQLMWSTSFKM 147          
BLAST of GLI pathogenesis related 1 vs. Ensembl Zebrafish
Match: pi15b (peptidase inhibitor 15b [Source:ZFIN;Acc:ZDB-GENE-070912-590])

HSP 1 Score: 58.5362 bits (140), Expect = 2.506e-10
Identity = 40/135 (29.63%), Postives = 66/135 (48.89%), Query Frame = 1
Query:  169 LTEAQQKEILDAHNKYRALVASGKVPKQPTAANMLKMKWNSESATKAQKTANICKFSHDTVTDRKYGKFEWVGQNIALFSDS--NVVKGVEMWYKENSVYIFS-----NNSCSLK----TCGHFTQVLWADSQEL 540
            ++++    ILD HNK RA V        P AANM  M W+   A  A+  A  C + H      +Y     +GQN+++ + +  ++++ V+ WY E   Y+F      N  C ++     C H+TQ++WA S  +
Sbjct:   61 ISQSDMIAILDYHNKVRANVF-------PPAANMEYMLWDDGLARSAEAWAATCIWEHGPPYLLRY-----LGQNLSVRTGNYRSILQLVKPWYDEVRDYMFPYPRDCNPHCPMRCYGPMCTHYTQMVWASSNRV 183          
BLAST of GLI pathogenesis related 1 vs. Ensembl Xenopus
Match: ENSXETT00000036788.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:KV464547.1:593:5826:1 gene:ENSXETG00000015856.1 transcript:ENSXETT00000036788.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 67.781 bits (164), Expect = 4.136e-13
Identity = 38/119 (31.93%), Postives = 66/119 (55.46%), Query Frame = 1
Query:  193 ILDAHNKYRALVASGKVPKQPTAANMLKMKWNSESATKAQKTANICKFSHDTVTDRKYGKFEWVGQNIALFSDS--NVVKGVEMWYKENSVYIFSNNSCSL-KTCGHFTQVLWADSQEL 540
            ILD HN YR+         +P+A++M+K+ W+S     A+  A  C + H+   DR +     +G+N+ + S S  +V  G++ W+KE   Y F+   C   + CGH+TQ++WA ++ +
Sbjct:   38 ILDKHNFYRS-------QTEPSASDMIKLTWDSALEAMAKSYAEKCIWEHN--KDRGF-----IGENLFVMSGSSLDVALGLDDWHKERGYYNFTTGMCQEGQMCGHYTQMVWAGTERV 142          
BLAST of GLI pathogenesis related 1 vs. Ensembl Xenopus
Match: R3HDML (R3H domain containing-like [Source:NCBI gene;Acc:100492715])

HSP 1 Score: 66.6254 bits (161), Expect = 4.458e-13
Identity = 55/186 (29.57%), Postives = 82/186 (44.09%), Query Frame = 1
Query:   91 IVNIKMNLLILISTLFFICFKS--ASSDLTEAQQKE-----------------------ILDAHNKYRALVASGKVPKQPTAANMLKMKWNSESATKAQKTANICKFSHDTVTDRKYGKFEWVGQNIALFSD--SNVVKGVEMWYKENSVYIFSN---------NSCSLKTCGHFTQVLWADSQEL 540
             + +K NL +L +TL   C+ S  AS+DL+   Q E                       +LD HN+ R+ V        P AANM  M W+   A  A+  AN CK+ H      +Y     +GQN+++ S    ++V  V+ WY E   Y F +         N C+   C H+TQ++WA S  +
Sbjct:    3 FLRLKQNLSVL-NTLAQTCWTSLFASTDLSNRNQTEHMFGSGIPRIRRKRYISPRDMSALLDYHNQVRSKVF-------PPAANMEYMVWDERLAKSAESWANQCKWDHGPNQLMRY-----IGQNLSVHSGRYRSIVDLVKGWYDERQHYSFPHPRECNPSCPNKCTGAVCTHYTQMVWASSNRI 175          
BLAST of GLI pathogenesis related 1 vs. Ensembl Xenopus
Match: ENSXETT00000011066.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:KV460357.1:2037421:2076750:-1 gene:ENSXETG00000001370.1 transcript:ENSXETT00000011066.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.3882 bits (150), Expect = 5.347e-12
Identity = 47/153 (30.72%), Postives = 75/153 (49.02%), Query Frame = 1
Query:  103 KMNLLILISTLFFICFKSASSD--LTEAQQKEILDAHNKYRALVASGKVPKQPTAANMLKMKWNSESATKAQKTANICKFSHDTVTDRKYG-KFEW-VGQNI--ALFSDSNVVKGVEMWYKENSVYIFS-NNSCSLKTCGHFTQVLWADSQEL 540
              N LI IS+ F   + +  +   L    +  I+D HN YR+ V        P AA+MLKM W++    KA++ A  C F H  ++ R+YG  F +  G+NI  + F  S     +  W+ E+  + ++   +      GHFTQ++WA +  L
Sbjct:    3 PFNFLICISSTFHQTYHNNKTVPVLDPNNRNFIVDKHNYYRSWV-------NPPAADMLKMHWDNYYLAKAKEWALTCSFKHSNLSFRQYGVDFYYSAGENIMNSYFRHS-WEYVINYWFNEHVNWEYAVGTTKEGAVTGHFTQIIWAPTHAL 147          
BLAST of GLI pathogenesis related 1 vs. Ensembl Xenopus
Match: R3HDML (R3H domain containing-like [Source:NCBI gene;Acc:100492715])

HSP 1 Score: 63.1586 bits (152), Expect = 6.772e-12
Identity = 41/135 (30.37%), Postives = 63/135 (46.67%), Query Frame = 1
Query:  169 LTEAQQKEILDAHNKYRALVASGKVPKQPTAANMLKMKWNSESATKAQKTANICKFSHDTVTDRKYGKFEWVGQNIALFSD--SNVVKGVEMWYKENSVYIFSN---------NSCSLKTCGHFTQVLWADSQEL 540
            ++      +LD HN+ R+ V        P AANM  M W+   A  A+  AN CK+ H      +Y     +GQN+++ S    ++V  V+ WY E   Y F +         N C+   C H+TQ++WA S  +
Sbjct:   58 ISPRDMSALLDYHNQVRSKVF-------PPAANMEYMVWDERLAKSAESWANQCKWDHGPNQLMRY-----IGQNLSVHSGRYRSIVDLVKGWYDERQHYSFPHPRECNPSCPNKCTGAVCTHYTQMVWASSNRI 180          
BLAST of GLI pathogenesis related 1 vs. Ensembl Xenopus
Match: ENSXETT00000010663.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:KV460357.1:2036819:2079188:-1 gene:ENSXETG00000001370.1 transcript:ENSXETT00000010663.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 61.2326 bits (147), Expect = 2.776e-11
Identity = 46/151 (30.46%), Postives = 74/151 (49.01%), Query Frame = 1
Query:  109 NLLILISTLFFICFKSASSD--LTEAQQKEILDAHNKYRALVASGKVPKQPTAANMLKMKWNSESATKAQKTANICKFSHDTVTDRKYGK--FEWVGQNI--ALFSDSNVVKGVEMWYKENSVYIFS-NNSCSLKTCGHFTQVLWADSQEL 540
            NL+I IS  F   + +  +   L    +  I+D HN YR+ V        P AA+MLKM W++    KA++ A  C F H  ++ R+YG   +   G+NI  + F  S     +  W+ E+  + ++   +      GHFTQ++WA +  L
Sbjct:    8 NLIICISATFHQTYHNNKTVPVLDPNNRNFIVDKHNYYRSWV-------NPPAADMLKMHWDNYYLAKAKEWALTCSFKHSNLSFRQYGVDFYYSAGENIMNSYFRHS-WEYVINYWFNEHVNWEYAVGTTKEGAVTGHFTQIIWAPTHAL 150          
BLAST of GLI pathogenesis related 1 vs. Ensembl Mouse
Match: Pi16 (peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:1921366])

HSP 1 Score: 75.485 bits (184), Expect = 1.306e-16
Identity = 41/132 (31.06%), Postives = 74/132 (56.06%), Query Frame = 1
Query:  154 SASSDLTEAQQKEILDAHNKYRALVASGKVPKQPTAANMLKMKWNSESATKAQKTANICKFSHDTVTDRKYGKFEWVGQNIALFSDS--NVVKGVEMWYKENSVYIFSNNSCSL-KTCGHFTQVLWADSQEL 540
              ++ LTE +++ ++D HN+YRA V+       P A++ML+M+W+ E A  A+  A  C + H+    R+       G+N+   +D   +V   V  W++E+  Y FS  +C   + CGH+TQV+W+ ++ +
Sbjct:   25 GPTTALTEDEKQTMVDLHNQYRAQVS-------PPASDMLQMRWDDELAAFAKAYAQKCVWGHNKERGRR-------GENLFAITDEGMDVPLAVGNWHEEHEYYNFSTATCDPNQMCGHYTQVVWSKTERI 142          
BLAST of GLI pathogenesis related 1 vs. Ensembl Mouse
Match: Pi16 (peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:1921366])

HSP 1 Score: 75.485 bits (184), Expect = 2.100e-16
Identity = 41/132 (31.06%), Postives = 74/132 (56.06%), Query Frame = 1
Query:  154 SASSDLTEAQQKEILDAHNKYRALVASGKVPKQPTAANMLKMKWNSESATKAQKTANICKFSHDTVTDRKYGKFEWVGQNIALFSDS--NVVKGVEMWYKENSVYIFSNNSCSL-KTCGHFTQVLWADSQEL 540
              ++ LTE +++ ++D HN+YRA V+       P A++ML+M+W+ E A  A+  A  C + H+    R+       G+N+   +D   +V   V  W++E+  Y FS  +C   + CGH+TQV+W+ ++ +
Sbjct:   25 GPTTALTEDEKQTMVDLHNQYRAQVS-------PPASDMLQMRWDDELAAFAKAYAQKCVWGHNKERGRR-------GENLFAITDEGMDVPLAVGNWHEEHEYYNFSTATCDPNQMCGHYTQVVWSKTERI 142          
BLAST of GLI pathogenesis related 1 vs. Ensembl Mouse
Match: Pi16 (peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:1921366])

HSP 1 Score: 75.485 bits (184), Expect = 2.100e-16
Identity = 41/132 (31.06%), Postives = 74/132 (56.06%), Query Frame = 1
Query:  154 SASSDLTEAQQKEILDAHNKYRALVASGKVPKQPTAANMLKMKWNSESATKAQKTANICKFSHDTVTDRKYGKFEWVGQNIALFSDS--NVVKGVEMWYKENSVYIFSNNSCSL-KTCGHFTQVLWADSQEL 540
              ++ LTE +++ ++D HN+YRA V+       P A++ML+M+W+ E A  A+  A  C + H+    R+       G+N+   +D   +V   V  W++E+  Y FS  +C   + CGH+TQV+W+ ++ +
Sbjct:   25 GPTTALTEDEKQTMVDLHNQYRAQVS-------PPASDMLQMRWDDELAAFAKAYAQKCVWGHNKERGRR-------GENLFAITDEGMDVPLAVGNWHEEHEYYNFSTATCDPNQMCGHYTQVVWSKTERI 142          
BLAST of GLI pathogenesis related 1 vs. Ensembl Mouse
Match: Pi16 (peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:1921366])

HSP 1 Score: 75.485 bits (184), Expect = 7.475e-16
Identity = 41/127 (32.28%), Postives = 72/127 (56.69%), Query Frame = 1
Query:  169 LTEAQQKEILDAHNKYRALVASGKVPKQPTAANMLKMKWNSESATKAQKTANICKFSHDTVTDRKYGKFEWVGQNIALFSDS--NVVKGVEMWYKENSVYIFSNNSCSL-KTCGHFTQVLWADSQEL 540
            LTE +++ ++D HN+YRA V+       P A++ML+M+W+ E A  A+  A  C + H+    R+       G+N+   +D   +V   V  W++E+  Y FS  +C   + CGH+TQV+W+ ++ +
Sbjct:   30 LTEDEKQTMVDLHNQYRAQVS-------PPASDMLQMRWDDELAAFAKAYAQKCVWGHNKERGRR-------GENLFAITDEGMDVPLAVGNWHEEHEYYNFSTATCDPNQMCGHYTQVVWSKTERI 142          
BLAST of GLI pathogenesis related 1 vs. Ensembl Mouse
Match: Glipr1 (GLI pathogenesis-related 1 (glioma) [Source:MGI Symbol;Acc:MGI:1920940])

HSP 1 Score: 72.0182 bits (175), Expect = 3.416e-15
Identity = 45/121 (37.19%), Postives = 64/121 (52.89%), Query Frame = 1
Query:  187 KEILDAHNKYRALVASGKVPKQPTAANMLKMKWNSESATKAQKTANICKFSHDT-VTDRKYGKFEWVGQNIALFSDS--NVVKGVEMWYKENSVYIFSNNSCSLKTCGHFTQVLWADSQEL 540
            KE +  HN+ R+ V+       P A NML M W+ + A  A+     C+F H+  +  R +  F  +G+NI L S S  +V   +  WY+E   Y FS   C    CGH+TQV+WADS +L
Sbjct:   35 KECVQVHNQLRSKVS-------PPARNMLYMSWDPKLAQIAKAWTKSCEFKHNPQLHSRIHPNFTALGENIWLGSLSIFSVSSAISAWYEEIKHYDFSTRKCR-HVCGHYTQVVWADSYKL 147          
BLAST of GLI pathogenesis related 1 vs. UniProt/SwissProt
Match: sp|P0DPV2|VA558_SCODE (Scoloptoxin SSD558 OS=Scolopendra dehaani OX=2609776 PE=1 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 3.556e-21
Identity = 57/160 (35.62%), Postives = 87/160 (54.37%), Query Frame = 1
Query:  106 MNLLILISTLF-FICFKSASSD---------LTEAQQKEILDAHNKYRALVASGKVPKQPTAANMLKMKWNSESATKAQKTANICKFSHDTVTDRKYGKFEWVGQNI--ALFSDSNVVKGVEMWY---KENSVYIFSNNSCSLKTCGHFTQVLWADSQEL 540
            MN+L L STLF  + F+   S          L    +K ILD HNK R +VA+G+   QP+AANM ++ WN E A  AQ++A  C F H   + RK  K+ ++G+NI    + D  + + V  WY   K+ +  +  + S      GH+TQ++WA+++ L
Sbjct:    1 MNIL-LPSTLFVLLMFQIIGSGMGCDMKVRGLDANMKKMILDLHNKKRQIVANGQQSGQPSAANMKELHWNDEIAANAQRSAETCVFEHTAKSLRKTTKYSYLGENIYKGSYPDP-IPRSVNAWYDEVKDVTPAVVKSFSSGGPMIGHYTQMVWANTEAL 158          
BLAST of GLI pathogenesis related 1 vs. UniProt/SwissProt
Match: sp|P0DPU1|VA576_SCODE (Scoloptoxin SSD976 OS=Scolopendra dehaani OX=2609776 PE=1 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 6.040e-21
Identity = 57/160 (35.62%), Postives = 87/160 (54.37%), Query Frame = 1
Query:  106 MNLLILISTLF-FICFKSASSD---------LTEAQQKEILDAHNKYRALVASGKVPKQPTAANMLKMKWNSESATKAQKTANICKFSHDTVTDRKYGKFEWVGQNI--ALFSDSNVVKGVEMWY---KENSVYIFSNNSCSLKTCGHFTQVLWADSQEL 540
            MN+L L STLF  + F+   S          L    +K ILD HNK R +VA+G+   QP+AANM ++ WN E A  AQ++A  C F H   + RK  K+ ++G+NI    + D  + + V  WY   K+ +  +  + S      GH+TQ++WA+++ L
Sbjct:    1 MNIL-LSSTLFVLLMFQIIGSGMGCDMKVRGLDANMKKMILDLHNKKRQIVANGQQSGQPSAANMKELHWNDEIAANAQRSAETCVFEHTAKSLRKTTKYSYLGENIYKGSYPDP-IPRSVNAWYDEVKDVTPAVVKSFSSGGPMIGHYTQMVWANTEAL 158          
BLAST of GLI pathogenesis related 1 vs. UniProt/SwissProt
Match: sp|P0DPU0|VA552_SCODE (Scoloptoxin SSD552 OS=Scolopendra dehaani OX=2609776 PE=1 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 2.666e-18
Identity = 56/163 (34.36%), Postives = 86/163 (52.76%), Query Frame = 1
Query:  106 MNLLILISTLF-FICFKSASSD---------LTEAQQKEILDAHNKYRALVASGKVPKQPTAANMLKMKWNSESATKAQKTANICKFSHDTVTDRKYGKFEWVGQNI--ALFSDSNVVKGVEMWYKE------NSVYIFSNNSCSLKTCGHFTQVLWADSQEL 540
            MN+L L STLF  + F+   S          L    +K ILD HNK R +VA+G+   QP AANM ++ W+ E    AQ++A  C F H   + RK  K+ ++G+N+    + D  + + V  WY E        V  FS++   +   GH+TQ++WA+++ L
Sbjct:    1 MNIL-LSSTLFVLLMFQIIGSGMGCDMKVRGLDANMKKMILDLHNKKRQIVANGQQSGQPLAANMKELHWDDEIEAIAQRSAETCVFKHTAKSLRKSSKYSYLGENVYKGGYPDP-IPRSVNKWYDEVKDVTPAVVKSFSDDGPMI---GHYTQMVWANTEAL 158          
BLAST of GLI pathogenesis related 1 vs. UniProt/SwissProt
Match: sp|P0DPU2|VA543_SCODE (Scoloptoxin SSD43 OS=Scolopendra dehaani OX=2609776 PE=1 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 4.745e-18
Identity = 48/150 (32.00%), Postives = 83/150 (55.33%), Query Frame = 1
Query:  112 LLILISTLFFICFKSASSD--LTEAQQKEILDAHNKYRALVASGKVPKQPTAANMLKMKWNSESATKAQKTANICKFSHDTVTDRKYGKFEWVGQNIALFSDSNVVK-GVEMWYKE----NSVYIFSNNSCSLKTCGHFTQVLWADSQEL 540
            +++L S L+   +    S+  L +  + +IL  HN+ R  VA+G+   QPTA+NM +++WN E A  AQ+ A  C F H +   RK  K+   G+++   + SN +K  V+MWY+E    N   + S +       GH+ Q++WA+++ +
Sbjct:    9 IVVLTSQLYVDGWGCQMSERGLDKKMKNKILKHHNELRQKVANGQERGQPTASNMKQLRWNDELAANAQRAAERCIFQHTSDEGRKTTKYGVAGESMYAGTFSNPLKTAVDMWYEEVRDVNPSILDSYDYYPGAVIGHYIQLVWAETEAI 158          
BLAST of GLI pathogenesis related 1 vs. UniProt/SwissProt
Match: sp|P35787|VA5_VESVI (Venom allergen 5 OS=Vespula vidua OX=30215 PE=1 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 2.084e-17
Identity = 57/139 (41.01%), Postives = 75/139 (53.96%), Query Frame = 1
Query:  169 LTEAQQKEILDAHNKYRALVA-----SGKVPKQPTAANMLKMKWNSESATKAQKTANICKFSHDTVTD-RKYGKFEWVGQNIALFSDSNVV-----KGVEMWYKENSVYIFSNN----SCSLKTCGHFTQVLWADSQEL 540
            LTEA+++EIL  HN +R  VA      G    QP A NM  + WN E A  AQ  A+ C + HDT  D  KY     VGQNIA  S +  +     K V+MW  EN V  F+ N      +LK  GH+TQ++WA ++E+
Sbjct:   38 LTEAEKQEILKVHNDFRQKVAKGLETRGNPGPQPPAKNMNNLVWNDELANIAQVWASQCNYGHDTCKDTEKYP----VGQNIAKRSTTAALFDSPGKLVKMW--ENEVKDFNPNIEWSKNNLKKTGHYTQMVWAKTKEI 170          
BLAST of GLI pathogenesis related 1 vs. TrEMBL
Match: I1ZI85 (GLI pathogenesis related-1 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 149.058 bits (375), Expect = 1.072e-42
Identity = 65/119 (54.62%), Postives = 90/119 (75.63%), Query Frame = 1
Query:  160 SSDLTEAQQKEILDAHNKYRALVASGKVPKQPTAANMLKMKWNSESATKAQKTANICKFSHDTVTDRKYGKFEWVGQNIALFSDSNVVKGVEMWYKENSVYIFSNNSCSLKTCGHFTQV 516
            S DL+E ++K +L  HN +R+ +A G+V  QP A NM +M WN+ESA+KAQ TA+ C F+HDT+ DRKYG FEWVGQN+A F+  ++ +GV +WY + S + F N++CSLKTCGH+TQV
Sbjct:   12 SGDLSEKEKKLLLALHNGFRSNLAQGEVSGQPPATNMQQMVWNAESASKAQITADKCIFAHDTIDDRKYGDFEWVGQNVAKFAGQDISRGVTLWYNQVSGFTFENSACSLKTCGHYTQV 130          
BLAST of GLI pathogenesis related 1 vs. TrEMBL
Match: A0A0R3SFR1 (SCP domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS3694 PE=3 SV=1)

HSP 1 Score: 117.472 bits (293), Expect = 7.782e-30
Identity = 52/119 (43.70%), Postives = 84/119 (70.59%), Query Frame = 1
Query:  184 QKEILDAHNKYRALVASGKVPKQPTAANMLKMKWNSESATKAQKTANICKFSHDTVTDRKYGKFEWVGQNIALFSDSNVVKGVEMWYKENSVYIFSNNSCSLKTCGHFTQVLWADSQEL 540
            ++E+LD  N+YR  VA+G+VP QP ++ +  +KWN+E    AQ+ A+ C+F HD+  DRK  +F WVGQNIA    S++ + V+MW++E+  Y +S+N CS   CGH+TQ++WA++ ++
Sbjct:   53 KQELLDLQNQYRREVAAGRVPNQPASSKIRDLKWNTELEASAQRHADRCRFQHDSSDDRKTAEFWWVGQNIAY--SSSIAQNVKMWFEEHKDYNYSHNYCS-GVCGHYTQLVWANTTDV 168          
BLAST of GLI pathogenesis related 1 vs. TrEMBL
Match: A0A564YFQ7 (SCP domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS5585 PE=3 SV=1)

HSP 1 Score: 117.472 bits (293), Expect = 1.212e-29
Identity = 52/119 (43.70%), Postives = 84/119 (70.59%), Query Frame = 1
Query:  184 QKEILDAHNKYRALVASGKVPKQPTAANMLKMKWNSESATKAQKTANICKFSHDTVTDRKYGKFEWVGQNIALFSDSNVVKGVEMWYKENSVYIFSNNSCSLKTCGHFTQVLWADSQEL 540
            ++E+LD  N+YR  VA+G+VP QP ++ +  +KWN+E    AQ+ A+ C+F HD+  DRK  +F WVGQNIA    S++ + V+MW++E+  Y +S+N CS   CGH+TQ++WA++ ++
Sbjct:   53 KQELLDLQNQYRREVAAGRVPNQPASSKIRDLKWNTELEASAQRHADRCRFQHDSSDDRKTAEFWWVGQNIAY--SSSIAQNVKMWFEEHKDYNYSHNYCS-GVCGHYTQLVWANTTDV 168          
BLAST of GLI pathogenesis related 1 vs. TrEMBL
Match: A0A4E0RMR8 (Peptidase inhibitor 16 OS=Fasciola hepatica OX=6192 GN=D915_001060 PE=3 SV=1)

HSP 1 Score: 114.39 bits (285), Expect = 1.318e-28
Identity = 56/143 (39.16%), Postives = 87/143 (60.84%), Query Frame = 1
Query:  115 LILISTLFFICFKSASSDLTEAQQKEILDAHNKYRALVASGKVPKQPTAANMLKMKWNSESATKAQKTANICKFSHDTVTDRKYGKFEWVGQNIALFSDSNVVKGVEMWYKENSVYIFSNNSCSL-KTCGHFTQVLWADSQEL 540
            ++ + TL+ I     S   T  +++  +D HNKYR ++ +GKV  QP A++M  + W+ E A KAQ  AN C+  HDT+ +R+  +F WVGQN A     NV   V +W++E+  Y F  NSC   + CGH+TQV+WA ++++
Sbjct:   12 VVTLLTLYHI-----SMSTTRVERRRFVDEHNKYRTMLMAGKVSGQPRASSMKMLTWDEELARKAQFLANKCQVGHDTLMERQTKEFHWVGQNWA--GTFNVSDTVRLWFEEHRHYSFEKNSCKPGRMCGHYTQVVWASTRKV 147          
BLAST of GLI pathogenesis related 1 vs. TrEMBL
Match: A0A5K3ENG8 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 112.464 bits (280), Expect = 1.018e-27
Identity = 49/121 (40.50%), Postives = 84/121 (69.42%), Query Frame = 1
Query:  178 AQQKEILDAHNKYRALVASGKVPKQPTAANMLKMKWNSESATKAQKTANICKFSHDTVTDRKYGKFEWVGQNIALFSDSNVVKGVEMWYKENSVYIFSNNSCSLKTCGHFTQVLWADSQEL 540
            A++ E+L+ HNKYR LV+ G++ +QP+++ +  +KW++E    AQ+ A+ C+F+HD+   R+  +++WVGQNIA    S++ K VEMW+ E   Y + +N CS   CGH+TQ++WA++  +
Sbjct:   55 AEKSELLNLHNKYRRLVSDGQIREQPSSSKIHDLKWSTELEASAQRHADTCRFAHDSADARRTPQWDWVGQNIAY--SSSIAKNVEMWFDEYKEYNYQSNYCS-GVCGHYTQLVWANTTHV 172          
BLAST of GLI pathogenesis related 1 vs. Ensembl Cavefish
Match: ENSAMXT00000032496.1 (pep primary_assembly:Astyanax_mexicanus-2.0:18:32321795:32342374:-1 gene:ENSAMXG00000031919.1 transcript:ENSAMXT00000032496.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 75.485 bits (184), Expect = 1.310e-16
Identity = 45/129 (34.88%), Postives = 70/129 (54.26%), Query Frame = 1
Query:  163 SDLTEAQQKEILDAHNKYRALVASGKVPKQPTAANMLKMKWNSESATKAQKTANICKFSHDTVTDRKYGKFEWVGQNIALFSDSNVVK---GVEMWYKENSVYIFSNNSCSLKTCGHFTQVLWADSQEL 540
            +D+T  Q  EI++ HN +R  V+       P+A NMLKM W+ E+A  AQ  AN C   H   + R  G ++ +G+N  LF  + +VK    V  W+ E + Y++   S + +  GH+TQV+W  S  +
Sbjct:   37 TDVTSVQD-EIVNLHNVFRRGVS-------PSATNMLKMNWSREAAVSAQNWANTCSMVHGDPSTRMLGTYQ-MGEN--LFKSTGMVKWTSVVTAWHNEVANYVYPTGSANTQPIGHYTQVVWYSSYSV 154          
BLAST of GLI pathogenesis related 1 vs. Ensembl Cavefish
Match: ENSAMXT00000054643.1 (glioma pathogenesis-related protein 1-like [Source:NCBI gene;Acc:103030109])

HSP 1 Score: 70.4774 bits (171), Expect = 1.207e-14
Identity = 48/159 (30.19%), Postives = 76/159 (47.80%), Query Frame = 1
Query:  106 MNLLILISTLFFICFKSASS-------DLTEAQ-QKEILDAHNKYRALVASGKVPKQPTAANMLKMKWNSESATKAQKTANICKFSHDTV---TDRKYGKFEWVGQNIAL---FSDSNVVKGVEMWYKENSVYIFSNNSCSLKTCGHFTQVLWADSQEL 540
            M+LL  ++    + F            D+TE    +  + AHN +R+  +       P AANM  M W+   A  A+  A  CK SH+ +     + +  F  VG+NI L   +S   V   ++ W +E + Y   N SC+ + CGH+TQ++WA S +L
Sbjct:    1 MDLLGPLALWLTVLFSGPRGVLALVLPDITEPDFIRRCVQAHNAHRSRAS-------PHAANMRLMTWDDALAKGARSWARHCKASHNPILQHMGQAHPDFRRVGENIWLGSPYSAFTVESAIQTWNQEGADYTHRNRSCA-RVCGHYTQLMWATSYKL 151          
BLAST of GLI pathogenesis related 1 vs. Ensembl Cavefish
Match: ENSAMXT00000030308.1 (glioma pathogenesis-related protein 1-like [Source:NCBI gene;Acc:103030109])

HSP 1 Score: 69.707 bits (169), Expect = 1.265e-14
Identity = 44/132 (33.33%), Postives = 68/132 (51.52%), Query Frame = 1
Query:  166 DLTEAQ-QKEILDAHNKYRALVASGKVPKQPTAANMLKMKWNSESATKAQKTANICKFSHDTV---TDRKYGKFEWVGQNIAL---FSDSNVVKGVEMWYKENSVYIFSNNSCSLKTCGHFTQVLWADSQEL 540
            D+TE    +  + AHN +R+  +       P AANM  M W+   A  A+  A  CK SH+ +     + +  F  VG+NI L   +S   V   ++ W +E + Y   N SC+ + CGH+TQ++WA S +L
Sbjct:   28 DITEPDFIRRCVQAHNAHRSRAS-------PHAANMRLMTWDDALAKGARSWARHCKASHNPILQHMGQAHPDFRRVGENIWLGSPYSAFTVESAIQTWNQEGADYTHRNRSCA-RVCGHYTQLMWATSYKL 151          
BLAST of GLI pathogenesis related 1 vs. Ensembl Cavefish
Match: ENSAMXT00000053689.1 (glioma pathogenesis-related protein 1-like [Source:NCBI gene;Acc:103030109])

HSP 1 Score: 70.0922 bits (170), Expect = 1.414e-14
Identity = 48/159 (30.19%), Postives = 76/159 (47.80%), Query Frame = 1
Query:  106 MNLLILISTLFFICFKSASS-------DLTEAQ-QKEILDAHNKYRALVASGKVPKQPTAANMLKMKWNSESATKAQKTANICKFSHDTV---TDRKYGKFEWVGQNIAL---FSDSNVVKGVEMWYKENSVYIFSNNSCSLKTCGHFTQVLWADSQEL 540
            M+LL  ++    + F            D+TE    +  + AHN +R+  +       P AANM  M W+   A  A+  A  CK SH+ +     + +  F  VG+NI L   +S   V   ++ W +E + Y   N SC+ + CGH+TQ++WA S +L
Sbjct:    1 MDLLGPLALWLTVLFSGPRGVLALVLPDITEPDFIRRCVQAHNAHRSRAS-------PHAANMRLMTWDDALAKGARSWARHCKASHNPILQHMGQAHPDFRRVGENIWLGSPYSAFTVESAIQTWNQEGADYTHRNRSCA-RVCGHYTQLMWATSYKL 151          
BLAST of GLI pathogenesis related 1 vs. Ensembl Cavefish
Match: ENSAMXT00000036030.1 (peptidase inhibitor 16 [Source:NCBI gene;Acc:103029846])

HSP 1 Score: 69.707 bits (169), Expect = 1.814e-14
Identity = 38/142 (26.76%), Postives = 75/142 (52.82%), Query Frame = 1
Query:  121 LISTLFFICFKSASSDLTEAQQKEILDAHNKYRALVASGKVPKQPTAANMLKMKWNSESATKAQKTANICKFSHDTVTDRKYGKFEWVGQNIALFSDS-NVVKGVEMWYKENSVYIFSNNSCSL-KTCGHFTQVLWADSQEL 540
            LI    ++          +  Q+ I++ HN +R+ V       +P AA+M+ MKW+ E A  A++ A  C + H+  +         +G+N+ + +   ++ K +  W+ E+  Y + NN+C+  + CGH+TQ++WA ++E+
Sbjct:    9 LICAGLWMLLAPGRGQFPKEDQQRIVNLHNHHRSTV-------EPPAADMIHMKWSGELALIAKEYATKCIWEHNPDSQNI------MGENLFITTGPLDIEKALSDWFMEHKHYSYDNNTCAENEMCGHYTQMVWAKTKEV 137          
BLAST of GLI pathogenesis related 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000374.1 (pep scaffold:Pmarinus_7.0:GL476650:75849:87118:-1 gene:ENSPMAG00000000334.1 transcript:ENSPMAT00000000374.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 59.3066 bits (142), Expect = 3.330e-11
Identity = 35/135 (25.93%), Postives = 66/135 (48.89%), Query Frame = 1
Query:  169 LTEAQQKEILDAHNKYRALVASGKVPKQPTAANMLKMKWNSESATKAQKTANICKFSHDTVTDRKYGKFEWVGQNIALF--SDSNVVKGVEMWYKENSVYIFSN---------NSCSLKTCGHFTQVLWADSQEL 540
            + + +++ + + HN+ RA V        P AA+M  M W+ E A  A+  A  CK+ H         + + +GQN+A++  S+  +   V+ W+ E   Y +           ++C    C H+TQ++WA+S+ +
Sbjct:    1 IADDERRALTEYHNRLRASV-------HPQAADMEHMSWDWELAGMAEAWAKQCKWGHGPSD-----QLDAIGQNLAVYVGSERPLAYHVQAWFDEEEWYQYPEEKECSPECPHTCRGPICTHYTQLVWAESRRV 123          
BLAST of GLI pathogenesis related 1 vs. Ensembl Sea Lamprey
Match: CRISP3 (cysteine rich secretory protein 3 [Source:HGNC Symbol;Acc:HGNC:16904])

HSP 1 Score: 51.2174 bits (121), Expect = 1.471e-8
Identity = 38/122 (31.15%), Postives = 56/122 (45.90%), Query Frame = 1
Query:  184 QKEILDAHNKYRALVASGKVPKQPTAANMLKMKWNSESATKAQKTANICKFSHDTVTDRKYGKFEWVGQNIALFSDSNVVK-GVEMWYKE--NSVYIFSNNSCSLKTCGHFTQVLWADSQEL 540
            Q  I+D HN  R  V        P+A NML+M W  E+   A   AN C F H     RK  ++   G+NI + S        +  WY E  +  + +   S +    GH+TQ++W +S +L
Sbjct:   44 QTFIVDLHNDLRRNVT-------PSAGNMLQMMWKKEAYLNALSWANNCTFGHSPDARRKTTQWT-CGENIFMSSAPFTWNYAIRDWYNEVISPGFQYDVGSTTTGAVGHYTQLVWYNSFQL 157          
BLAST of GLI pathogenesis related 1 vs. Ensembl Yeast
Match: PRY3 (Cell wall-associated protein involved in export of acetylated sterols; member of the CAP protein superfamily (cysteine-rich secretory proteins (CRISP), antigen 5, and pathogenesis related 1 proteins); role in mating efficiency; expression of full-length transcript is daughter cell-specific; in response to alpha factor, a short transcript starting at +452 is expressed and the long form is repressed by Ste12p [Source:SGD;Acc:S000003614])

HSP 1 Score: 51.9878 bits (123), Expect = 9.790e-9
Identity = 40/120 (33.33%), Postives = 61/120 (50.83%), Query Frame = 1
Query:  184 QKEILDAHNKYRALVASGKVPKQPTAANMLKMKWNSESATKAQKTANICKFSHDTVTDRKYGKFEWVGQNIAL-FSDSNVVKGVEMWYKENSVYIFSNNSCSLKTCGHFTQVLWADSQEL 540
            + ++L+ HNK+RAL     V   P       + W+   AT AQ  A+  ++    V     G +   G+N+AL ++D+     V+ WY E S Y +SN   S  T GHFTQV+W  + E+
Sbjct:   26 ESDVLNEHNKFRAL----HVDTAP-------LTWSDTLATYAQNYAD--QYDCSGVLTHSDGPY---GENLALGYTDTG---AVDAWYGEISKYNYSNPGFSEST-GHFTQVVWKSTAEI 125          
BLAST of GLI pathogenesis related 1 vs. Ensembl Yeast
Match: PRY1 (Sterol binding protein involved in the export of acetylated sterols; secreted glycoprotein and member of the CAP protein superfamily (cysteine-rich secretory proteins (CRISP), antigen 5, and pathogenesis related 1 proteins); sterol export function is redundant with that of PRY2; may be involved in detoxification of hydrophobic compounds; PRY1 has a paralog, PRY2, that arose from the whole genome duplication [Source:SGD;Acc:S000003615])

HSP 1 Score: 43.1282 bits (100), Expect = 7.298e-6
Identity = 41/116 (35.34%), Postives = 56/116 (48.28%), Query Frame = 1
Query:  193 ILDAHNKYRALVASGKVPKQPTAANMLKMKWNSESATKAQKTANICKFSHDTVTDRKYGKFEWVGQNIALFSDSNVVKGVEMWYKENSVYIFSNNSCSLKTCGHFTQVLWADSQEL 540
            +L  HNK RAL        + T A    + W+   A+ AQ  A+    S  T+T    G +   G+N+AL  D      V+ WY E S Y FSN   S  T GHFTQV+W  + ++
Sbjct:  166 VLAEHNKKRAL-------HKDTPA----LSWSDTLASYAQDYADNYDCS-GTLTHSG-GPY---GENLALGYDGPAA--VDAWYNEISNYDFSNPGFSSNT-GHFTQVVWKSTTQV 262          
BLAST of GLI pathogenesis related 1 vs. Ensembl Nematostella
Match: EDO48880 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHM7])

HSP 1 Score: 56.6102 bits (135), Expect = 9.019e-11
Identity = 43/121 (35.54%), Postives = 58/121 (47.93%), Query Frame = 1
Query:  184 QKEILDAHNKYRALVASGKVPKQPTAANMLKMKWNSESATKAQKTANICKFSHDTVTDRKYGKFEWVGQNIALFSDSNVVKG--VEMWYKENSVYIFSNNSCSLKTCGHFTQVLWADSQEL 540
            QKE LD+HN YRA    G  P          +KW+++ A+   K A     +         G++   G+N+A  S   +  G   EMWY E   Y F+N   S  T GHFTQV+W  SQE+
Sbjct:    6 QKECLDSHNAYRA--QHGAPP----------LKWSAKLASDCDKWAK--DLARRNTMQHSKGEY---GENLAFASGYELSGGRTTEMWYDEIQKYRFNNPGFSSGT-GHFTQVVWVGSQEM 108          
BLAST of GLI pathogenesis related 1 vs. Ensembl Nematostella
Match: EDO49310 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RH92])

HSP 1 Score: 58.151 bits (139), Expect = 1.477e-10
Identity = 38/129 (29.46%), Postives = 61/129 (47.29%), Query Frame = 1
Query:  169 LTEAQQKEILDAHNKYRALVASGKVPKQPTAANMLKMKWNSESATKAQ----KTANICKFSHDTVTDRKYGKFEWVGQNIALFSDS-NVVKGVEMWYKENSVYIFSNNSCSLKTCGHFTQVLWADSQEL 540
            + E  +  ILD HN YRA+             N   ++W++  A  AQ    K A   +  H +  DR Y      G+NI   S   ++   +++WY E+  Y + N   +L T GHFTQ++W  ++E+
Sbjct:  209 VDEDTRSRILDIHNNYRAM------------HNAAPLRWSAALAKDAQAWAGKLAREGRLEHASREDRYY-----KGENICRMSHHFDIGDALQIWYNESESYQYDNPGFAL-TTGHFTQIVWRGTREV 319          

HSP 2 Score: 51.2174 bits (121), Expect = 3.677e-8
Identity = 39/123 (31.71%), Postives = 59/123 (47.97%), Query Frame = 1
Query:  187 KEILDAHNKYRALVASGKVPKQPTAANMLKMKWNSESATKAQKTANICKFSHDTVTDR-KYGKFEWVGQNIALFSDSNVVKGVEM----WYKENSVYIFSNNSCSLKTCGHFTQVLWADSQEL 540
            ++ LDAHN+YRA+             N+  + W++  A +AQK AN        + D+ + G+    G+N+ + S +N     E     WY+E   Y F        T GHFTQV+W  S+EL
Sbjct:    6 RKSLDAHNRYRAM------------HNVPPLTWSNSIAREAQKWANKLAKEGKLIHDKSRSGQ----GENVFMSSGANFDDAGEAACESWYQEVERYNFQRGGHQSGT-GHFTQVVWKSSEEL 111          
BLAST of GLI pathogenesis related 1 vs. Ensembl Nematostella
Match: EDO48663 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI98])

HSP 1 Score: 55.4546 bits (132), Expect = 2.423e-10
Identity = 40/124 (32.26%), Postives = 58/124 (46.77%), Query Frame = 1
Query:  190 EILDAHNKYRALVASGKVPKQPTAANMLKMKWNSESATKAQ----KTANICKFSHDTVTDRKYGKFEWVGQNIALFSDSNVVKG---VEMWYKENSVYIFSNNSCSLKTCGHFTQVLWADSQEL 540
            + +D HNKYRA+ ++              +KW+ E A +AQ    K A      H +   R        G+N+A+FS      G    EMWY+E+  Y F      + T GHFTQ++W  S+EL
Sbjct:    6 QCVDNHNKYRAMHSA------------PPLKWSDELAREAQYYAEKLAQQRSMQHSSKCSRND-----AGENLAMFSGRYDTAGDMACEMWYEESKKYSFVRGGSQMGT-GHFTQMVWKGSKEL 111          
BLAST of GLI pathogenesis related 1 vs. Ensembl Nematostella
Match: EDO49309 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RH91])

HSP 1 Score: 54.299 bits (129), Expect = 1.458e-9
Identity = 44/136 (32.35%), Postives = 64/136 (47.06%), Query Frame = 1
Query:  154 SASSDLTEAQQKEILDAHNKYRALVASGKVPKQPTAANMLKMKWNSESATKAQ----KTANICKFSHDTVTDRKYGKFEWVGQNIALFSDSNVVKGVE---MWYKENSVYIFSNNSCSLKTCGHFTQVLWADSQEL 540
            S+S    E  Q++ LDAHN +RA               +  +KW+ + A  AQ    K A      H T   R+ G+    G+N+A+F+      G E   MWY+E++ Y F N        GHFTQV+W  ++EL
Sbjct:   32 SSSRATLELFQQQALDAHNYFRAFHG------------VKNLKWSHDLARGAQAWAEKLARERTLKHST---RERGE---DGENLAMFTGKYESAGEEATNMWYEESAYYNF-NRPGYQSNTGHFTQVVWKGTKEL 148          
BLAST of GLI pathogenesis related 1 vs. Ensembl Nematostella
Match: EDO48881 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHM8])

HSP 1 Score: 51.6026 bits (122), Expect = 5.625e-9
Identity = 43/125 (34.40%), Postives = 62/125 (49.60%), Query Frame = 1
Query:  184 QKEILDAHNKYRALVASGKVPKQPTAANMLKMKWNSESATKAQKTA-NICK---FSHDTVTDRKYGKFEWVGQNIALFSDSNVV--KGVEMWYKENSVYIFSNNSCSLKTCGHFTQVLWADSQEL 540
            + +IL  HN YRA        +  T A    +KWN+  A++AQ  A N+ +     H +   R+YG      ++IA  S + +   K  +MWY E   Y F N   S  + GHFTQV+WA S E+
Sbjct:    3 KNDILKTHNDYRA--------QHGTKA----LKWNARLASEAQSWAENLAQRNAIQHSS--SREYG------ESIAYMSGAVLTGRKATDMWYGEVDKYRFENPGFST-SSGHFTQVVWAGSTEM 106          
BLAST of GLI pathogenesis related 1 vs. Ensembl Medaka
Match: ENSORLT00000023160.2 (peptidase inhibitor 16 [Source:NCBI gene;Acc:101164782])

HSP 1 Score: 72.0182 bits (175), Expect = 6.532e-15
Identity = 42/126 (33.33%), Postives = 68/126 (53.97%), Query Frame = 1
Query:  169 LTEAQQKEILDAHNKYRALVASGKVPKQPTAANMLKMKWNSESATKAQKTANICKFSHDTVTDRKYGKFEWVGQNI-ALFSDSNVVKGVEMWYKENSVYIFSNNSCSL-KTCGHFTQVLWADSQEL 540
            LT+ Q++ +++ HN YR  V+       P+AA ML +KW+      A+  A  C + H+T       + E  G+N+ A     ++ + VE W+ E   Y + NNSC   K CGH+TQ++WAD+  +
Sbjct:   57 LTDQQEEMLVELHNHYRGQVS-------PSAAAMLPLKWDGNLKLVAEGYAAKCIWEHNT-------ELEDTGENLFAGTGKLDLSEAVEKWFLERLDYSYENNSCDEDKMCGHYTQMVWADTHRV 168          
BLAST of GLI pathogenesis related 1 vs. Ensembl Medaka
Match: ENSORLT00000020676.2 (cysteine-rich venom protein pseudecin-like [Source:NCBI gene;Acc:101157728])

HSP 1 Score: 70.0922 bits (170), Expect = 8.598e-15
Identity = 43/123 (34.96%), Postives = 65/123 (52.85%), Query Frame = 1
Query:  178 AQQKEILDAHNKYRALVASGKVPKQPTAANMLKMKWNSESATKAQKTANICKFSHDTVTDRKYGKFEWVGQNIALFSDSNVV--KGVEMWYKENSVYIFSNNSCSLKTCGHFTQVLWADSQEL 540
            A Q EI+D HN +R  V       +P AA+ML M ++ E A  AQ   + C   H   + R    +E +G+N+  +S S ++    +  WYKE S + F N S + K  GH+TQV+W  S ++
Sbjct:   14 AVQAEIVDVHNAFRRAV-------EPPAADMLMMSYSEELAVSAQAWVDKCVLDHGPPSSRMLNGYE-LGENL-FYSTSPMLWKSIINAWYKEVSHFAFPNASTNGKPVGHYTQVVWNSSYKV 127          
BLAST of GLI pathogenesis related 1 vs. Ensembl Medaka
Match: ENSORLT00000020674.2 (cysteine-rich venom protein pseudecin-like [Source:NCBI gene;Acc:101157728])

HSP 1 Score: 70.4774 bits (171), Expect = 9.147e-15
Identity = 48/147 (32.65%), Postives = 74/147 (50.34%), Query Frame = 1
Query:  115 LILISTLFFICFKSASSDLTE---AQQKEILDAHNKYRALVASGKVPKQPTAANMLKMKWNSESATKAQKTANICKFSHDTVTDRKYGKFEWVGQNIALFSDSNVV--KGVEMWYKENSVYIFSNNSCSLKTCGHFTQVLWADSQEL 540
            L+ I TL  +      +D+     A Q EI+D HN +R  V       +P AA+ML M ++ E A  AQ   + C   H   + R    +E +G+N+  +S S ++    +  WYKE S + F N S + K  GH+TQV+W  S ++
Sbjct:    5 LVCILTLQGVRSACVLADICPEDTAVQAEIVDVHNAFRRAV-------EPPAADMLMMSYSEELAVSAQAWVDKCVLDHGPPSSRMLNGYE-LGENL-FYSTSPMLWKSIINAWYKEVSHFAFPNASTNGKPVGHYTQVVWNSSYKV 142          
BLAST of GLI pathogenesis related 1 vs. Ensembl Medaka
Match: ENSORLT00000043877.1 (Golgi-associated plant pathogenesis-related protein 1-like [Source:NCBI gene;Acc:101166141])

HSP 1 Score: 53.9138 bits (128), Expect = 3.459e-9
Identity = 48/139 (34.53%), Postives = 63/139 (45.32%), Query Frame = 1
Query:  142 ICFKSASSDLTEAQQKEILDAHNKYRALVASGKVPKQPTAANMLKMKWNSESATKAQKTANICKFSHDTV-TDRKYGKFEWVGQNIALFSDSNVVK-----GVEMWYKENSVYIFSNNSCSLKTCGHFTQVLWADSQEL 540
            ICF        E  Q+E L+AHN YRAL   G  P          + +N E   +AQK A+ C  +H    +D +       G+N+   S S  VK      V+ WY E   Y F        T GHFTQV+W +S+EL
Sbjct:    4 ICFAD------EEFQQEFLNAHNAYRAL--HGAPP----------LTYNKELCDEAQKWADTCLRTHTLGHSDTE------EGENVFYKSGSPPVKVTGKDAVDAWYSEIKDYNFKKPGSQSGT-GHFTQVVWKESKEL 117          
BLAST of GLI pathogenesis related 1 vs. Ensembl Medaka
Match: ENSORLT00000020413.2 (Golgi-associated plant pathogenesis-related protein 1-like [Source:NCBI gene;Acc:101166141])

HSP 1 Score: 53.1434 bits (126), Expect = 6.378e-9
Identity = 45/129 (34.88%), Postives = 58/129 (44.96%), Query Frame = 1
Query:  184 QKEILDAHNKYRALVASGKVPKQPTAANMLKMKWNSESATKAQKTANICKFSH-----DTVTDRKYGKFEWVGQNIALFSDSNVVK-----GVEMWYKENSVYIFSNNSCSLKTCGHFTQVLWADSQEL 540
            Q+E L+AHN YRAL   G  P          + +N E   +AQK A+ C  +H     DT            G+N+   S S  VK      V+ WY E   Y F        T GHFTQV+W +S+EL
Sbjct:    7 QQEFLNAHNAYRAL--HGAPP----------LTYNKELCDEAQKWADTCLRTHTLGHSDTEE----------GENVFYKSGSPPVKVTGKDAVDAWYSEIKDYNFKKPGSQSGT-GHFTQVVWKESKEL 112          
BLAST of GLI pathogenesis related 1 vs. Planmine SMEST
Match: SMESG000001227.1 (SMESG000001227.1)

HSP 1 Score: 301.212 bits (770), Expect = 1.653e-105
Identity = 144/145 (99.31%), Postives = 145/145 (100.00%), Query Frame = 1
Query:  106 MNLLILISTLFFICFKSASSDLTEAQQKEILDAHNKYRALVASGKVPKQPTAANMLKMKWNSESATKAQKTANICKFSHDTVTDRKYGKFEWVGQNIALFSDSNVVKGVEMWYKENSVYIFSNNSCSLKTCGHFTQVLWADSQEL 540
            MNL+ILISTLFFICFKSASSDLTEAQQKEILDAHNKYRALVASGKVPKQPTAANMLKMKWNSESATKAQKTANICKFSHDTVTDRKYGKFEWVGQNIALFSDSNVVKGVEMWYKENSVYIFSNNSCSLKTCGHFTQVLWADSQEL
Sbjct:    1 MNLIILISTLFFICFKSASSDLTEAQQKEILDAHNKYRALVASGKVPKQPTAANMLKMKWNSESATKAQKTANICKFSHDTVTDRKYGKFEWVGQNIALFSDSNVVKGVEMWYKENSVYIFSNNSCSLKTCGHFTQVLWADSQEL 145          
BLAST of GLI pathogenesis related 1 vs. Planmine SMEST
Match: SMESG000055797.1 (SMESG000055797.1)

HSP 1 Score: 176.407 bits (446), Expect = 2.986e-56
Identity = 78/147 (53.06%), Postives = 108/147 (73.47%), Query Frame = 1
Query:  100 IKMNLLILISTLFFICFKSASSDLTEAQQKEILDAHNKYRALVASGKVPKQPTAANMLKMKWNSESATKAQKTANICKFSHDTVTDRKYGKFEWVGQNIALFSDSNVVKGVEMWYKENSVYIFSNNSCSLKTCGHFTQVLWADSQEL 540
            I MN +I I T   +     S DL+E ++ +IL+ HNK+R  VA+G+V  QP AANM +M W+ E+A++AQ TA+ C F+HDT+ DRKYG +EWVGQNIA+F+  N+ KGV++W+ E S Y FS+NSCS  TCGH+TQ++WA S+EL
Sbjct:    4 ITMNFIIKI-TFVLVALDFCSGDLSEEERNQILEIHNKFRKSVANGEVSNQPKAANMQQMVWSEEAASRAQATADKCSFNHDTINDRKYGNYEWVGQNIAMFTGGNIAKGVQLWFNEVSGYTFSDNSCSENTCGHYTQIVWAKSKEL 149          
BLAST of GLI pathogenesis related 1 vs. Planmine SMEST
Match: SMESG000055797.1 (SMESG000055797.1)

HSP 1 Score: 174.866 bits (442), Expect = 9.265e-56
Identity = 77/145 (53.10%), Postives = 107/145 (73.79%), Query Frame = 1
Query:  106 MNLLILISTLFFICFKSASSDLTEAQQKEILDAHNKYRALVASGKVPKQPTAANMLKMKWNSESATKAQKTANICKFSHDTVTDRKYGKFEWVGQNIALFSDSNVVKGVEMWYKENSVYIFSNNSCSLKTCGHFTQVLWADSQEL 540
            MN +I I T   +     S DL+E ++ +IL+ HNK+R  VA+G+V  QP AANM +M W+ E+A++AQ TA+ C F+HDT+ DRKYG +EWVGQNIA+F+  N+ KGV++W+ E S Y FS+NSCS  TCGH+TQ++WA S+EL
Sbjct:    1 MNFIIKI-TFVLVALDFCSGDLSEEERNQILEIHNKFRKSVANGEVSNQPKAANMQQMVWSEEAASRAQATADKCSFNHDTINDRKYGNYEWVGQNIAMFTGGNIAKGVQLWFNEVSGYTFSDNSCSENTCGHYTQIVWAKSKEL 144          
BLAST of GLI pathogenesis related 1 vs. Planmine SMEST
Match: SMESG000016022.1 (SMESG000016022.1)

HSP 1 Score: 170.244 bits (430), Expect = 7.890e-54
Identity = 80/145 (55.17%), Postives = 103/145 (71.03%), Query Frame = 1
Query:  106 MNLLILISTLFFICFKSASSDLTEAQQKEILDAHNKYRALVASGKVPKQPTAANMLKMKWNSESATKAQKTANICKFSHDTVTDRKYGKFEWVGQNIALFSDSNVVKGVEMWYKENSVYIFSNNSCSLKTCGHFTQVLWADSQEL 540
            MN LI I+ +  +     S DL+E ++  +LD HNKYR  VA G V  QP A NM +M WN+ESA+KAQ +A+ C F+H T  DRKYG FE VGQN+A+FS  N+ +GVE+WY E   + FSNN+CSLKTCGH+TQ++WADS EL
Sbjct:    1 MNFLIKIAFVLVV-LDFCSGDLSEKEKNLLLDVHNKYRGNVAQGVVSGQPPATNMQQMVWNAESASKAQISADKCIFAHGTKDDRKYGDFESVGQNVAMFSGKNIFRGVELWYNEAFGFTFSNNTCSLKTCGHYTQLVWADSSEL 144          
BLAST of GLI pathogenesis related 1 vs. Planmine SMEST
Match: SMESG000076290.1 (SMESG000076290.1)

HSP 1 Score: 166.777 bits (421), Expect = 9.157e-53
Identity = 76/145 (52.41%), Postives = 105/145 (72.41%), Query Frame = 1
Query:  106 MNLLILISTLFFICFKSASSDLTEAQQKEILDAHNKYRALVASGKVPKQPTAANMLKMKWNSESATKAQKTANICKFSHDTVTDRKYGKFEWVGQNIALFSDSNVVKGVEMWYKENSVYIFSNNSCSLKTCGHFTQVLWADSQEL 540
            MN LI I+    +     S DL+E +  ++LD H+ YR  VA+G+V +QP A NM  +KWN+ESA KAQK+AN C F+HDT+ +RKYG FEWVGQN+A F+  N+ +GVE+WY +   + FS+NSCSL TCGH+TQ++WA+S E+
Sbjct:    1 MNFLIKIA-FVLVAQDFCSGDLSETEIYKLLDMHHIYRRSVAAGEVREQPPAKNMPSLKWNAESALKAQKSANKCIFAHDTIDERKYGGFEWVGQNVAKFTGENIARGVELWYNQVYGFTFSDNSCSLPTCGHYTQLVWANSTEV 144          
The following BLAST results are available for this feature:
BLAST of GLI pathogenesis related 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GLIPR1L16.441e-1739.32GLIPR1 like 1 [Source:HGNC Symbol;Acc:HGNC:28392][more]
GLIPR1L16.680e-1739.32GLIPR1 like 1 [Source:HGNC Symbol;Acc:HGNC:28392][more]
PI161.320e-1432.28peptidase inhibitor 16 [Source:HGNC Symbol;Acc:HGN... [more]
PI161.320e-1432.28peptidase inhibitor 16 [Source:HGNC Symbol;Acc:HGN... [more]
PI161.320e-1432.28peptidase inhibitor 16 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of GLI pathogenesis related 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
scl-153.355e-1333.76SCP-Like extracellular protein [Source:UniProtKB/... [more]
scl-112.766e-1231.25SCP-Like extracellular protein [Source:UniProtKB/... [more]
scl-78.453e-1129.45SCP-Like extracellular protein [Source:UniProtKB/... [more]
scl-21.986e-1030.07SCP-Like extracellular protein [Source:UniProtKB/... [more]
scl-21.986e-1030.07SCP-Like extracellular protein [Source:UniProtKB/... [more]
back to top
BLAST of GLI pathogenesis related 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG84836.757e-1932.89gene:FBgn0038126 transcript:FBtr0082782[more]
CG94003.904e-933.75gene:FBgn0030562 transcript:FBtr0073920[more]
Ag5r2.969e-830.69gene:FBgn0015010 transcript:FBtr0333658[more]
Ag5r2.969e-830.69gene:FBgn0015010 transcript:FBtr0073937[more]
Ag5r2.969e-830.69gene:FBgn0015010 transcript:FBtr0305582[more]
back to top
BLAST of GLI pathogenesis related 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
glipr1a8.336e-1535.76GLI pathogenesis-related 1a [Source:ZFIN;Acc:ZDB-G... [more]
glipr1a8.864e-1535.76GLI pathogenesis-related 1a [Source:ZFIN;Acc:ZDB-G... [more]
CABZ01068499.16.953e-1433.33cysteine-rich venom protein natrin-1-like [Source:... [more]
glipr1b1.078e-1332.45GLI pathogenesis-related 1b [Source:ZFIN;Acc:ZDB-G... [more]
pi15b2.506e-1029.63peptidase inhibitor 15b [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of GLI pathogenesis related 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000036788.14.136e-1331.93pep primary_assembly:Xenopus_tropicalis_v9.1:KV464... [more]
R3HDML4.458e-1329.57R3H domain containing-like [Source:NCBI gene;Acc:1... [more]
ENSXETT00000011066.15.347e-1230.72pep primary_assembly:Xenopus_tropicalis_v9.1:KV460... [more]
R3HDML6.772e-1230.37R3H domain containing-like [Source:NCBI gene;Acc:1... [more]
ENSXETT00000010663.12.776e-1130.46pep primary_assembly:Xenopus_tropicalis_v9.1:KV460... [more]
back to top
BLAST of GLI pathogenesis related 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pi161.306e-1631.06peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:... [more]
Pi162.100e-1631.06peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:... [more]
Pi162.100e-1631.06peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:... [more]
Pi167.475e-1632.28peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:... [more]
Glipr13.416e-1537.19GLI pathogenesis-related 1 (glioma) [Source:MGI Sy... [more]
back to top
BLAST of GLI pathogenesis related 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P0DPV2|VA558_SCODE3.556e-2135.63Scoloptoxin SSD558 OS=Scolopendra dehaani OX=26097... [more]
sp|P0DPU1|VA576_SCODE6.040e-2135.63Scoloptoxin SSD976 OS=Scolopendra dehaani OX=26097... [more]
sp|P0DPU0|VA552_SCODE2.666e-1834.36Scoloptoxin SSD552 OS=Scolopendra dehaani OX=26097... [more]
sp|P0DPU2|VA543_SCODE4.745e-1832.00Scoloptoxin SSD43 OS=Scolopendra dehaani OX=260977... [more]
sp|P35787|VA5_VESVI2.084e-1741.01Venom allergen 5 OS=Vespula vidua OX=30215 PE=1 SV... [more]
back to top
BLAST of GLI pathogenesis related 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
I1ZI851.072e-4254.62GLI pathogenesis related-1 (Fragment) OS=Schmidtea... [more]
A0A0R3SFR17.782e-3043.70SCP domain-containing protein OS=Hymenolepis dimin... [more]
A0A564YFQ71.212e-2943.70SCP domain-containing protein OS=Hymenolepis dimin... [more]
A0A4E0RMR81.318e-2839.16Peptidase inhibitor 16 OS=Fasciola hepatica OX=619... [more]
A0A5K3ENG81.018e-2740.50Uncharacterized protein OS=Mesocestoides corti OX=... [more]
back to top
BLAST of GLI pathogenesis related 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000032496.11.310e-1634.88pep primary_assembly:Astyanax_mexicanus-2.0:18:323... [more]
ENSAMXT00000054643.11.207e-1430.19glioma pathogenesis-related protein 1-like [Source... [more]
ENSAMXT00000030308.11.265e-1433.33glioma pathogenesis-related protein 1-like [Source... [more]
ENSAMXT00000053689.11.414e-1430.19glioma pathogenesis-related protein 1-like [Source... [more]
ENSAMXT00000036030.11.814e-1426.76peptidase inhibitor 16 [Source:NCBI gene;Acc:10302... [more]
back to top
BLAST of GLI pathogenesis related 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000000374.13.330e-1125.93pep scaffold:Pmarinus_7.0:GL476650:75849:87118:-1 ... [more]
CRISP31.471e-831.15cysteine rich secretory protein 3 [Source:HGNC Sym... [more]
back to top
BLAST of GLI pathogenesis related 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
PRY39.790e-933.33Cell wall-associated protein involved in export of... [more]
PRY17.298e-635.34Sterol binding protein involved in the export of a... [more]
back to top
BLAST of GLI pathogenesis related 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO488809.019e-1135.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO493101.477e-1029.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO486632.423e-1032.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO493091.458e-932.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO488815.625e-934.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of GLI pathogenesis related 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000023160.26.532e-1533.33peptidase inhibitor 16 [Source:NCBI gene;Acc:10116... [more]
ENSORLT00000020676.28.598e-1534.96cysteine-rich venom protein pseudecin-like [Source... [more]
ENSORLT00000020674.29.147e-1532.65cysteine-rich venom protein pseudecin-like [Source... [more]
ENSORLT00000043877.13.459e-934.53Golgi-associated plant pathogenesis-related protei... [more]
ENSORLT00000020413.26.378e-934.88Golgi-associated plant pathogenesis-related protei... [more]
back to top
BLAST of GLI pathogenesis related 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000001227.11.653e-10599.31SMESG000001227.1[more]
SMESG000055797.12.986e-5653.06SMESG000055797.1[more]
SMESG000055797.19.265e-5653.10SMESG000055797.1[more]
SMESG000016022.17.890e-5455.17SMESG000016022.1[more]
SMESG000076290.19.157e-5352.41SMESG000076290.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011858 ID=SMED30011858|Name=GLI pathogenesis related 1|organism=Schmidtea mediterranea sexual|type=transcript|length=541bp
CATAATTTGAATTTTCCGCAAATTTGGTAATTCTTGTTCGGTCAAGCAGG
CATAAACTCTCTATAAAACTTCAGTGTTTTCTCGCAGTCTATTGTAAATA
TAAAAATGAATCTTCTTATTTTAATTTCAACTTTATTTTTTATTTGTTTC
AAATCTGCCTCTAGTGACCTTACAGAAGCCCAGCAGAAGGAAATCCTTGA
TGCTCACAACAAGTACAGAGCATTAGTTGCTAGTGGAAAAGTACCAAAGC
AACCCACTGCTGCAAATATGCTAAAAATGAAATGGAACTCTGAATCTGCG
ACAAAAGCACAAAAGACAGCGAATATATGCAAGTTTAGCCACGACACAGT
GACGGATCGCAAATACGGAAAGTTCGAATGGGTTGGGCAAAATATTGCCT
TGTTTAGTGATAGCAATGTTGTTAAGGGAGTAGAAATGTGGTATAAAGAA
AACTCTGTATACATATTTTCAAACAATTCATGCTCACTTAAAACATGTGG
TCATTTTACTCAAGTTTTATGGGCTGATTCTCAAGAACTTG
back to top

protein sequence of SMED30011858-orf-1

>SMED30011858-orf-1 ID=SMED30011858-orf-1|Name=SMED30011858-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=145bp
MNLLILISTLFFICFKSASSDLTEAQQKEILDAHNKYRALVASGKVPKQP
TAANMLKMKWNSESATKAQKTANICKFSHDTVTDRKYGKFEWVGQNIALF
SDSNVVKGVEMWYKENSVYIFSNNSCSLKTCGHFTQVLWADSQEL
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
GO:0005576extracellular region
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000484secretory system
Vocabulary: INTERPRO
TermDefinition
IPR035940CAP_sf
IPR001283CRISP-related
IPR014044CAP_domain
IPR018244Allrgn_V5/Tpx1_CS
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001283Cysteine-rich secretory protein-relatedPRINTSPR00837V5TPXLIKEcoord: 58..76
score: 35.68
coord: 131..145
score: 41.8
coord: 108..121
score: 28.65
IPR001283Cysteine-rich secretory protein-relatedPANTHERPTHR10334CYSTEINE-RICH SECRETORY PROTEIN-RELATEDcoord: 17..144
IPR014044CAP domainSMARTSM00198SCP_3coord: 25..145
e-value: 3.5E-21
score: 86.4
IPR014044CAP domainPFAMPF00188CAPcoord: 31..144
e-value: 3.6E-14
score: 53.7
IPR035940CAP superfamilyGENE3DG3DSA:3.40.33.10coord: 21..145
e-value: 2.5E-38
score: 133.6
IPR035940CAP superfamilySUPERFAMILYSSF55797PR-1-likecoord: 1..144
NoneNo IPR availablePANTHERPTHR10334:SF344AT27079P-RELATEDcoord: 17..144
NoneNo IPR availableCDDcd05380CAP_eukcoord: 27..142
e-value: 2.37062E-33
score: 112.548
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..20
score: 0.819
IPR018244Allergen V5/Tpx-1-related, conserved sitePROSITEPS01009CRISP_1coord: 132..142