Phospholipid scramblase

Overview
NamePhospholipid scramblase
Smed IDSMED30011854
Uniprot Best hitPhospholipid scramblase 2 OS=Bos taurus OX=9913 GN=PLSCR2 PE=2 SV=1 (E=2.1393e-30)
Length (bp)950
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Phospholipid scramblase (SMED30011854) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Phospholipid scramblase (SMED30011854) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011854

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30011854SMESG000050116.1 SmedASXL_011015SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
epidermal cellSMED30011854SMESG000050116.1 dd_Smed_v4_14409_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30011854SMESG000050116.1 dd_Smed_v6_14409_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30011854SMESG000050116.1 dd_Smed_v4_14409_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30011854SMESG000050116.1 dd_Smed_v4_14409_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Phospholipid scramblase vs. Ensembl Human
Match: PLSCR1 (phospholipid scramblase 1 [Source:HGNC Symbol;Acc:HGNC:9092])

HSP 1 Score: 117.857 bits (294), Expect = 3.041e-30
Identity = 74/230 (32.17%), Postives = 119/230 (51.74%), Query Frame = 3
Query:  108 WMTKAVVK-NCIPGLEYLTQLDSVLVKRMMNWIEILRKIDPKNKYIVKNMIGQSVYYAIEDSNQCLRWCCGTKRPSNIFVYDKSDSVVLKIEHPXXXXXXXXXXXXXXXXXXXXXXTTGSDQVLGYIQEINNCGFIVYFILDENSKLLLILKGPHYCHGCCSSRSDFSFKIMDNTGKVEIGAITNSWRCWTQEWLSNSENFGVQFPIDXXXXXXXXXXXXTFFIDFLYFE 794
            WM       NC PGLEYL+Q+D +L+ + +  +E+L   +  NKY +KN  GQ VY+A ED++ C R CCG  RP  + + D     V+ +E P + +     C   +               +GY+ +  +     + I +E  + +L + GP     CC    DF  K +D   +  +G I+  W    +E  ++++NFG+QFP+DL V +KA+ + A F IDF++FE
Sbjct:   78 WMPAPQPPLNCPPGLEYLSQIDQILIHQQIELLEVLTGFETNNKYEIKNSFGQRVYFAAEDTDCCTRNCCGPSRPFTLRIIDNMGQEVITLERPLRCSSCCCPCCLQEIEIQAPPGVP-----IGYVIQTWHPCLPKFTIQNEKREDVLKISGPCVVCSCCGD-VDFEIKSLDE--QCVVGKISKHWTGILREAFTDADNFGIQFPLDLDVKMKAVMIGACFLIDFMFFE 299          
BLAST of Phospholipid scramblase vs. Ensembl Human
Match: PLSCR1 (phospholipid scramblase 1 [Source:HGNC Symbol;Acc:HGNC:9092])

HSP 1 Score: 117.857 bits (294), Expect = 3.782e-30
Identity = 74/230 (32.17%), Postives = 119/230 (51.74%), Query Frame = 3
Query:  108 WMTKAVVK-NCIPGLEYLTQLDSVLVKRMMNWIEILRKIDPKNKYIVKNMIGQSVYYAIEDSNQCLRWCCGTKRPSNIFVYDKSDSVVLKIEHPXXXXXXXXXXXXXXXXXXXXXXTTGSDQVLGYIQEINNCGFIVYFILDENSKLLLILKGPHYCHGCCSSRSDFSFKIMDNTGKVEIGAITNSWRCWTQEWLSNSENFGVQFPIDXXXXXXXXXXXXTFFIDFLYFE 794
            WM       NC PGLEYL+Q+D +L+ + +  +E+L   +  NKY +KN  GQ VY+A ED++ C R CCG  RP  + + D     V+ +E P + +     C   +               +GY+ +  +     + I +E  + +L + GP     CC    DF  K +D   +  +G I+  W    +E  ++++NFG+QFP+DL V +KA+ + A F IDF++FE
Sbjct:   85 WMPAPQPPLNCPPGLEYLSQIDQILIHQQIELLEVLTGFETNNKYEIKNSFGQRVYFAAEDTDCCTRNCCGPSRPFTLRIIDNMGQEVITLERPLRCSSCCCPCCLQEIEIQAPPGVP-----IGYVIQTWHPCLPKFTIQNEKREDVLKISGPCVVCSCCGD-VDFEIKSLDE--QCVVGKISKHWTGILREAFTDADNFGIQFPLDLDVKMKAVMIGACFLIDFMFFE 306          
BLAST of Phospholipid scramblase vs. Ensembl Human
Match: PLSCR2 (phospholipid scramblase 2 [Source:HGNC Symbol;Acc:HGNC:16494])

HSP 1 Score: 103.219 bits (256), Expect = 1.532e-25
Identity = 69/219 (31.51%), Postives = 118/219 (53.88%), Query Frame = 3
Query:  144 GLEYLTQLDSVLVKRMMNWIEILRKIDPKNKYIVKNMIGQSVYYAIEDSNQCLRWCCGTKRPSNIFVYDKSDSVVLKIEHPXXXXXXXXXXXXXXXXXXXXXXTTGSDQVLGYIQEINNCGFIVYFILDENSKLLLILKGPHYCHGC-CSSRSDFSFKIMDNTGKVEIGAITNSWRCWTQEWLSNSENFGVQFPIDXXXXXXXXXXXXTFFIDFLYFER 797
            GLEYL+Q+D +L+ + +  +E+L   +  N Y +KN  GQ +Y+A ED+N C+R CCG  RP  + + D     V+ +E P + NC    C   +               +GY+ +  +     + I ++  + +L + GP  C  C C +  DF    +D   ++ +G I+  W  + +E  ++++NFG+QFP DL V +KA+ + A F ID+++FER
Sbjct:   13 GLEYLSQIDMILIHQQIELLEVLFSFESSNMYEIKNSFGQRIYFAAEDTNFCIRNCCGRSRPFTLRITDNVGREVITLERPLRCNCCCCPCCLQEIEIQAPPGVP-----VGYVTQTWHPCLTKFTIKNQKREDVLKISGP--CIVCSCIAGVDFEITSLDE--QIVVGRISKHWSGFLREAFTDADNFGIQFPRDLDVKMKAVMIGACFLIDYMFFER 222          
BLAST of Phospholipid scramblase vs. Ensembl Human
Match: PLSCR2 (phospholipid scramblase 2 [Source:HGNC Symbol;Acc:HGNC:16494])

HSP 1 Score: 103.219 bits (256), Expect = 1.532e-25
Identity = 69/219 (31.51%), Postives = 118/219 (53.88%), Query Frame = 3
Query:  144 GLEYLTQLDSVLVKRMMNWIEILRKIDPKNKYIVKNMIGQSVYYAIEDSNQCLRWCCGTKRPSNIFVYDKSDSVVLKIEHPXXXXXXXXXXXXXXXXXXXXXXTTGSDQVLGYIQEINNCGFIVYFILDENSKLLLILKGPHYCHGC-CSSRSDFSFKIMDNTGKVEIGAITNSWRCWTQEWLSNSENFGVQFPIDXXXXXXXXXXXXTFFIDFLYFER 797
            GLEYL+Q+D +L+ + +  +E+L   +  N Y +KN  GQ +Y+A ED+N C+R CCG  RP  + + D     V+ +E P + NC    C   +               +GY+ +  +     + I ++  + +L + GP  C  C C +  DF    +D   ++ +G I+  W  + +E  ++++NFG+QFP DL V +KA+ + A F ID+++FER
Sbjct:   13 GLEYLSQIDMILIHQQIELLEVLFSFESSNMYEIKNSFGQRIYFAAEDTNFCIRNCCGRSRPFTLRITDNVGREVITLERPLRCNCCCCPCCLQEIEIQAPPGVP-----VGYVTQTWHPCLTKFTIKNQKREDVLKISGP--CIVCSCIAGVDFEITSLDE--QIVVGRISKHWSGFLREAFTDADNFGIQFPRDLDVKMKAVMIGACFLIDYMFFER 222          
BLAST of Phospholipid scramblase vs. Ensembl Human
Match: PLSCR2 (phospholipid scramblase 2 [Source:HGNC Symbol;Acc:HGNC:16494])

HSP 1 Score: 103.99 bits (258), Expect = 3.120e-25
Identity = 69/219 (31.51%), Postives = 118/219 (53.88%), Query Frame = 3
Query:  144 GLEYLTQLDSVLVKRMMNWIEILRKIDPKNKYIVKNMIGQSVYYAIEDSNQCLRWCCGTKRPSNIFVYDKSDSVVLKIEHPXXXXXXXXXXXXXXXXXXXXXXTTGSDQVLGYIQEINNCGFIVYFILDENSKLLLILKGPHYCHGC-CSSRSDFSFKIMDNTGKVEIGAITNSWRCWTQEWLSNSENFGVQFPIDXXXXXXXXXXXXTFFIDFLYFER 797
            GLEYL+Q+D +L+ + +  +E+L   +  N Y +KN  GQ +Y+A ED+N C+R CCG  RP  + + D     V+ +E P + NC    C   +               +GY+ +  +     + I ++  + +L + GP  C  C C +  DF    +D   ++ +G I+  W  + +E  ++++NFG+QFP DL V +KA+ + A F ID+++FER
Sbjct:   82 GLEYLSQIDMILIHQQIELLEVLFSFESSNMYEIKNSFGQRIYFAAEDTNFCIRNCCGRSRPFTLRITDNVGREVITLERPLRCNCCCCPCCLQEIEIQAPPGVP-----VGYVTQTWHPCLTKFTIKNQKREDVLKISGP--CIVCSCIAGVDFEITSLDE--QIVVGRISKHWSGFLREAFTDADNFGIQFPRDLDVKMKAVMIGACFLIDYMFFER 291          
BLAST of Phospholipid scramblase vs. Ensembl Celegans
Match: scrm-2 (Phospholipid scramblase [Source:UniProtKB/TrEMBL;Acc:G5EEQ3])

HSP 1 Score: 118.242 bits (295), Expect = 2.967e-31
Identity = 85/257 (33.07%), Postives = 127/257 (49.42%), Query Frame = 3
Query:   39 FVNTVSKTMKRPPVIEICRDKGE-WMTKAVVKNCIP-GLEYLTQLDSVLVKRMMNWIEILRKIDPKNKYIVKNMIGQSVYYAIEDSNQCLRWCCGTKRPSNIFVYDKSDSVVLKIEHPXXXXXXXXXXXXXXXXXXXXXXTTGSDQVLGYIQEINNCGFIVYFILDENSKLLLILKGPHYCHGCCSSRSDFSFKIMDNTGKVEIGAITNSWRCWTQEWLSNSENFGVQFPIDXXXXXXXXXXXXTFFIDFLYFERIN 803
            +V    + +   P   I    G  WM        IP GLEYL  LD+V+V ++   +EIL   + KNKY ++N  GQ  YYA E+SN   R CCG++R   + + D  +  VL ++   +    +               +  S  +LG + +   C    Y ILD++  L+ ++ G   C  CC    DF+ K  D++  V IG+IT  W    +E  ++++ F V FPIDL V +KA+ L ATF IDF+ FE  N
Sbjct:   12 YVEIEDRAITTEPGASIQAAPGAIWMEALPAIEGIPAGLEYLAYLDTVMVHQVKEVLEILTGWESKNKYAIRNKNGQQCYYAFEESNAWERQCCGSQRGFTMHIVDNFNKNVLIVKRELRCCADSFCGCLLGLQNICTIESL-STGLLGTVLQGYGCTNSFYNILDKDGNLIFLVDGQGCCTSCCCEDKDFTIKTPDSS--VPIGSITKKWGGLLREAFTDADTFAVTFPIDLDVKLKAILLGATFLIDFVEFENNN 265          
BLAST of Phospholipid scramblase vs. Ensembl Celegans
Match: scrm-1 (Phospholipid scramblase [Source:UniProtKB/TrEMBL;Acc:Q7JKP1])

HSP 1 Score: 110.153 bits (274), Expect = 4.937e-28
Identity = 82/233 (35.19%), Postives = 122/233 (52.36%), Query Frame = 3
Query:  108 WMTKAVVKNCIP-GLEYLTQLDSVLVKRMMNWIEILRKIDPKNKYIVKNMIGQSVYYAIEDSNQCLRWCCGTKRPSNIFVYD--KSDSVVLKIEHPXXXXXXXXXXXXXXXXXXXXXXTTGSDQVLGYIQEINNCGFIVYFILDENSKLLLILKGPHYCHGCCSSRSDFSFKIMDNTGKVEIGAITNSWRCWTQEWLSNSENFGVQFPIDXXXXXXXXXXXXTFFIDFLYFER 797
            WM        +P GLEYLT LD+++V ++   IEI+   + KNKY++KN  G+  YYA E+S  C R CCG +R   + + D  K + + +K E             C  CC+ +  I T S  VLG I++   C    Y I+D +  ++  + GP  C  C     +F  K  +N G V +GAIT  W    +E  ++++ F V FP DL V +K + + ATF IDF+ FE+
Sbjct:   50 WMPMPPAIQGVPTGLEYLTYLDTIMVHQIKELIEIVTDWETKNKYVLKNANGEQCYYAFEESGCCERQCCGPQRGFVMHIVDNFKREVLTIKREFKCCGGGCCGCLACIGCCQQECIIETPSMGVLGIIRQRCGCMSSNYDIMDGDGNVIFQIDGPCCCMLCGCQDKEFPIKTANN-GTV-VGAITKKWGGCFREAFTDADTFAVNFPGDLDVKLKGVLIGATFLIDFMEFEQ 280          
BLAST of Phospholipid scramblase vs. Ensembl Celegans
Match: scrm-1 (Phospholipid scramblase [Source:UniProtKB/TrEMBL;Acc:Q7JKP1])

HSP 1 Score: 110.153 bits (274), Expect = 5.150e-28
Identity = 82/233 (35.19%), Postives = 122/233 (52.36%), Query Frame = 3
Query:  108 WMTKAVVKNCIP-GLEYLTQLDSVLVKRMMNWIEILRKIDPKNKYIVKNMIGQSVYYAIEDSNQCLRWCCGTKRPSNIFVYD--KSDSVVLKIEHPXXXXXXXXXXXXXXXXXXXXXXTTGSDQVLGYIQEINNCGFIVYFILDENSKLLLILKGPHYCHGCCSSRSDFSFKIMDNTGKVEIGAITNSWRCWTQEWLSNSENFGVQFPIDXXXXXXXXXXXXTFFIDFLYFER 797
            WM        +P GLEYLT LD+++V ++   IEI+   + KNKY++KN  G+  YYA E+S  C R CCG +R   + + D  K + + +K E             C  CC+ +  I T S  VLG I++   C    Y I+D +  ++  + GP  C  C     +F  K  +N G V +GAIT  W    +E  ++++ F V FP DL V +K + + ATF IDF+ FE+
Sbjct:   50 WMPMPPAIQGVPTGLEYLTYLDTIMVHQIKELIEIVTDWETKNKYVLKNANGEQCYYAFEESGCCERQCCGPQRGFVMHIVDNFKREVLTIKREFKCCGGGCCGCLACIGCCQQECIIETPSMGVLGIIRQRCGCMSSNYDIMDGDGNVIFQIDGPCCCMLCGCQDKEFPIKTANN-GTV-VGAITKKWGGCFREAFTDADTFAVNFPGDLDVKLKGVLIGATFLIDFMEFEQ 280          
BLAST of Phospholipid scramblase vs. Ensembl Celegans
Match: scrm-1 (Phospholipid scramblase [Source:UniProtKB/TrEMBL;Acc:Q7JKP1])

HSP 1 Score: 110.153 bits (274), Expect = 5.150e-28
Identity = 82/233 (35.19%), Postives = 122/233 (52.36%), Query Frame = 3
Query:  108 WMTKAVVKNCIP-GLEYLTQLDSVLVKRMMNWIEILRKIDPKNKYIVKNMIGQSVYYAIEDSNQCLRWCCGTKRPSNIFVYD--KSDSVVLKIEHPXXXXXXXXXXXXXXXXXXXXXXTTGSDQVLGYIQEINNCGFIVYFILDENSKLLLILKGPHYCHGCCSSRSDFSFKIMDNTGKVEIGAITNSWRCWTQEWLSNSENFGVQFPIDXXXXXXXXXXXXTFFIDFLYFER 797
            WM        +P GLEYLT LD+++V ++   IEI+   + KNKY++KN  G+  YYA E+S  C R CCG +R   + + D  K + + +K E             C  CC+ +  I T S  VLG I++   C    Y I+D +  ++  + GP  C  C     +F  K  +N G V +GAIT  W    +E  ++++ F V FP DL V +K + + ATF IDF+ FE+
Sbjct:   50 WMPMPPAIQGVPTGLEYLTYLDTIMVHQIKELIEIVTDWETKNKYVLKNANGEQCYYAFEESGCCERQCCGPQRGFVMHIVDNFKREVLTIKREFKCCGGGCCGCLACIGCCQQECIIETPSMGVLGIIRQRCGCMSSNYDIMDGDGNVIFQIDGPCCCMLCGCQDKEFPIKTANN-GTV-VGAITKKWGGCFREAFTDADTFAVNFPGDLDVKLKGVLIGATFLIDFMEFEQ 280          
BLAST of Phospholipid scramblase vs. Ensembl Celegans
Match: scrm-1 (Phospholipid scramblase [Source:UniProtKB/TrEMBL;Acc:Q7JKP1])

HSP 1 Score: 110.153 bits (274), Expect = 6.091e-28
Identity = 82/233 (35.19%), Postives = 122/233 (52.36%), Query Frame = 3
Query:  108 WMTKAVVKNCIP-GLEYLTQLDSVLVKRMMNWIEILRKIDPKNKYIVKNMIGQSVYYAIEDSNQCLRWCCGTKRPSNIFVYD--KSDSVVLKIEHPXXXXXXXXXXXXXXXXXXXXXXTTGSDQVLGYIQEINNCGFIVYFILDENSKLLLILKGPHYCHGCCSSRSDFSFKIMDNTGKVEIGAITNSWRCWTQEWLSNSENFGVQFPIDXXXXXXXXXXXXTFFIDFLYFER 797
            WM        +P GLEYLT LD+++V ++   IEI+   + KNKY++KN  G+  YYA E+S  C R CCG +R   + + D  K + + +K E             C  CC+ +  I T S  VLG I++   C    Y I+D +  ++  + GP  C  C     +F  K  +N G V +GAIT  W    +E  ++++ F V FP DL V +K + + ATF IDF+ FE+
Sbjct:   50 WMPMPPAIQGVPTGLEYLTYLDTIMVHQIKELIEIVTDWETKNKYVLKNANGEQCYYAFEESGCCERQCCGPQRGFVMHIVDNFKREVLTIKREFKCCGGGCCGCLACIGCCQQECIIETPSMGVLGIIRQRCGCMSSNYDIMDGDGNVIFQIDGPCCCMLCGCQDKEFPIKTANN-GTV-VGAITKKWGGCFREAFTDADTFAVNFPGDLDVKLKGVLIGATFLIDFMEFEQ 280          
BLAST of Phospholipid scramblase vs. Ensembl Fly
Match: scramb1 (gene:FBgn0052056 transcript:FBtr0076302)

HSP 1 Score: 108.612 bits (270), Expect = 9.255e-28
Identity = 73/224 (32.59%), Postives = 121/224 (54.02%), Query Frame = 3
Query:  126 VKNCIPGLEYLTQLDSVLVKRMMNWIEILRKIDPKNKYIVKNMIGQSVYYAIEDSNQCLRWCCGTKRPSNIFVYDKSDSVVLKIEHPXXXXXXXXXXXXXXXXXXXXXXTTGSDQVLGYIQEINNCGFIVYFILDENSKLLLILKGPHYCHGCCSSRSDFSFKIMDNTGKVEIGAITNSWRCWTQEWLSNSENFGVQFPIDXXXXXXXXXXXXTFFIDFLYFER 797
            + NC  GLEYLT +D +LVK+ +  +E     +  NK+ +KN +GQ VY+A ED++ C R CCG  RP ++ V+D     V+ +  P        S     CC   I+++     V+G I++  +     + IL+     ++ ++GP      C    D  F ++  TG+ +IG I+  W    +E  ++++ FG+ FP+DL V +KA+ L ATF ID ++FE+
Sbjct:    7 IPNCPRGLEYLTTIDQLLVKQKVELLEAFTGFETNNKFTIKNALGQKVYFAAEDNDCCTRNCCGPARPFDMRVFDNFQQEVIHMHRP-----LACSSCLFPCCLQSIEVSAPPGNVIGTIEQEWSICSPSFRILNHVGDTVMRIEGPFCTFSLC---GDVEFNVVSLTGE-KIGKISKQWSGLAREIFTDADFFGINFPLDLDVRMKAVLLGATFLIDAMFFEK 221          
BLAST of Phospholipid scramblase vs. Ensembl Fly
Match: scramb1 (gene:FBgn0052056 transcript:FBtr0076303)

HSP 1 Score: 108.227 bits (269), Expect = 8.478e-27
Identity = 73/224 (32.59%), Postives = 121/224 (54.02%), Query Frame = 3
Query:  126 VKNCIPGLEYLTQLDSVLVKRMMNWIEILRKIDPKNKYIVKNMIGQSVYYAIEDSNQCLRWCCGTKRPSNIFVYDKSDSVVLKIEHPXXXXXXXXXXXXXXXXXXXXXXTTGSDQVLGYIQEINNCGFIVYFILDENSKLLLILKGPHYCHGCCSSRSDFSFKIMDNTGKVEIGAITNSWRCWTQEWLSNSENFGVQFPIDXXXXXXXXXXXXTFFIDFLYFER 797
            + NC  GLEYLT +D +LVK+ +  +E     +  NK+ +KN +GQ VY+A ED++ C R CCG  RP ++ V+D     V+ +  P        S     CC   I+++     V+G I++  +     + IL+     ++ ++GP      C    D  F ++  TG+ +IG I+  W    +E  ++++ FG+ FP+DL V +KA+ L ATF ID ++FE+
Sbjct:  106 IPNCPRGLEYLTTIDQLLVKQKVELLEAFTGFETNNKFTIKNALGQKVYFAAEDNDCCTRNCCGPARPFDMRVFDNFQQEVIHMHRP-----LACSSCLFPCCLQSIEVSAPPGNVIGTIEQEWSICSPSFRILNHVGDTVMRIEGPFCTFSLC---GDVEFNVVSLTGE-KIGKISKQWSGLAREIFTDADFFGINFPLDLDVRMKAVLLGATFLIDAMFFEK 320          
BLAST of Phospholipid scramblase vs. Ensembl Fly
Match: scramb1 (gene:FBgn0052056 transcript:FBtr0076301)

HSP 1 Score: 106.686 bits (265), Expect = 7.485e-26
Identity = 76/236 (32.20%), Postives = 126/236 (53.39%), Query Frame = 3
Query:   99 KGEWMT-KAVVKNCIPGLEYLTQLDSVLVKRMMNWIEILRKIDPKNKYIVKNMIGQSVYYAIEDSNQCLRWCCGTKRPSNIFVYDKSDSVVLKIEHPXXXXXXXXXXXXXXXXXXXXXXTTGSDQVLGYIQEINNCGFIVYFILDENSKLLLILKGPHYCHGCCSSRSDFSFKIMDNTGKVEIGAITNSWRCWTQEWLSNSENFGVQFPIDXXXXXXXXXXXXTFFIDFLYFERIN 803
             G+WM+    + NC  GLEYLT +D +LVK+ +  +E     +  NK+ +KN +GQ VY+A ED++ C R CCG  RP ++ V+D     V+ +  P        S     CC   I+++     V+G I++  +     + IL+     ++ ++GP      C    D  F ++  TG+ +IG I+  W    +E  ++++ FG+ FP+DL V +KA+ L ATF ID ++FE+  
Sbjct:  180 AGDWMSIPTGIPNCPRGLEYLTTIDQLLVKQKVELLEAFTGFETNNKFTIKNALGQKVYFAAEDNDCCTRNCCGPARPFDMRVFDNFQQEVIHMHRP-----LACSSCLFPCCLQSIEVSAPPGNVIGTIEQEWSICSPSFRILNHVGDTVMRIEGPFCTFSLC---GDVEFNVVSLTGE-KIGKISKQWSGLAREIFTDADFFGINFPLDLDVRMKAVLLGATFLIDAMFFEKAG 406          
BLAST of Phospholipid scramblase vs. Ensembl Fly
Match: scramb2 (gene:FBgn0035390 transcript:FBtr0073005)

HSP 1 Score: 97.0561 bits (240), Expect = 3.297e-23
Identity = 78/233 (33.48%), Postives = 128/233 (54.94%), Query Frame = 3
Query:  108 WMTKAV-VKNCIPGLEYLTQLDSVLVKRMMNWIEILRKIDPKNKYIVKNMIGQSVYYAIEDSNQCLRWCCGTKRPSNIFVYDKSDSVVLKIEHPXXXXXXXXXXXXXXXXXXXXXXTTGSDQVLGYIQEINNCGFI--VYFILDENSKLLLILKGPHYCHGCCSSRSDFSFKIMDNTGKVEIGAITNSWRCWTQEWLSNSENFGVQFPIDXXXXXXXXXXXXTFFIDFLYFER 797
            WM+  V + NC  GLEYLT LD +LV + +  +E+L   + KN++ VKN +GQ+VY+A E+S+ C R   G  RP  + + D   + VL +  P           C   C N ++++    QV+G ++++  C F+   + I +     +L ++GP  C   C   SD +FK++    + EIG I+  W    +E  ++++ F V FP++L V +KAL  AA F ID +Y+E+
Sbjct:   41 WMSIPVGMPNCPQGLEYLTALDQLLVSQKIEKLELLTGFETKNRFKVKNSLGQNVYFAYEESDCCTRNMLGRSRPFEMKILDNFQNEVLHLYRP----FKCDILCCFPSCMNAVEVSAPPGQVIGSVEQV--CTFMRPKFNIKNTCGDTVLQIEGP-VCP--CKCFSDTNFKVLSANNE-EIGKISKQWSGLGRELFTDADYFSVTFPLNLDVRMKALIFAALFLIDAVYYEQ 263          
BLAST of Phospholipid scramblase vs. Ensembl Zebrafish
Match: si:ch73-206p6.1 (si:ch73-206p6.1 [Source:ZFIN;Acc:ZDB-GENE-030131-5048])

HSP 1 Score: 115.546 bits (288), Expect = 2.856e-30
Identity = 76/226 (33.63%), Postives = 121/226 (53.54%), Query Frame = 3
Query:  126 VKNCIPGLEYLTQLDSVLVKRMMNWIEILRKIDPKNKYIVKNMIGQSVYYAIEDSNQCLRWCCGTKRPSNIFVYDKSDSVVLKIEHPXXXXXXXXXXXXXXXXXXXXXXTTGSDQVLGYIQEINNCGFIVYFILDENSKLLLILKGPHYCHGCCSSRSDFSFKIMDNTGKVEIGAITNSWRCWTQEWLSNSENFGVQFPIDXXXXXXXXXXXXTFFIDFLYFERIN 803
            +  C PGLEYLTQ+D +L+K+ +  IE L   +  NKY ++N +GQ+V+YA+E+++   R CCG  R   I V D     ++ +  P +       C   +         T     +GY+ +  +     + I +E+ + +L L+GP +C   C    DF    MD   +V IG I+  W    +E  ++S+NFG+QFP+DL V +KA+ + A F IDF++FE  N
Sbjct:   14 IPGCPPGLEYLTQVDQLLIKQKVELIEALAGFESNNKYEIRNSLGQNVFYAVEENDCLTRQCCGPLRSFTIRVLDNFGQEIITVNRPLKCMSCFFPCCLQELEIQSPPGNT-----VGYVVQQWHPFLPKFTIENEHRQPVLKLQGP-FCGWSCLPDVDFEILTMD---EVSIGKISKQWTGLLREVFTDSDNFGIQFPMDLDVRMKAVMIGACFLIDFMFFETNN 230          
BLAST of Phospholipid scramblase vs. Ensembl Zebrafish
Match: plscr3b (phospholipid scramblase 3b [Source:ZFIN;Acc:ZDB-GENE-040426-2517])

HSP 1 Score: 111.309 bits (277), Expect = 6.493e-28
Identity = 71/229 (31.00%), Postives = 121/229 (52.84%), Query Frame = 3
Query:  120 AVVKNCIPGLEYLTQLDSVLVKRMMNWIEILRKIDPKNKYIVKNMIGQSVYYAIEDSNQCLRWCCGTKRPSNIFVYDKSDSVVLKIEHPXXXXXXXXXXXXXXXXXXXXXXTTGSDQVLGYIQEINNCGFIVYFILDENSKLLLILKGPHYCHGC-CSSRSDFSFKIMDNTGKVEIGAITNSWRCWTQEWLSNSENFGVQFPIDXXXXXXXXXXXXTFFIDFLYFERIN 803
            AV     PGLEYLTQ+D +L+ + +  +E     +  N+Y +KN +GQ +Y A E ++ C R CCG  R  ++ + D  D  V+++  P++       C   +        T      +GY+++  +  +  + I+  N + ++ L+GP  C  C C     F  K  D TGK  IG I+  W    +E  ++++NFG+QFP+D+ V +KA+ +   F IDF++FE++ 
Sbjct:   84 AVPAGVPPGLEYLTQIDQILIHQKVELLEAFIGFETNNQYEIKNSLGQKIYSAKEKNDCCTRNCCGALRSFDMKIKDNMDREVIRLIRPYRCVSCWCPCCLQEMEIQAPPGTP-----IGYVKQDWHPCYPKFSIMGPNKETVMKLEGP--CMACNCCGDVHFELKGKDGTGK-PIGRISKQWTGLLKEVFTDADNFGIQFPLDMDVKMKAVLMGTCFLIDFMFFEKVG 304          
BLAST of Phospholipid scramblase vs. Ensembl Zebrafish
Match: plscr3b (phospholipid scramblase 3b [Source:ZFIN;Acc:ZDB-GENE-040426-2517])

HSP 1 Score: 111.309 bits (277), Expect = 6.493e-28
Identity = 71/229 (31.00%), Postives = 121/229 (52.84%), Query Frame = 3
Query:  120 AVVKNCIPGLEYLTQLDSVLVKRMMNWIEILRKIDPKNKYIVKNMIGQSVYYAIEDSNQCLRWCCGTKRPSNIFVYDKSDSVVLKIEHPXXXXXXXXXXXXXXXXXXXXXXTTGSDQVLGYIQEINNCGFIVYFILDENSKLLLILKGPHYCHGC-CSSRSDFSFKIMDNTGKVEIGAITNSWRCWTQEWLSNSENFGVQFPIDXXXXXXXXXXXXTFFIDFLYFERIN 803
            AV     PGLEYLTQ+D +L+ + +  +E     +  N+Y +KN +GQ +Y A E ++ C R CCG  R  ++ + D  D  V+++  P++       C   +        T      +GY+++  +  +  + I+  N + ++ L+GP  C  C C     F  K  D TGK  IG I+  W    +E  ++++NFG+QFP+D+ V +KA+ +   F IDF++FE++ 
Sbjct:   84 AVPAGVPPGLEYLTQIDQILIHQKVELLEAFIGFETNNQYEIKNSLGQKIYSAKEKNDCCTRNCCGALRSFDMKIKDNMDREVIRLIRPYRCVSCWCPCCLQEMEIQAPPGTP-----IGYVKQDWHPCYPKFSIMGPNKETVMKLEGP--CMACNCCGDVHFELKGKDGTGK-PIGRISKQWTGLLKEVFTDADNFGIQFPLDMDVKMKAVLMGTCFLIDFMFFEKVG 304          
BLAST of Phospholipid scramblase vs. Ensembl Zebrafish
Match: si:ch211-71m22.5 (si:ch211-71m22.5 [Source:ZFIN;Acc:ZDB-GENE-130531-65])

HSP 1 Score: 105.531 bits (262), Expect = 1.923e-26
Identity = 72/222 (32.43%), Postives = 119/222 (53.60%), Query Frame = 3
Query:  132 NCIPGLEYLTQLDSVLVKRMMNWIEILRKIDPKNKYIVKNMIGQSVYYAIEDSNQCLRWCCGTKRPSNIFVYDKSDSVVLKIEHPXXXXXXXXXXXXXXXXXXXXXXTTGSDQVLGYIQEINNCGFIVYFILDENSKLLLILKGPHYCHGCCSSRSDFSFKIMDNTGKVEIGAITNSWRCWTQEWLSNSENFGVQFPIDXXXXXXXXXXXXTFFIDFLYFER 797
             C  GLEYLTQ+D +LV + +  +E+L   +  N+Y+VKN +GQ V++A E+S+ C R  CG+ R   + + D     V+ +  P + +     C   +   +     + S   LGY+ +  +     + I +E  + +L + GP     CC   SD +F++M       IG I+  W  +  E  ++++NFG+QFP+DL V +KA+ L A F IDF++FE 
Sbjct:   28 GCPVGLEYLTQVDQLLVHQKVELMEVLMGWETNNQYVVKNSLGQQVFFAAEESHFCSRMFCGSVRSFLLHIQDNMGQEVMTLSRPLKCSSCFFPCCLQELEVH-----SPSGSPLGYVTQSWHPYLPKFIIHNERKEPVLKILGPFCDCKCC---SDVNFEVMSLDESSVIGRISKQWSGFEAEAFTDADNFGLQFPMDLDVKIKAVILGACFLIDFMFFEH 241          
BLAST of Phospholipid scramblase vs. Ensembl Zebrafish
Match: si:ch211-71m22.5 (si:ch211-71m22.5 [Source:ZFIN;Acc:ZDB-GENE-130531-65])

HSP 1 Score: 104.76 bits (260), Expect = 6.753e-26
Identity = 72/222 (32.43%), Postives = 119/222 (53.60%), Query Frame = 3
Query:  132 NCIPGLEYLTQLDSVLVKRMMNWIEILRKIDPKNKYIVKNMIGQSVYYAIEDSNQCLRWCCGTKRPSNIFVYDKSDSVVLKIEHPXXXXXXXXXXXXXXXXXXXXXXTTGSDQVLGYIQEINNCGFIVYFILDENSKLLLILKGPHYCHGCCSSRSDFSFKIMDNTGKVEIGAITNSWRCWTQEWLSNSENFGVQFPIDXXXXXXXXXXXXTFFIDFLYFER 797
             C  GLEYLTQ+D +LV + +  +E+L   +  N+Y+VKN +GQ V++A E+S+ C R  CG+ R   + + D     V+ +  P + +     C   +   +     + S   LGY+ +  +     + I +E  + +L + GP     CC   SD +F++M       IG I+  W  +  E  ++++NFG+QFP+DL V +KA+ L A F IDF++FE 
Sbjct:   59 GCPVGLEYLTQVDQLLVHQKVELMEVLMGWETNNQYVVKNSLGQQVFFAAEESHFCSRMFCGSVRSFLLHIQDNMGQEVMTLSRPLKCSSCFFPCCLQELEVH-----SPSGSPLGYVTQSWHPYLPKFIIHNERKEPVLKILGPFCDCKCC---SDVNFEVMSLDESSVIGRISKQWSGFEAEAFTDADNFGLQFPMDLDVKIKAVILGACFLIDFMFFEH 272          
BLAST of Phospholipid scramblase vs. Ensembl Xenopus
Match: insyn1 (inhibitory synaptic factor 1 [Source:Xenbase;Acc:XB-GENE-5931898])

HSP 1 Score: 128.642 bits (322), Expect = 3.059e-34
Identity = 85/224 (37.95%), Postives = 127/224 (56.70%), Query Frame = 3
Query:  132 NCIPGLEYLTQLDSVLVKRMMNWIEILRKIDPKNKYIVKNMIGQSVYYAIEDSNQCLRWCCGTKRPSNIFVYDKSDSVVLKIEHPXXXXXXXXXXXXXXXXXXXXXXTTGSDQVLGY-IQEINNCGFIVYFILDENSKLLLILKGPHYCHGC-CSSRSDFSFKIMDNTGKVEIGAITNSWRCWTQEWLSNSENFGVQFPIDXXXXXXXXXXXXTFFIDFLYFER 797
            NC PGLEYLTQ+D +LV + +  +E+L   +  NKY +KN +GQ VY+A E+++ C R CCG  RP ++ + D +   V+K+  P + +     C   K        TT     +GY IQ  + C    + I DE  + +L +KGP  C  C C +   F  K MD +  V  G IT  W  + +E  ++++NFG+QFP+DL V +KA+ L A F IDF++FE+
Sbjct:  106 NCPPGLEYLTQIDQILVHQQVELLEVLTGFETNNKYEIKNSLGQRVYFAAEENDCCTRNCCGPSRPFSMTIVDNAGQEVMKLHRPCRCSACCFPCCLQKLEVQAPPGTT-----VGYVIQNWHPC-LPKFTIQDEREQGILKIKGP--CIPCRCCADVKFEIKSMDESAVV--GRITKQWTGFVKEAFTDADNFGIQFPMDLDVKIKAVLLGACFLIDFMFFEQ 319          
BLAST of Phospholipid scramblase vs. Ensembl Xenopus
Match: insyn1 (inhibitory synaptic factor 1 [Source:Xenbase;Acc:XB-GENE-5931898])

HSP 1 Score: 128.642 bits (322), Expect = 3.062e-34
Identity = 85/224 (37.95%), Postives = 127/224 (56.70%), Query Frame = 3
Query:  132 NCIPGLEYLTQLDSVLVKRMMNWIEILRKIDPKNKYIVKNMIGQSVYYAIEDSNQCLRWCCGTKRPSNIFVYDKSDSVVLKIEHPXXXXXXXXXXXXXXXXXXXXXXTTGSDQVLGY-IQEINNCGFIVYFILDENSKLLLILKGPHYCHGC-CSSRSDFSFKIMDNTGKVEIGAITNSWRCWTQEWLSNSENFGVQFPIDXXXXXXXXXXXXTFFIDFLYFER 797
            NC PGLEYLTQ+D +LV + +  +E+L   +  NKY +KN +GQ VY+A E+++ C R CCG  RP ++ + D +   V+K+  P + +     C   K        TT     +GY IQ  + C    + I DE  + +L +KGP  C  C C +   F  K MD +  V  G IT  W  + +E  ++++NFG+QFP+DL V +KA+ L A F IDF++FE+
Sbjct:  101 NCPPGLEYLTQIDQILVHQQVELLEVLTGFETNNKYEIKNSLGQRVYFAAEENDCCTRNCCGPSRPFSMTIVDNAGQEVMKLHRPCRCSACCFPCCLQKLEVQAPPGTT-----VGYVIQNWHPC-LPKFTIQDEREQGILKIKGP--CIPCRCCADVKFEIKSMDESAVV--GRITKQWTGFVKEAFTDADNFGIQFPMDLDVKIKAVLLGACFLIDFMFFEQ 314          
BLAST of Phospholipid scramblase vs. Ensembl Xenopus
Match: ENSXETT00000012543.1 (phospholipid scramblase 2 [Source:NCBI gene;Acc:100489273])

HSP 1 Score: 109.768 bits (273), Expect = 1.661e-27
Identity = 74/231 (32.03%), Postives = 119/231 (51.52%), Query Frame = 3
Query:  102 GEWMT-KAVVKNCIPGLEYLTQLDSVLVKRMMNWIEILRKIDPKNKYIVKNMIGQSVYYAIEDSNQCLRWCCGTKRPSNIFVYDKSDSVVLKIEHPXXXXXXXXXXXXXXXXXXXXXXTTGSDQVLGYIQEINNCGFIVYFILDENSKLLLILKGPHYCHGCCSSRSDFSFKIMDNTGKVEIGAITNSWRCWTQEWLSNSENFGVQFPIDXXXXXXXXXXXXTFFIDFLYF 791
              WM   A   NC PGLEYL+Q+D +LV + +  +E+L   +  NKY +KN +GQ VY+A E+++ C R  CG  RP  + + D +   V+K+  P + +     C   K        T     V+GY+ +  +     + I DE  + +L + GP     CC   +D +F++M       +G I+  W    +E  ++++NFG+QFP+DL +  KA+ L A F I   +F
Sbjct:   55 AAWMPIPAANPNCPPGLEYLSQIDQILVHQQVELLEVLTGFETNNKYEIKNSLGQRVYFAAEENDCCTRNYCGPSRPFAMTIVDNTGREVMKLHRPLRCSACCFPCCLQKLEVQAPPGT-----VVGYVVQNWHPCLPKFTIQDEREQGVLKISGPCIPCRCC---TDVNFEVMSVDESSVVGRISKQWAGSVKEIFTDTDNFGIQFPMDLDIKTKAVLLGACFLIVSSFF 277          
BLAST of Phospholipid scramblase vs. Ensembl Xenopus
Match: kpna6 (karyopherin alpha 6 (importin alpha 7) [Source:Xenbase;Acc:XB-GENE-946491])

HSP 1 Score: 54.6842 bits (130), Expect = 3.755e-8
Identity = 41/169 (24.26%), Postives = 75/169 (44.38%), Query Frame = 3
Query:  222 DPKNKYIVKNMIGQSVYYAIEDSNQCLRWCCGTKRPSNIFVYDKSDSVVLKIEHPXXXXXXXXXXXXXXXXXXXXXXTTGSDQVLGYIQEINNCGFIVYFILDENSKLLLILKGPHYCHGCCSSRSDFSFKIMDNTGKVEIGAITNSWRCWTQEWLSNSENFGVQFPID 728
            +  NKY +K+  GQ  Y+A E++    +  CG  RP  + + +     V+ I  P +       C   +        TT      G+I +  +     + I +E+ + +LI+ GP+    C     D  F++     +  IG I   W  +  +  +N++NFG++FP+D
Sbjct:   24 EKSNKYEIKDNFGQRFYFATEENEYFNKNFCGPVRPFTMRISNSRGQEVITIIRPLRCIHCCFPCYLQELEVQAPLGTTA-----GFIVQKWDPLLPKFIIQNESKEDVLIVIGPYLTSSC---FGDVIFEVKTLNEESTIGKICKYWSGFVNDVFTNADNFGIEFPVD 184          
BLAST of Phospholipid scramblase vs. Ensembl Xenopus
Match: kpna6 (karyopherin alpha 6 (importin alpha 7) [Source:Xenbase;Acc:XB-GENE-946491])

HSP 1 Score: 54.299 bits (129), Expect = 5.483e-8
Identity = 41/169 (24.26%), Postives = 75/169 (44.38%), Query Frame = 3
Query:  222 DPKNKYIVKNMIGQSVYYAIEDSNQCLRWCCGTKRPSNIFVYDKSDSVVLKIEHPXXXXXXXXXXXXXXXXXXXXXXTTGSDQVLGYIQEINNCGFIVYFILDENSKLLLILKGPHYCHGCCSSRSDFSFKIMDNTGKVEIGAITNSWRCWTQEWLSNSENFGVQFPID 728
            +  NKY +K+  GQ  Y+A E++    +  CG  RP  + + +     V+ I  P +       C   +        TT      G+I +  +     + I +E+ + +LI+ GP+    C     D  F++     +  IG I   W  +  +  +N++NFG++FP+D
Sbjct:   36 EKSNKYEIKDNFGQRFYFATEENEYFNKNFCGPVRPFTMRISNSRGQEVITIIRPLRCIHCCFPCYLQEVKVQAPLGTTA-----GFIVQKWDPLLPKFIIQNESKEDVLIVIGPYLTSSCFG---DVIFEVKTLNEESTIGKICKYWSGFVNDVFTNADNFGIEFPVD 196          
BLAST of Phospholipid scramblase vs. Ensembl Mouse
Match: Plscr1 (phospholipid scramblase 1 [Source:MGI Symbol;Acc:MGI:893575])

HSP 1 Score: 117.087 bits (292), Expect = 6.245e-30
Identity = 73/218 (33.49%), Postives = 117/218 (53.67%), Query Frame = 3
Query:  144 GLEYLTQLDSVLVKRMMNWIEILRKIDPKNKYIVKNMIGQSVYYAIEDSNQCLRWCCGTKRPSNIFVYDKSDSVVLKIEHPXXXXXXXXXXXXXXXXXXXXXXTTGSDQVLGYIQEINNCGFIVYFILDENSKLLLILKGPHYCHGCCSSRSDFSFKIMDNTGKVEIGAITNSWRCWTQEWLSNSENFGVQFPIDXXXXXXXXXXXXTFFIDFLYFER 797
            GLEYL Q+D +LV + +  +E+L   +  NKY +KN +GQ VY+A+ED++ C R CCG  RP  + + D     V+ +E P + +     C   +               +GY+ +  +     + + +E  + +L + GP     CCS   DF  K +D    V  G I+  W  + +E  ++++NFG+QFP+DL V +KA+ L A F IDF++FER
Sbjct:  107 GLEYLAQIDQLLVHQQIELLEVLTGFETNNKYEIKNSLGQRVYFAVEDTDCCTRNCCGASRPFTLRILDNLGREVMTLERPLRCSSCCFPCCLQEIEIQAPPGVP-----VGYVTQTWHPCLPKFTLQNEKKQDVLKVVGPCVVCSCCSD-IDFELKSLDEESVV--GKISKQWSGFVREAFTDADNFGIQFPLDLDVKMKAVMLGACFLIDFMFFER 316          
BLAST of Phospholipid scramblase vs. Ensembl Mouse
Match: Plscr1 (phospholipid scramblase 1 [Source:MGI Symbol;Acc:MGI:893575])

HSP 1 Score: 117.087 bits (292), Expect = 6.245e-30
Identity = 73/218 (33.49%), Postives = 117/218 (53.67%), Query Frame = 3
Query:  144 GLEYLTQLDSVLVKRMMNWIEILRKIDPKNKYIVKNMIGQSVYYAIEDSNQCLRWCCGTKRPSNIFVYDKSDSVVLKIEHPXXXXXXXXXXXXXXXXXXXXXXTTGSDQVLGYIQEINNCGFIVYFILDENSKLLLILKGPHYCHGCCSSRSDFSFKIMDNTGKVEIGAITNSWRCWTQEWLSNSENFGVQFPIDXXXXXXXXXXXXTFFIDFLYFER 797
            GLEYL Q+D +LV + +  +E+L   +  NKY +KN +GQ VY+A+ED++ C R CCG  RP  + + D     V+ +E P + +     C   +               +GY+ +  +     + + +E  + +L + GP     CCS   DF  K +D    V  G I+  W  + +E  ++++NFG+QFP+DL V +KA+ L A F IDF++FER
Sbjct:  107 GLEYLAQIDQLLVHQQIELLEVLTGFETNNKYEIKNSLGQRVYFAVEDTDCCTRNCCGASRPFTLRILDNLGREVMTLERPLRCSSCCFPCCLQEIEIQAPPGVP-----VGYVTQTWHPCLPKFTLQNEKKQDVLKVVGPCVVCSCCSD-IDFELKSLDEESVV--GKISKQWSGFVREAFTDADNFGIQFPLDLDVKMKAVMLGACFLIDFMFFER 316          
BLAST of Phospholipid scramblase vs. Ensembl Mouse
Match: Plscr2 (phospholipid scramblase 2 [Source:MGI Symbol;Acc:MGI:1270860])

HSP 1 Score: 114.775 bits (286), Expect = 2.986e-29
Identity = 74/231 (32.03%), Postives = 120/231 (51.95%), Query Frame = 3
Query:  105 EWM-TKAVVKNCIPGLEYLTQLDSVLVKRMMNWIEILRKIDPKNKYIVKNMIGQSVYYAIEDSNQCLRWCCGTKRPSNIFVYDKSDSVVLKIEHPXXXXXXXXXXXXXXXXXXXXXXTTGSDQVLGYIQEINNCGFIVYFILDENSKLLLILKGPHYCHGCCSSRSDFSFKIMDNTGKVEIGAITNSWRCWTQEWLSNSENFGVQFPIDXXXXXXXXXXXXTFFIDFLYFE 794
            +WM     + NC PGLEYL Q+D +L+ + +  +E+L   +  NK+ +KN +GQ VY A+ED++ C R CC   RP  + + D     V+ +E P + +     C   +               +GY+ +  +       + ++  + +L + GP     CCS   DF  K +D   +  IG IT  W    +E  ++S+NFG+QFP+DL V +KA+ L A F ID+++FE
Sbjct:   82 QWMPAPPPILNCPPGLEYLNQIDQLLIHQQVELLEVLTGFETNNKFEIKNSLGQMVYVAVEDTDCCTRNCCEASRPFTLRILDHLGQEVMTLERPLKCSSCCFPCCLQEIEIQAPPGVP-----IGYVTQTWHPCLPKLTLQNDKRENVLKVVGPCVACTCCSD-IDFEIKSLDEVTR--IGKITKQWSGCVKEAFTDSDNFGIQFPLDLEVKMKAVTLGACFLIDYMFFE 304          
BLAST of Phospholipid scramblase vs. Ensembl Mouse
Match: Plscr2 (phospholipid scramblase 2 [Source:MGI Symbol;Acc:MGI:1270860])

HSP 1 Score: 114.775 bits (286), Expect = 2.986e-29
Identity = 74/231 (32.03%), Postives = 120/231 (51.95%), Query Frame = 3
Query:  105 EWM-TKAVVKNCIPGLEYLTQLDSVLVKRMMNWIEILRKIDPKNKYIVKNMIGQSVYYAIEDSNQCLRWCCGTKRPSNIFVYDKSDSVVLKIEHPXXXXXXXXXXXXXXXXXXXXXXTTGSDQVLGYIQEINNCGFIVYFILDENSKLLLILKGPHYCHGCCSSRSDFSFKIMDNTGKVEIGAITNSWRCWTQEWLSNSENFGVQFPIDXXXXXXXXXXXXTFFIDFLYFE 794
            +WM     + NC PGLEYL Q+D +L+ + +  +E+L   +  NK+ +KN +GQ VY A+ED++ C R CC   RP  + + D     V+ +E P + +     C   +               +GY+ +  +       + ++  + +L + GP     CCS   DF  K +D   +  IG IT  W    +E  ++S+NFG+QFP+DL V +KA+ L A F ID+++FE
Sbjct:   82 QWMPAPPPILNCPPGLEYLNQIDQLLIHQQVELLEVLTGFETNNKFEIKNSLGQMVYVAVEDTDCCTRNCCEASRPFTLRILDHLGQEVMTLERPLKCSSCCFPCCLQEIEIQAPPGVP-----IGYVTQTWHPCLPKLTLQNDKRENVLKVVGPCVACTCCSD-IDFEIKSLDEVTR--IGKITKQWSGCVKEAFTDSDNFGIQFPLDLEVKMKAVTLGACFLIDYMFFE 304          
BLAST of Phospholipid scramblase vs. Ensembl Mouse
Match: Plscr3 (phospholipid scramblase 3 [Source:MGI Symbol;Acc:MGI:1917560])

HSP 1 Score: 103.99 bits (258), Expect = 2.148e-25
Identity = 71/219 (32.42%), Postives = 117/219 (53.42%), Query Frame = 3
Query:  141 PGLEYLTQLDSVLVKRMMNWIEILRKIDPKNKYIVKNMIGQSVYYAIEDSNQCLRWCCGTKRPSNIFVYDKSDSVVLKIEHPXXXXXXXXXXXXXXXXXXXXXXTTGSDQVLGYIQEINNCGFIVYFILDENSKLLLILKGPHYCHGCCSSRSDFSFKIMDNTGKVEIGAITNSWRCWTQEWLSNSENFGVQFPIDXXXXXXXXXXXXTFFIDFLYFER 797
            PGLE+L Q+D +L+ +    +E     +  N Y +++  GQ +  A E+SN C R CCG +RP  I + D  D  VL++  P    C    C   +        TT     +G++ +  +     + ILD + + +L + GP +  G C + ++F  K  D +  V  G I+  W    +E L+++++FG+QFP+DL V VKA+ L ATF ID+++FE+
Sbjct:   75 PGLEFLVQIDQILIHQKAERVETFLGWETCNMYELRSGTGQQLGQAAEESNCCARLCCGARRPFRIRLADPGDREVLRLLRPLHCGCSCCPCGLQEMEVQAPPGTT-----IGHVLQTWHPFLPKFSILDADRQPVLRVVGPCWTCG-CGTDTNFEVKTKDESRSV--GRISKQWGGLLREALTDADDFGLQFPVDLDVKVKAVLLGATFLIDYMFFEK 285          
BLAST of Phospholipid scramblase vs. UniProt
Match: sp|Q3ZBG9|PLS2_BOVIN (Phospholipid scramblase 2 OS=Bos taurus OX=9913 GN=PLSCR2 PE=2 SV=1)

HSP 1 Score: 119.783 bits (299), Expect = 2.139e-30
Identity = 76/230 (33.04%), Postives = 121/230 (52.61%), Query Frame = 3
Query:  108 WMTKAVVK-NCIPGLEYLTQLDSVLVKRMMNWIEILRKIDPKNKYIVKNMIGQSVYYAIEDSNQCLRWCCGTKRPSNIFVYDKSDSVVLKIEHPXXXXXXXXXXXXXXXXXXXXXXTTGSDQVLGYIQEINNCGFIVYFILDENSKLLLILKGPHYCHGCCSSRSDFSFKIMDNTGKVEIGAITNSWRCWTQEWLSNSENFGVQFPIDXXXXXXXXXXXXTFFIDFLYFE 794
            WM   +   NC PGLEYLTQ+D +L+ + +  +E+L   +  NKY +KN +GQ +Y+A ED++ C R CCG  RP  + + D     V+ +E P +       C   +               +GY+ +  +     + I +E  + +L + GP     CC+   DF  K +D+  K  +G I+  W    +E  ++ +NFG+QFP+DL V +KA+ L A F IDF++FE
Sbjct:   67 WMPAPLPPLNCPPGLEYLTQIDQLLIHQQIELLEVLIGFETNNKYEIKNSLGQRIYFAAEDTDCCTRNCCGPSRPFTMRILDNMGREVITLERPLRCTSCCFPCCLQEIEIQAPPGVP-----VGYVTQTWHPCLPKFTIQNERREDVLRISGPCVICSCCAD-IDFEVKSLDD--KYVVGKISKHWTGLIKELFTDVDNFGIQFPLDLDVKMKAVMLGACFLIDFMFFE 288          
BLAST of Phospholipid scramblase vs. UniProt
Match: sp|O15162|PLS1_HUMAN (Phospholipid scramblase 1 OS=Homo sapiens OX=9606 GN=PLSCR1 PE=1 SV=1)

HSP 1 Score: 117.857 bits (294), Expect = 1.816e-29
Identity = 74/230 (32.17%), Postives = 119/230 (51.74%), Query Frame = 3
Query:  108 WMTKAVVK-NCIPGLEYLTQLDSVLVKRMMNWIEILRKIDPKNKYIVKNMIGQSVYYAIEDSNQCLRWCCGTKRPSNIFVYDKSDSVVLKIEHPXXXXXXXXXXXXXXXXXXXXXXTTGSDQVLGYIQEINNCGFIVYFILDENSKLLLILKGPHYCHGCCSSRSDFSFKIMDNTGKVEIGAITNSWRCWTQEWLSNSENFGVQFPIDXXXXXXXXXXXXTFFIDFLYFE 794
            WM       NC PGLEYL+Q+D +L+ + +  +E+L   +  NKY +KN  GQ VY+A ED++ C R CCG  RP  + + D     V+ +E P + +     C   +               +GY+ +  +     + I +E  + +L + GP     CC    DF  K +D   +  +G I+  W    +E  ++++NFG+QFP+DL V +KA+ + A F IDF++FE
Sbjct:   85 WMPAPQPPLNCPPGLEYLSQIDQILIHQQIELLEVLTGFETNNKYEIKNSFGQRVYFAAEDTDCCTRNCCGPSRPFTLRIIDNMGQEVITLERPLRCSSCCCPCCLQEIEIQAPPGVP-----IGYVIQTWHPCLPKFTIQNEKREDVLKISGPCVVCSCCGD-VDFEIKSLDE--QCVVGKISKHWTGILREAFTDADNFGIQFPLDLDVKMKAVMIGACFLIDFMFFE 306          
BLAST of Phospholipid scramblase vs. UniProt
Match: sp|P58195|PLS1_RAT (Phospholipid scramblase 1 OS=Rattus norvegicus OX=10116 GN=Plscr1 PE=1 SV=1)

HSP 1 Score: 117.472 bits (293), Expect = 2.964e-29
Identity = 74/220 (33.64%), Postives = 118/220 (53.64%), Query Frame = 3
Query:  144 GLEYLTQLDSVLVKRMMNWIEILRKIDPKNKYIVKNMIGQSVYYAIEDSNQCLRWCCGTKRPSNIFVYDKSDSVVLKIEHPXXXXXXXXXXXXXXXXXXXXXXTTGSDQVLGYIQEINNCGFIVYFILDENSKLLLILKGPHYCHGCCSSRSDFSFKIMDNTGKVEIGAITNSWRCWTQEWLSNSENFGVQFPIDXXXXXXXXXXXXTFFIDFLYFERIN 803
            GLEYLTQ+D +LV + +  +E+L   +  NKY +KN +GQ VY+A+ED++ C R CCG  RP  + + D     V+ +E P + +     C   +               +GY+ +  +     + + +E  + +L + GP     CCS   DF  K +D    V  G I+  W  + +E  ++++NFG+QFP+DL V +KA+ L A F IDF++FER  
Sbjct:  115 GLEYLTQIDQILVHQQIELLEVLTGFETNNKYEIKNSLGQRVYFAVEDTDCCTRNCCGASRPFTLRILDNMGREVMTLERPLRCSSCCFPCCLQEIEIQAPPGVP-----VGYVIQTWHPCLPKFTLQNEKRQDVLKVVGPCVVCSCCSD-IDFELKSLDEESVV--GKISKQWSGFVREAFTDADNFGIQFPLDLDVKMKAVMLGACFLIDFMFFERTG 326          
BLAST of Phospholipid scramblase vs. UniProt
Match: sp|Q9JJ00|PLS1_MOUSE (Phospholipid scramblase 1 OS=Mus musculus OX=10090 GN=Plscr1 PE=1 SV=1)

HSP 1 Score: 117.087 bits (292), Expect = 4.368e-29
Identity = 73/218 (33.49%), Postives = 117/218 (53.67%), Query Frame = 3
Query:  144 GLEYLTQLDSVLVKRMMNWIEILRKIDPKNKYIVKNMIGQSVYYAIEDSNQCLRWCCGTKRPSNIFVYDKSDSVVLKIEHPXXXXXXXXXXXXXXXXXXXXXXTTGSDQVLGYIQEINNCGFIVYFILDENSKLLLILKGPHYCHGCCSSRSDFSFKIMDNTGKVEIGAITNSWRCWTQEWLSNSENFGVQFPIDXXXXXXXXXXXXTFFIDFLYFER 797
            GLEYL Q+D +LV + +  +E+L   +  NKY +KN +GQ VY+A+ED++ C R CCG  RP  + + D     V+ +E P + +     C   +               +GY+ +  +     + + +E  + +L + GP     CCS   DF  K +D    V  G I+  W  + +E  ++++NFG+QFP+DL V +KA+ L A F IDF++FER
Sbjct:  107 GLEYLAQIDQLLVHQQIELLEVLTGFETNNKYEIKNSLGQRVYFAVEDTDCCTRNCCGASRPFTLRILDNLGREVMTLERPLRCSSCCFPCCLQEIEIQAPPGVP-----VGYVTQTWHPCLPKFTLQNEKKQDVLKVVGPCVVCSCCSD-IDFELKSLDEESVV--GKISKQWSGFVREAFTDADNFGIQFPLDLDVKMKAVMLGACFLIDFMFFER 316          
BLAST of Phospholipid scramblase vs. UniProt
Match: sp|Q9DCW2|PLS2_MOUSE (Phospholipid scramblase 2 OS=Mus musculus OX=10090 GN=Plscr2 PE=1 SV=3)

HSP 1 Score: 114.775 bits (286), Expect = 2.089e-28
Identity = 74/231 (32.03%), Postives = 120/231 (51.95%), Query Frame = 3
Query:  105 EWM-TKAVVKNCIPGLEYLTQLDSVLVKRMMNWIEILRKIDPKNKYIVKNMIGQSVYYAIEDSNQCLRWCCGTKRPSNIFVYDKSDSVVLKIEHPXXXXXXXXXXXXXXXXXXXXXXTTGSDQVLGYIQEINNCGFIVYFILDENSKLLLILKGPHYCHGCCSSRSDFSFKIMDNTGKVEIGAITNSWRCWTQEWLSNSENFGVQFPIDXXXXXXXXXXXXTFFIDFLYFE 794
            +WM     + NC PGLEYL Q+D +L+ + +  +E+L   +  NK+ +KN +GQ VY A+ED++ C R CC   RP  + + D     V+ +E P + +     C   +               +GY+ +  +       + ++  + +L + GP     CCS   DF  K +D   +  IG IT  W    +E  ++S+NFG+QFP+DL V +KA+ L A F ID+++FE
Sbjct:   82 QWMPAPPPILNCPPGLEYLNQIDQLLIHQQVELLEVLTGFETNNKFEIKNSLGQMVYVAVEDTDCCTRNCCEASRPFTLRILDHLGQEVMTLERPLKCSSCCFPCCLQEIEIQAPPGVP-----IGYVTQTWHPCLPKLTLQNDKRENVLKVVGPCVACTCCSD-IDFEIKSLDEVTR--IGKITKQWSGCVKEAFTDSDNFGIQFPLDLEVKMKAVTLGACFLIDYMFFE 304          
BLAST of Phospholipid scramblase vs. TrEMBL
Match: gnl|BL_ORD_ID|20375344 (tr|G7YRN6|G7YRN6_CLOSI Phospholipid scramblase OS=Clonorchis sinensis OX=79923 GN=CLF_108489 PE=3 SV=1)

HSP 1 Score: 159.073 bits (401), Expect = 1.582e-43
Identity = 90/233 (38.63%), Postives = 142/233 (60.94%), Query Frame = 3
Query:   96 DKGEWMTKAVVKNCIPGLEYLTQLDSVLVKRMMNWIEILRKIDPKNKYIVKNMIGQSVYYAIEDSNQCLRWCCGTKRPSNIFVYDKSDSVVLKIEHPXXXXXXXXXXXXXXXXXXXXXXTTGSDQVLGYIQEINNCGFIVYFILDENSKLLLILKGPHYCHGCCSSRSDFSFKIMDNTGKVEIGAITNSWRCWTQEWLSNSENFGVQFPIDXXXXXXXXXXXXTFFIDFLYFE 794
            D    M + VV NC PGLEYLTQ++ +LVK+     EIL  I+  N+YI+ N +GQ+++   E+SN C R CC  +RP  + V+D S + V++I+ P++  C      C +CC++++ +     QV+GY++++ +   I Y + D +  ++L++ GP YCH  C    D +F IM   G+ E+G IT  W    QE  ++++NFG+ FP+DL V VKA  + A F IDF++FE
Sbjct:    5 DSTNLMPRPVVPNCPPGLEYLTQINQLLVKQKKELFEILTDIEVANRYIIVNTMGQTLFNCKEESNFCSRQCCKGQRPYTMHVHDNSGTEVIRIKRPYKYVCCGQCFSCAECCQDELTVEAPVGQVVGYVKQVQDGCNIRYMVKDASENVVLLIHGPSYCHCTCIGE-DINFMIMSADGETEVGRITKQWSNIIQELFTDADNFGIAFPMDLDVRVKATLIGAVFLIDFMFFE 236          
BLAST of Phospholipid scramblase vs. TrEMBL
Match: gnl|BL_ORD_ID|20415936 (tr|A0A3R7GRQ5|A0A3R7GRQ5_CLOSI Phospholipid scramblase OS=Clonorchis sinensis OX=79923 GN=PLSCR2 PE=3 SV=1)

HSP 1 Score: 155.992 bits (393), Expect = 1.156e-41
Identity = 89/228 (39.04%), Postives = 141/228 (61.84%), Query Frame = 3
Query:  111 MTKAVVKNCIPGLEYLTQLDSVLVKRMMNWIEILRKIDPKNKYIVKNMIGQSVYYAIEDSNQCLRWCCGTKRPSNIFVYDKSDSVVLKIEHPXXXXXXXXXXXXXXXXXXXXXXTTGSDQVLGYIQEINNCGFIVYFILDENSKLLLILKGPHYCHGCCSSRSDFSFKIMDNTGKVEIGAITNSWRCWTQEWLSNSENFGVQFPIDXXXXXXXXXXXXTFFIDFLYFE 794
            M + VV NC PGLEYLTQ++ +LVK+     EIL  I+  N+YI+ N +GQ+++   E+SN C R CC  +RP  + V+D S + V++I+ P++  C      C +CC++++ +     QV+GY++++ +   I Y + D +  ++L++ GP YCH  C    D +F IM   G+ E+G IT  W    QE  ++++NFG+ FP+DL V VKA  + A F IDF++FE
Sbjct:   72 MPRPVVPNCPPGLEYLTQINQLLVKQKKELFEILTDIEVANRYIIVNTMGQTLFNCKEESNFCSRQCCKGQRPYTMHVHDNSGTEVIRIKRPYKYVCCGQCFSCAECCQDELTVEAPVGQVVGYVKQVQDGCNIRYMVKDASENVVLLIHGPSYCHCTCIGE-DINFMIMSADGETEVGRITKQWSNIIQELFTDADNFGIAFPMDLDVRVKATLIGAVFLIDFMFFE 298          
BLAST of Phospholipid scramblase vs. TrEMBL
Match: gnl|BL_ORD_ID|21420950 (tr|A0A075A1P0|A0A075A1P0_9TREM Phospholipid scramblase OS=Opisthorchis viverrini OX=6198 GN=T265_00773 PE=3 SV=1)

HSP 1 Score: 153.68 bits (387), Expect = 1.472e-41
Identity = 88/228 (38.60%), Postives = 139/228 (60.96%), Query Frame = 3
Query:  111 MTKAVVKNCIPGLEYLTQLDSVLVKRMMNWIEILRKIDPKNKYIVKNMIGQSVYYAIEDSNQCLRWCCGTKRPSNIFVYDKSDSVVLKIEHPXXXXXXXXXXXXXXXXXXXXXXTTGSDQVLGYIQEINNCGFIVYFILDENSKLLLILKGPHYCHGCCSSRSDFSFKIMDNTGKVEIGAITNSWRCWTQEWLSNSENFGVQFPIDXXXXXXXXXXXXTFFIDFLYFE 794
            M + VV +C PGLEYLTQ++ +LVK+     EI+  I+  N+Y++ N +GQ+VY   E+SN C R CC ++RP  + V D S   V++++ P++  C      C +CC++++++     Q++GY+++I +   I Y I D   K +L + GP YCH  C    D +FK+M   G  E+G IT  W    QE  ++++NFG+ FP+DL V +KA  + A F IDF++FE
Sbjct:    1 MPRPVVLDCPPGLEYLTQINQLLVKQKKELFEIMTDIETANRYVIVNTMGQTVYNCSEESNFCARQCCRSQRPYTMHVQDNSGMEVIRVKRPYKCYCCWECLSCSECCQDELQVEAPIGQLVGYVKQIQDGCNIRYAIKDSTGKQVLRIHGPSYCHCACFG-EDINFKVMSADGNTEVGRITKQWSNIVQEMFTDADNFGIAFPMDLDVRIKATLIGAVFLIDFMFFE 227          
BLAST of Phospholipid scramblase vs. TrEMBL
Match: gnl|BL_ORD_ID|16180041 (tr|A0A4S2LVZ8|A0A4S2LVZ8_OPIFE Phospholipid scramblase OS=Opisthorchis felineus OX=147828 GN=CRM22_004675 PE=3 SV=1)

HSP 1 Score: 151.369 bits (381), Expect = 8.227e-40
Identity = 90/228 (39.47%), Postives = 138/228 (60.53%), Query Frame = 3
Query:  111 MTKAVVKNCIPGLEYLTQLDSVLVKRMMNWIEILRKIDPKNKYIVKNMIGQSVYYAIEDSNQCLRWCCGTKRPSNIFVYDKSDSVVLKIEHPXXXXXXXXXXXXXXXXXXXXXXTTGSDQVLGYIQEINNCGFIVYFILDENSKLLLILKGPHYCHGCCSSRSDFSFKIMDNTGKVEIGAITNSWRCWTQEWLSNSENFGVQFPIDXXXXXXXXXXXXTFFIDFLYFE 794
            M + VV NC PGLEYLTQ++ +LVK+     EI+  I+  N+Y++ N +GQ+V+   E+SN C R CC  +RP  + V+D S   V++I+ P++  C      C +CC++++ I     QV+GY+++I +   I Y + D +  ++L + GP YCH  C    D +F IM   G  E+G IT  W    QE  ++++NFG+ FP+DL V VKA  + A F IDF++FE
Sbjct:   78 MPRPVVPNCPPGLEYLTQINQLLVKQKKELFEIITDIEVANRYVILNTMGQTVFNCNEESNFCSRQCCKGQRPYTMHVHDNSGMEVIRIKRPYKYACCGQCFSCVECCQDELTIEAPVGQVVGYVKQIQDGCNIRYVVKDASENVVLRIHGPSYCHCACFGE-DVNFMIMSADGNTEVGRITKQWSNIIQEMFTDADNFGIAFPMDLDVWVKATLIGAVFLIDFMFFE 304          
BLAST of Phospholipid scramblase vs. TrEMBL
Match: gnl|BL_ORD_ID|22921308 (tr|A0A4S2LUZ8|A0A4S2LUZ8_OPIFE Phospholipid scramblase OS=Opisthorchis felineus OX=147828 GN=CRM22_004676 PE=3 SV=1)

HSP 1 Score: 150.984 bits (380), Expect = 3.115e-39
Identity = 91/257 (35.41%), Postives = 141/257 (54.86%), Query Frame = 3
Query:   24 KETNYFVNTVSKTMKRPPVIEICRDKGEWMTKAVVKNCIPGLEYLTQLDSVLVKRMMNWIEILRKIDPKNKYIVKNMIGQSVYYAIEDSNQCLRWCCGTKRPSNIFVYDKSDSVVLKIEHPXXXXXXXXXXXXXXXXXXXXXXTTGSDQVLGYIQEINNCGFIVYFILDENSKLLLILKGPHYCHGCCSSRSDFSFKIMDNTGKVEIGAITNSWRCWTQEWLSNSENFGVQFPIDXXXXXXXXXXXXTFFIDFLYFE 794
             + +Y    V +    P           WM + VV +C PGLEYLTQ++ +LVK+     EI+  I+  N+Y++ N +GQ+VY   E+SN C R  C  +RP  + V D S   V++++ P++  C      C +CC++++ +     QV+GY+++I     I Y I D   K +L + GP YCH C     D +FK+M   G  E+G IT  W    QE  ++++NFG+ FP+DL   +KA  + A F IDF++FE
Sbjct:   91 PQAHYGPVPVPQGAYGPGPAHQGPPAANWMPRPVVLDCPPGLEYLTQINQLLVKQKKELFEIMTDIETANRYVILNTMGQTVYNCSEESNFCARQFCKAQRPYTMHVQDNSGMEVIRVKRPYKCYCCWECLSCSECCQDELLVEAPIGQVVGYVKQIQEGCKIRYAIKDSTGKQVLRIHGPSYCH-CACFGEDINFKVMSADGNTEVGRITKQWSNIVQEMFTDADNFGIAFPMDLDARIKATLIGAVFLIDFMFFE 346          
BLAST of Phospholipid scramblase vs. Ensembl Cavefish
Match: si:ch211-71m22.1 (phospholipid scramblase 1-like [Source:NCBI gene;Acc:103030773])

HSP 1 Score: 114.005 bits (284), Expect = 2.044e-29
Identity = 73/223 (32.74%), Postives = 121/223 (54.26%), Query Frame = 3
Query:  135 CIPGLEYLTQLDSVLVKRMMNWIEILRKIDPKNKYIVKNMIGQSVYYAIEDSNQCLRWCCGTKRPSNIFVYDKSDSVVLKIEHPXXXXXXXXXXXXXXXXXXXXXXTTGSDQVLGYIQEINNCGFIVYFILDENSKLLLILKGPHYCHGCCSSRSDFSFKIMDNTGKVEIGAITNSWRCWTQEWLSNSENFGVQFPIDXXXXXXXXXXXXTFFIDFLYFERIN 803
            C PGLEYLTQ+D +LV + +   E++   +  NKY+VKN +GQ V+Y  E+++ C R CCG  R   + V D     V+ +  P        +  CC CC  ++++       +GY+ +  +     + + +E  + +L ++GP     CC   SD +F++M      ++G I   W    QE  ++++NFG++FP+DL V +KA+   A F IDF++FE  N
Sbjct:   48 CPPGLEYLTQIDQLLVHQKIELAEVILGWETNNKYLVKNTLGQQVFYVAEENDCCTRQCCGPMRSFVLHVQDNMGQEVMTLTRP-----LRCASCCCPCCLQELEVQAPPGNPIGYVIQKWHPFLPKFIVQNEKREDVLRIQGPFCACNCC---SDVNFEVMSMDESTQVGRICKQWTGMLQEAFTDADNFGIKFPMDLDVKIKAVLFGALFLIDFMFFENSN 262          
BLAST of Phospholipid scramblase vs. Ensembl Cavefish
Match: si:ch73-206p6.1 (phospholipid scramblase 1 [Source:NCBI gene;Acc:103028162])

HSP 1 Score: 112.849 bits (281), Expect = 2.489e-29
Identity = 74/226 (32.74%), Postives = 123/226 (54.42%), Query Frame = 3
Query:  126 VKNCIPGLEYLTQLDSVLVKRMMNWIEILRKIDPKNKYIVKNMIGQSVYYAIEDSNQCLRWCCGTKRPSNIFVYDKSDSVVLKIEHPXXXXXXXXXXXXXXXXXXXXXXTTGSDQVLGYIQEINNCGFIVYFILDENSKLLLILKGPHYCHGCCSSRSDFSFKIMDNTGKVEIGAITNSWRCWTQEWLSNSENFGVQFPIDXXXXXXXXXXXXTFFIDFLYFERIN 803
            +  C  GLEYLTQ+D +L+K+ +  IE L   +  NKY ++N +GQ+V+YA+E+++   R CCG  R   I V D     V+ +  P              CC  ++++ +    ++GY+ +  +     + I +E+ + +L L+GP +C   C    DF    MD+   V IG I+  W    +E  ++++NFG+QFP+DL V +KA+ +   F IDF++FE  N
Sbjct:   13 MPGCPAGLEYLTQVDQLLIKQKVELIEALAGFESNNKYEIRNAMGQNVFYAVEENDCLTRQCCGPLRSFTIRVLDNFGQEVITVNRP-----LKCMSCFFPCCLQELEVQSPPGNIVGYVLQEWHPFLPKFTIKNEHREPVLKLQGP-FCGWSCLPDVDFEIMTMDD---VSIGKISKQWTGLLREAFTDADNFGIQFPMDLDVRMKAVMIGLCFLIDFMFFETNN 229          
BLAST of Phospholipid scramblase vs. Ensembl Cavefish
Match: plscr3b (phospholipid scramblase 2-like [Source:NCBI gene;Acc:103046260])

HSP 1 Score: 110.923 bits (276), Expect = 7.405e-28
Identity = 70/221 (31.67%), Postives = 121/221 (54.75%), Query Frame = 3
Query:  141 PGLEYLTQLDSVLVKRMMNWIEILRKIDPKNKYIVKNMIGQSVYYAIEDSNQCLRWCCGTKRPSNIFVYDKSDSVVLKIEHPXXXXXXXXXXXXXXXXXXXXXXTTGSDQVLGYIQEINNCGFIVYFILDENSKLLLILKGPHYCHGCCSSRSDFSFKIMDNTGKVEIGAITNSWRCWTQEWLSNSENFGVQFPIDXXXXXXXXXXXXTFFIDFLYFERIN 803
            PGLEYLTQ+D VL+ + +  +E +   +  N+Y VKN +GQ +Y A E ++ C R CCG+ R  ++ + D +D  V+++  PF+       C   +        TT     +GY+ +  +  +  + I   N + ++ L+GP     CC    D +F++    G   IG I+  W    +E  ++++NFG+QFP+D+ V +KA+ + A F IDF++FE++ 
Sbjct:  103 PGLEYLTQIDQVLIHQKVELLEAIIGFETNNQYEVKNSMGQKIYKAKEKNDCCTRNCCGSLRSFDMKIKDNTDREVIRLIRPFRCATCWCPCCLQEMEVQAPPGTT-----IGYVTQDWHPCYPKFSIKGPNKETVMKLEGPCLACNCC---GDVNFELKGKDGGKSIGRISKQWSGLLKEVFTDTDNFGIQFPLDMDVKMKAVLMGACFLIDFIFFEKVG 315          
BLAST of Phospholipid scramblase vs. Ensembl Cavefish
Match: plscr3b (phospholipid scramblase 2-like [Source:NCBI gene;Acc:103046260])

HSP 1 Score: 110.923 bits (276), Expect = 7.405e-28
Identity = 70/221 (31.67%), Postives = 121/221 (54.75%), Query Frame = 3
Query:  141 PGLEYLTQLDSVLVKRMMNWIEILRKIDPKNKYIVKNMIGQSVYYAIEDSNQCLRWCCGTKRPSNIFVYDKSDSVVLKIEHPXXXXXXXXXXXXXXXXXXXXXXTTGSDQVLGYIQEINNCGFIVYFILDENSKLLLILKGPHYCHGCCSSRSDFSFKIMDNTGKVEIGAITNSWRCWTQEWLSNSENFGVQFPIDXXXXXXXXXXXXTFFIDFLYFERIN 803
            PGLEYLTQ+D VL+ + +  +E +   +  N+Y VKN +GQ +Y A E ++ C R CCG+ R  ++ + D +D  V+++  PF+       C   +        TT     +GY+ +  +  +  + I   N + ++ L+GP     CC    D +F++    G   IG I+  W    +E  ++++NFG+QFP+D+ V +KA+ + A F IDF++FE++ 
Sbjct:  103 PGLEYLTQIDQVLIHQKVELLEAIIGFETNNQYEVKNSMGQKIYKAKEKNDCCTRNCCGSLRSFDMKIKDNTDREVIRLIRPFRCATCWCPCCLQEMEVQAPPGTT-----IGYVTQDWHPCYPKFSIKGPNKETVMKLEGPCLACNCC---GDVNFELKGKDGGKSIGRISKQWSGLLKEVFTDTDNFGIQFPLDMDVKMKAVLMGACFLIDFIFFEKVG 315          
BLAST of Phospholipid scramblase vs. Ensembl Cavefish
Match: si:ch211-71m22.5 (si:ch211-71m22.5 [Source:ZFIN;Acc:ZDB-GENE-130531-65])

HSP 1 Score: 103.99 bits (258), Expect = 7.862e-26
Identity = 75/216 (34.72%), Postives = 121/216 (56.02%), Query Frame = 3
Query:  147 LEYLTQLDSVLVKRMMNWIEILRKIDPKNKYIVKNMIGQSVYYAIEDSNQCLRWCCGTKRPSNIFVYDKSDSVVLKIEHPXXXXXXXXXXXXXXXXXXXXXXTTGSDQVLGYIQEINNCGFIVYFILDENSKLLLILKGPHYCHGCCSSRSDFSFKIMDNTGKVEIGAITNSWRCWTQEWLSNSENFGVQFPIDXXXXXXXXXXXXTFFIDFLYFE 794
            LEYLTQ+D +L+ + +  +E +   +  N+Y+VKN +GQ V+ A E+++ C R  CG  R   + + D +   VL +  P      N S  C  CC  ++++ +   Q +GY+ +  +     + I DE  + ++ + GP     CC   SD +F++M   G   IG I+  W     E L++++NFGVQFP+DL V +KA+ L+A F IDF+YFE
Sbjct:   33 LEYLTQIDQILIHQKVELMEAMLGWETNNQYVVKNSLGQQVFLAAEENDFCTRTMCGPMRSFVLHLQDNTGREVLTLTRP-----LNCSSCCFPCCLQELEVQSPPGQPIGYVIQKWHPYLPKFTIKDERKQSVMQIVGPFCDCNCC---SDVNFEVMSLDGASVIGRISKQWTGMEAEMLTDADNFGVQFPMDLDVKIKAVILSACFLIDFMYFE 240          
BLAST of Phospholipid scramblase vs. Ensembl Nematostella
Match: EDO31512 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXP9])

HSP 1 Score: 120.168 bits (300), Expect = 1.062e-32
Identity = 76/220 (34.55%), Postives = 116/220 (52.73%), Query Frame = 3
Query:  147 LEYLTQLDSVLVKRMMNWIEILRKIDPKNKYIVKNMIGQSVYYAIEDSNQCLRWCCGTKRPSNIFVYDKSDSVVLKIEHPXXXXXXXXXXXXXXXXXXXXXXTTGSDQVLGYI-QEINNCGFIVYFILDENSKLLLILKGPHYCHGCCSSRSDFSFKIMDNTGKVEIGAITNSWRCWTQEWLSNSENFGVQFPIDXXXXXXXXXXXXTFFIDFLYFERIN 803
            LEYLTQ+D +L+++ +   E+    + KNKY + N +GQ VY+A ED++ C R CCG  RP  + + D +   V+ +  P +  CF   C                  V+GY+ QE   C    + I D N + +L + GP     CC   +D  F ++   G V +G +T  W    +E  +++ENFG+ FP+DL V +KA+ L A F IDF++FE  N
Sbjct:   14 LEYLTQIDQLLIRQQVELFELFTGCEMKNKYQITNSLGQQVYFAKEDTDCCTRQCCGPARPFEMEITDNTGREVIHLSRPLRCACFCCWCCLQTIEVQ-----APRGNVVGYVEQEFYICK-PKFTIKDANRQTILTMTGPICACRCC---ADVEFPVLSADGTVPVGKVTKQWTGLIKEAFTDAENFGITFPMDLDVKMKAVMLGAVFLIDFMFFETQN 224          
BLAST of Phospholipid scramblase vs. Ensembl Nematostella
Match: EDO46109 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR56])

HSP 1 Score: 97.0561 bits (240), Expect = 2.404e-22
Identity = 56/195 (28.72%), Postives = 99/195 (50.77%), Query Frame = 3
Query:  144 GLEYLTQLDSVLVKRMMNWIEILRKIDPKNKYIVKNMIGQSVYYAIEDSNQCLRWCCGTKRPSNIFVYDKSDSVVLKIEHPXXXXXXXXXXXXXXXXXXXXXXTTGSDQVLGYIQEINNCGFIVYFILDENSKLLLILKGPHYCHGCCSSRSDFSFKIMDNTGKVEIGAITNSWRCWTQEWLSNSENFGVQFPID 728
            GLEYLT +D +L+K+ +  +E     +  NKY + N +GQ V++A ED++ C R CCG  RP +I + D +   V+ +  P + +     C   +        T     V+GY  +  +     Y + D N + +L ++GP      C    D  F+++   G+ ++G ++  W    +E  ++++NFGV FP+D
Sbjct:   86 GLEYLTMVDQLLIKQQVELLEAFTGFETNNKYKITNNLGQQVFFAAEDTDCCTRQCCGPSRPFDIKIMDNTQREVIHLTRPLRCSSCWFPCCLQEVEVQSPPGT-----VVGYCCQSWSICIPKYTLQDANRQTILQIEGPLCTFNIC---GDVEFQVLSADGQNQVGKVSKQWSGLVKEAFTDADNFGVTFPMD 272          
BLAST of Phospholipid scramblase vs. Ensembl Medaka
Match: plscr3b (phospholipid scramblase 2 [Source:NCBI gene;Acc:101157328])

HSP 1 Score: 110.923 bits (276), Expect = 3.585e-28
Identity = 72/221 (32.58%), Postives = 118/221 (53.39%), Query Frame = 3
Query:  141 PGLEYLTQLDSVLVKRMMNWIEILRKIDPKNKYIVKNMIGQSVYYAIEDSNQCLRWCCGTKRPSNIFVYDKSDSVVLKIEHPXXXXXXXXXXXXXXXXXXXXXXTTGSDQVLGYIQEINNCGFIVYFILDENSKLLLILKGPHYCHGCCSSRSDFSFKIMDNTGKVEIGAITNSWRCWTQEWLSNSENFGVQFPIDXXXXXXXXXXXXTFFIDFLYFERIN 803
            PGLEYL Q+D +L+ + +  +E     +  N+Y +KN +GQ +Y A E ++ C R CCG  R  ++ + D +D  V+++  PF+       C   +        TT     +GY+++  +     + I   N + L+ L+GP +   CC   S F  K  D T    IG IT  W    +E  ++++NFG+QFP+DL V +KA+ + A F IDF++FE++ 
Sbjct:   69 PGLEYLAQIDQILIHQKVELLEAFIGFETNNQYEIKNNLGQKIYTAKEKNDCCTRNCCGALRSFDMKIKDNTDREVIRLIRPFRCVSCCCPCCLQEMEVQAPPGTT-----VGYVKQDWHPFLPKFSIQGANKETLMRLEGPCFACNCCGDVS-FELKGKDET---PIGRITKQWSGLLKEVFTDTDNFGIQFPLDLDVKMKAVLMGACFLIDFMFFEKVG 280          
BLAST of Phospholipid scramblase vs. Ensembl Medaka
Match: plscr3b (phospholipid scramblase 2 [Source:NCBI gene;Acc:101157328])

HSP 1 Score: 110.923 bits (276), Expect = 3.585e-28
Identity = 72/221 (32.58%), Postives = 118/221 (53.39%), Query Frame = 3
Query:  141 PGLEYLTQLDSVLVKRMMNWIEILRKIDPKNKYIVKNMIGQSVYYAIEDSNQCLRWCCGTKRPSNIFVYDKSDSVVLKIEHPXXXXXXXXXXXXXXXXXXXXXXTTGSDQVLGYIQEINNCGFIVYFILDENSKLLLILKGPHYCHGCCSSRSDFSFKIMDNTGKVEIGAITNSWRCWTQEWLSNSENFGVQFPIDXXXXXXXXXXXXTFFIDFLYFERIN 803
            PGLEYL Q+D +L+ + +  +E     +  N+Y +KN +GQ +Y A E ++ C R CCG  R  ++ + D +D  V+++  PF+       C   +        TT     +GY+++  +     + I   N + L+ L+GP +   CC   S F  K  D T    IG IT  W    +E  ++++NFG+QFP+DL V +KA+ + A F IDF++FE++ 
Sbjct:   69 PGLEYLAQIDQILIHQKVELLEAFIGFETNNQYEIKNNLGQKIYTAKEKNDCCTRNCCGALRSFDMKIKDNTDREVIRLIRPFRCVSCCCPCCLQEMEVQAPPGTT-----VGYVKQDWHPFLPKFSIQGANKETLMRLEGPCFACNCCGDVS-FELKGKDET---PIGRITKQWSGLLKEVFTDTDNFGIQFPLDLDVKMKAVLMGACFLIDFMFFEKVG 280          
BLAST of Phospholipid scramblase vs. Ensembl Medaka
Match: si:ch73-206p6.1 (phospholipid scramblase 1 [Source:NCBI gene;Acc:101170797])

HSP 1 Score: 100.523 bits (249), Expect = 1.233e-24
Identity = 67/217 (30.88%), Postives = 114/217 (52.53%), Query Frame = 3
Query:  153 YLTQLDSVLVKRMMNWIEILRKIDPKNKYIVKNMIGQSVYYAIEDSNQCLRWCCGTKRPSNIFVYDKSDSVVLKIEHPXXXXXXXXXXXXXXXXXXXXXXTTGSDQVLGYIQEINNCGFIVYFILDENSKLLLILKGPHYCHGCCSSRSDFSFKIMDNTGKVEIGAITNSWRCWTQEWLSNSENFGVQFPIDXXXXXXXXXXXXTFFIDFLYFERIN 803
            Y  Q+D +L+K+ +  +E L   +  NKY ++N++GQ+V+YA+E+++   R CCG  R   I V D     ++ +  P +       C   +         T     +GY+ +  +  F  + + +E+++ +L + GP +C   C    DF    MD   K  IG I+  W    +E  ++S+NFG+QFP+DL V +KA+ + A F IDF++FE  N
Sbjct:   37 YCCQVDQLLMKQKVELVEALVGFESNNKYEIRNVMGQNVFYAVEENDCLSRQCCGPLRSFTIHVLDNFGQEIITVTRPLKCMSCFFPCCLQELEVQSPPGNT-----VGYVIQQWHPFFPKFIVANEHNEPVLKIHGP-FCGWSCLPDVDFEILTMDEVNK--IGKISKQWTGLLREAFTDSDNFGIQFPLDLDVRMKAVMIGACFLIDFMFFETTN 245          
BLAST of Phospholipid scramblase vs. Ensembl Medaka
Match: si:ch73-206p6.1 (phospholipid scramblase 1 [Source:NCBI gene;Acc:101170797])

HSP 1 Score: 100.523 bits (249), Expect = 1.233e-24
Identity = 67/217 (30.88%), Postives = 114/217 (52.53%), Query Frame = 3
Query:  153 YLTQLDSVLVKRMMNWIEILRKIDPKNKYIVKNMIGQSVYYAIEDSNQCLRWCCGTKRPSNIFVYDKSDSVVLKIEHPXXXXXXXXXXXXXXXXXXXXXXTTGSDQVLGYIQEINNCGFIVYFILDENSKLLLILKGPHYCHGCCSSRSDFSFKIMDNTGKVEIGAITNSWRCWTQEWLSNSENFGVQFPIDXXXXXXXXXXXXTFFIDFLYFERIN 803
            Y  Q+D +L+K+ +  +E L   +  NKY ++N++GQ+V+YA+E+++   R CCG  R   I V D     ++ +  P +       C   +         T     +GY+ +  +  F  + + +E+++ +L + GP +C   C    DF    MD   K  IG I+  W    +E  ++S+NFG+QFP+DL V +KA+ + A F IDF++FE  N
Sbjct:   37 YCCQVDQLLMKQKVELVEALVGFESNNKYEIRNVMGQNVFYAVEENDCLSRQCCGPLRSFTIHVLDNFGQEIITVTRPLKCMSCFFPCCLQELEVQSPPGNT-----VGYVIQQWHPFFPKFIVANEHNEPVLKIHGP-FCGWSCLPDVDFEILTMDEVNK--IGKISKQWTGLLREAFTDSDNFGIQFPLDLDVRMKAVMIGACFLIDFMFFETTN 245          
BLAST of Phospholipid scramblase vs. Planmine SMEST
Match: SMESG000050116.1 (SMESG000050116.1)

HSP 1 Score: 396.356 bits (1017), Expect = 2.156e-140
Identity = 231/231 (100.00%), Postives = 231/231 (100.00%), Query Frame = 3
Query:  111 MTKAVVKNCIPGLEYLTQLDSVLVKRMMNWIEILRKIDPKNKYIVKNMIGQSVYYAIEDSNQCLRWCCGTKRPSNIFVYDKSDSVVLKIEHPXXXXXXXXXXXXXXXXXXXXXXTTGSDQVLGYIQEINNCGFIVYFILDENSKLLLILKGPHYCHGCCSSRSDFSFKIMDNTGKVEIGAITNSWRCWTQEWLSNSENFGVQFPIDXXXXXXXXXXXXTFFIDFLYFERIN 803
            MTKAVVKNCIPGLEYLTQLDSVLVKRMMNWIEILRKIDPKNKYIVKNMIGQSVYYAIEDSNQCLRWCCGTKRPSNIFVYDKSDSVVLKIEHPFQNNCFNISCICCKCCRNQIKITTGSDQVLGYIQEINNCGFIVYFILDENSKLLLILKGPHYCHGCCSSRSDFSFKIMDNTGKVEIGAITNSWRCWTQEWLSNSENFGVQFPIDLAVNVKALALAATFFIDFLYFERIN
Sbjct:    1 MTKAVVKNCIPGLEYLTQLDSVLVKRMMNWIEILRKIDPKNKYIVKNMIGQSVYYAIEDSNQCLRWCCGTKRPSNIFVYDKSDSVVLKIEHPFQNNCFNISCICCKCCRNQIKITTGSDQVLGYIQEINNCGFIVYFILDENSKLLLILKGPHYCHGCCSSRSDFSFKIMDNTGKVEIGAITNSWRCWTQEWLSNSENFGVQFPIDLAVNVKALALAATFFIDFLYFERIN 231          
BLAST of Phospholipid scramblase vs. Planmine SMEST
Match: SMESG000050656.1 (SMESG000050656.1)

HSP 1 Score: 177.178 bits (448), Expect = 7.157e-54
Identity = 102/245 (41.63%), Postives = 154/245 (62.86%), Query Frame = 3
Query:   69 RPPVIEICRDKGEWMTKAVVKNCIPGLEYLTQLDSVLVKRMMNWIEILRKIDPKNKYIVKNMIGQSVYYAIEDSNQCLRWCCGTKRPSNIFVYDKSDSVVLKIEHPXXXXXXXXXXXXXXXXXXXXXXTTGSDQVLGYIQEINNCGFIVYFILDENSKLLLILKGPHYCHGCCSSRSDFSFKIMDNTGKVEIGAITNSWRCWTQEWLSNSENFGVQFPIDXXXXXXXXXXXXTFFIDFLYFERIN 803
            R P  +  + +  W+T  VV  C PGLEYLTQ++ +LVK++ + IE+  + D  NKY+V N++GQSV+YA E++  C+R+ CG+ R   I+VYD S+ VV++I  P + +     C C KC R+++++     +V+GY++++     + Y ILD++  ++L L GPHYC   C    D+   +M   G +EIG IT  W  W QE  + ++NFGVQFP+DL V  KA+ LAA F IDF+YFE  N
Sbjct:    6 RNPQRQQQQARVTWVTAPVVPGCPPGLEYLTQINQLLVKQLFDLIEVFTEYDTNNKYLVNNILGQSVFYAKEENGCCMRYWCGSNRSFVIYVYDNSNQVVMEIRRPLKCHYMGPCCNCSKCSRDELEVQAPPGEVIGYVKQLYEGCQVRYAILDKDKNIILRLHGPHYCFCYCPG-DDYPVGVMTANGDLEIGKITKQWSGWAQELYTTADNFGVQFPMDLDVKYKAIVLAAVFLIDFMYFENKN 249          
BLAST of Phospholipid scramblase vs. Planmine SMEST
Match: SMESG000050651.1 (SMESG000050651.1)

HSP 1 Score: 140.584 bits (353), Expect = 4.419e-39
Identity = 84/233 (36.05%), Postives = 139/233 (59.66%), Query Frame = 3
Query:  105 EWMTKAVVKNCIPGLEYLTQLDSVLVKRMMNWIEILRKIDPKNKYIVKNMIGQSVYYAIEDSNQCLRWCCGTKRPSNIFVYDKSDSVVLKIEHPXXXXXXXXXXXXXXXXXXXXXXTTGSDQVLGYIQEINNCGFIVYFILDENSKLLLILKGPHYCHGCCSSRSDFSFKIMDNTGKVEIGAITNSWRCWTQEWLSNSENFGVQFPIDXXXXXXXXXXXXTFFIDFLYFERIN 803
            +WM++  V  C  GLEYLT +D +L+ + +   EIL   +  N+YI+KN+ GQ +YYA ED++ C+R   G  RP  I V D  +  V++I  P   NC      C +CC++++++     Q++GY++++     I Y I +EN +++L L GP Y   C     DF  K++   G VE+G ++  W    +E  ++++NFG+QFP+DL V +KA+ + + F +DF+YFE+ N
Sbjct:   89 QWMSRPEVVGCPIGLEYLTLIDQLLIHQQVELFEILSGYETNNRYILKNIFGQKIYYAKEDTDCCIRNLTGPNRPFVIHVSDYLNHEVIQIRRPCTCNCCGQCFSCSECCQDEVQVEAPPGQIVGYVKQLYEGCEIRYSISNENREIVLRLHGPSY-FKCYCPGDDFPLKLLSADGSVELGKVSKQWSNLVRELFTDADNFGIQFPMDLDVKIKAVIIGSVFLLDFMYFEQAN 320          
BLAST of Phospholipid scramblase vs. Planmine SMEST
Match: SMESG000050651.1 (SMESG000050651.1)

HSP 1 Score: 137.502 bits (345), Expect = 9.820e-39
Identity = 83/231 (35.93%), Postives = 137/231 (59.31%), Query Frame = 3
Query:  111 MTKAVVKNCIPGLEYLTQLDSVLVKRMMNWIEILRKIDPKNKYIVKNMIGQSVYYAIEDSNQCLRWCCGTKRPSNIFVYDKSDSVVLKIEHPXXXXXXXXXXXXXXXXXXXXXXTTGSDQVLGYIQEINNCGFIVYFILDENSKLLLILKGPHYCHGCCSSRSDFSFKIMDNTGKVEIGAITNSWRCWTQEWLSNSENFGVQFPIDXXXXXXXXXXXXTFFIDFLYFERIN 803
            M++  V  C  GLEYLT +D +L+ + +   EIL   +  N+YI+KN+ GQ +YYA ED++ C+R   G  RP  I V D  +  V++I  P   NC      C +CC++++++     Q++GY++++     I Y I +EN +++L L GP Y   C     DF  K++   G VE+G ++  W    +E  ++++NFG+QFP+DL V +KA+ + + F +DF+YFE+ N
Sbjct:    1 MSRPEVVGCPIGLEYLTLIDQLLIHQQVELFEILSGYETNNRYILKNIFGQKIYYAKEDTDCCIRNLTGPNRPFVIHVSDYLNHEVIQIRRPCTCNCCGQCFSCSECCQDEVQVEAPPGQIVGYVKQLYEGCEIRYSISNENREIVLRLHGPSY-FKCYCPGDDFPLKLLSADGSVELGKVSKQWSNLVRELFTDADNFGIQFPMDLDVKIKAVIIGSVFLLDFMYFEQAN 230          
BLAST of Phospholipid scramblase vs. Planmine SMEST
Match: SMESG000043802.1 (SMESG000043802.1)

HSP 1 Score: 122.479 bits (306), Expect = 1.138e-31
Identity = 80/233 (34.33%), Postives = 126/233 (54.08%), Query Frame = 3
Query:  108 WMTKAV-VKNCIPGLEYLTQLDSVLVKRMMNWIEILRKIDPKNKYIVKNMIGQSVYYAIEDSNQCLRWCCGTKRPSNIFVYDKSDSVVLKI--EHPXXXXXXXXXXXXXXXXXXXXXXTTGSDQVLGYIQEINNCGFIVYFILDENSKLLLILKGPH-YCHGCCSSRSDFSFKIMDNTGKVEIGAITNSWRCWTQEWLSNSENFGVQFPIDXXXXXXXXXXXXTFFIDFLYFE 794
            WM +   V  C PGLEYLT +D +LV + +  +E+    + KNKY +KN +GQ VYYA E+S+ C R CCG +R   + + D   + V++   E           C     C  ++ +     Q +G + + ++C    Y I + + + +L ++GP   C G C +  D  FK+  +    E+G I+  W  +  E+ ++++NFGV FPIDL V +KA  LAA F IDF++FE
Sbjct:  170 WMQRPPQVVGCPPGLEYLTMVDQILVHQQIELLEVFTNWETKNKYQIKNSLGQQVYYAAEESDVCARQCCGPQRGFVMHITDNMGTEVIRAMREFKCCAGPCCHCCAGIDMCAQELTVEAPPGQAIGRVIQQSSCLEPSYAIQNADEETMLQIRGPICICQGPCCTW-DQEFKVFSSDMSTELGRISKQWSGFVHEYFTDADNFGVSFPIDLDVKMKATMLAAVFLIDFMFFE 401          
The following BLAST results are available for this feature:
BLAST of Phospholipid scramblase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PLSCR13.041e-3032.17phospholipid scramblase 1 [Source:HGNC Symbol;Acc:... [more]
PLSCR13.782e-3032.17phospholipid scramblase 1 [Source:HGNC Symbol;Acc:... [more]
PLSCR21.532e-2531.51phospholipid scramblase 2 [Source:HGNC Symbol;Acc:... [more]
PLSCR21.532e-2531.51phospholipid scramblase 2 [Source:HGNC Symbol;Acc:... [more]
PLSCR23.120e-2531.51phospholipid scramblase 2 [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Phospholipid scramblase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
scrm-22.967e-3133.07Phospholipid scramblase [Source:UniProtKB/TrEMBL;... [more]
scrm-14.937e-2835.19Phospholipid scramblase [Source:UniProtKB/TrEMBL;... [more]
scrm-15.150e-2835.19Phospholipid scramblase [Source:UniProtKB/TrEMBL;... [more]
scrm-15.150e-2835.19Phospholipid scramblase [Source:UniProtKB/TrEMBL;... [more]
scrm-16.091e-2835.19Phospholipid scramblase [Source:UniProtKB/TrEMBL;... [more]
back to top
BLAST of Phospholipid scramblase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
scramb19.255e-2832.59gene:FBgn0052056 transcript:FBtr0076302[more]
scramb18.478e-2732.59gene:FBgn0052056 transcript:FBtr0076303[more]
scramb17.485e-2632.20gene:FBgn0052056 transcript:FBtr0076301[more]
scramb23.297e-2333.48gene:FBgn0035390 transcript:FBtr0073005[more]
back to top
BLAST of Phospholipid scramblase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch73-206p6.12.856e-3033.63si:ch73-206p6.1 [Source:ZFIN;Acc:ZDB-GENE-030131-5... [more]
plscr3b6.493e-2831.00phospholipid scramblase 3b [Source:ZFIN;Acc:ZDB-GE... [more]
plscr3b6.493e-2831.00phospholipid scramblase 3b [Source:ZFIN;Acc:ZDB-GE... [more]
si:ch211-71m22.51.923e-2632.43si:ch211-71m22.5 [Source:ZFIN;Acc:ZDB-GENE-130531-... [more]
si:ch211-71m22.56.753e-2632.43si:ch211-71m22.5 [Source:ZFIN;Acc:ZDB-GENE-130531-... [more]
back to top
BLAST of Phospholipid scramblase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
insyn13.059e-3437.95inhibitory synaptic factor 1 [Source:Xenbase;Acc:X... [more]
insyn13.062e-3437.95inhibitory synaptic factor 1 [Source:Xenbase;Acc:X... [more]
ENSXETT00000012543.11.661e-2732.03phospholipid scramblase 2 [Source:NCBI gene;Acc:10... [more]
kpna63.755e-824.26karyopherin alpha 6 (importin alpha 7) [Source:Xen... [more]
kpna65.483e-824.26karyopherin alpha 6 (importin alpha 7) [Source:Xen... [more]
back to top
BLAST of Phospholipid scramblase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Plscr16.245e-3033.49phospholipid scramblase 1 [Source:MGI Symbol;Acc:M... [more]
Plscr16.245e-3033.49phospholipid scramblase 1 [Source:MGI Symbol;Acc:M... [more]
Plscr22.986e-2932.03phospholipid scramblase 2 [Source:MGI Symbol;Acc:M... [more]
Plscr22.986e-2932.03phospholipid scramblase 2 [Source:MGI Symbol;Acc:M... [more]
Plscr32.148e-2532.42phospholipid scramblase 3 [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Phospholipid scramblase vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q3ZBG9|PLS2_BOVIN2.139e-3033.04Phospholipid scramblase 2 OS=Bos taurus OX=9913 GN... [more]
sp|O15162|PLS1_HUMAN1.816e-2932.17Phospholipid scramblase 1 OS=Homo sapiens OX=9606 ... [more]
sp|P58195|PLS1_RAT2.964e-2933.64Phospholipid scramblase 1 OS=Rattus norvegicus OX=... [more]
sp|Q9JJ00|PLS1_MOUSE4.368e-2933.49Phospholipid scramblase 1 OS=Mus musculus OX=10090... [more]
sp|Q9DCW2|PLS2_MOUSE2.089e-2832.03Phospholipid scramblase 2 OS=Mus musculus OX=10090... [more]
back to top
BLAST of Phospholipid scramblase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|203753441.582e-4338.63tr|G7YRN6|G7YRN6_CLOSI Phospholipid scramblase OS=... [more]
gnl|BL_ORD_ID|204159361.156e-4139.04tr|A0A3R7GRQ5|A0A3R7GRQ5_CLOSI Phospholipid scramb... [more]
gnl|BL_ORD_ID|214209501.472e-4138.60tr|A0A075A1P0|A0A075A1P0_9TREM Phospholipid scramb... [more]
gnl|BL_ORD_ID|161800418.227e-4039.47tr|A0A4S2LVZ8|A0A4S2LVZ8_OPIFE Phospholipid scramb... [more]
gnl|BL_ORD_ID|229213083.115e-3935.41tr|A0A4S2LUZ8|A0A4S2LUZ8_OPIFE Phospholipid scramb... [more]
back to top
BLAST of Phospholipid scramblase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-71m22.12.044e-2932.74phospholipid scramblase 1-like [Source:NCBI gene;A... [more]
si:ch73-206p6.12.489e-2932.74phospholipid scramblase 1 [Source:NCBI gene;Acc:10... [more]
plscr3b7.405e-2831.67phospholipid scramblase 2-like [Source:NCBI gene;A... [more]
plscr3b7.405e-2831.67phospholipid scramblase 2-like [Source:NCBI gene;A... [more]
si:ch211-71m22.57.862e-2634.72si:ch211-71m22.5 [Source:ZFIN;Acc:ZDB-GENE-130531-... [more]
back to top
BLAST of Phospholipid scramblase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Phospholipid scramblase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Phospholipid scramblase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO315121.062e-3234.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO461092.404e-2228.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Phospholipid scramblase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
plscr3b3.585e-2832.58phospholipid scramblase 2 [Source:NCBI gene;Acc:10... [more]
plscr3b3.585e-2832.58phospholipid scramblase 2 [Source:NCBI gene;Acc:10... [more]
si:ch73-206p6.11.233e-2430.88phospholipid scramblase 1 [Source:NCBI gene;Acc:10... [more]
si:ch73-206p6.11.233e-2430.88phospholipid scramblase 1 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Phospholipid scramblase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000050116.12.156e-140100.00SMESG000050116.1[more]
SMESG000050656.17.157e-5441.63SMESG000050656.1[more]
SMESG000050651.14.419e-3936.05SMESG000050651.1[more]
SMESG000050651.19.820e-3935.93SMESG000050651.1[more]
SMESG000043802.11.138e-3134.33SMESG000043802.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011854 ID=SMED30011854|Name=Phospholipid scramblase|organism=Schmidtea mediterranea sexual|type=transcript|length=950bp
TTTCATTTGAGTGTCATTGTTAAAAAGAAACAAATTATTTTGTTAATACA
GTTTCAAAGACTATGAAAAGGCCTCCCGTTATTGAAATATGTCGAGATAA
AGGAGAATGGATGACAAAGGCGGTAGTGAAAAATTGCATTCCTGGACTGG
AGTATTTGACTCAATTAGACAGTGTTCTGGTTAAAAGAATGATGAACTGG
ATAGAAATTTTAAGAAAAATCGACCCGAAAAATAAATATATTGTGAAAAA
TATGATTGGCCAATCTGTTTATTATGCTATAGAAGATTCGAATCAATGTC
TAAGATGGTGTTGTGGGACAAAACGACCTTCCAACATTTTTGTCTATGAC
AAAAGTGATTCCGTTGTACTGAAAATTGAGCATCCCTTCCAAAACAATTG
CTTCAACATCAGTTGTATTTGCTGTAAGTGCTGTAGAAATCAAATAAAGA
TCACTACAGGATCCGATCAAGTGCTAGGATATATTCAAGAGATTAACAAC
TGCGGATTCATTGTTTACTTTATTTTAGACGAAAATTCAAAGCTTTTATT
GATATTGAAAGGGCCACATTATTGTCATGGCTGTTGCAGTTCACGGAGTG
ACTTTTCATTTAAGATCATGGATAACACTGGTAAAGTTGAGATTGGGGCG
ATAACTAATTCATGGAGATGTTGGACTCAAGAATGGCTATCAAACTCTGA
AAATTTCGGAGTTCAATTCCCAATAGATCTCGCGGTGAATGTTAAAGCTT
TGGCACTCGCAGCAACTTTTTTTATAGACTTTCTTTACTTCGAAAGAATA
AATTGACCAGAAATTTTATCAAAATTTCCAAATACATCCTTACAAATAAA
TATAATTTCTGTTGCGTACATATTGGAAAAGCCATGTGTTAACTGAAAGA
TTTGTCGCTAATTTTGTCGACTAAATATTTTTATAGTAATATTTCAGTGT
back to top

protein sequence of SMED30011854-orf-1

>SMED30011854-orf-1 ID=SMED30011854-orf-1|Name=SMED30011854-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=248bp
MKRPPVIEICRDKGEWMTKAVVKNCIPGLEYLTQLDSVLVKRMMNWIEIL
RKIDPKNKYIVKNMIGQSVYYAIEDSNQCLRWCCGTKRPSNIFVYDKSDS
VVLKIEHPFQNNCFNISCICCKCCRNQIKITTGSDQVLGYIQEINNCGFI
VYFILDENSKLLLILKGPHYCHGCCSSRSDFSFKIMDNTGKVEIGAITNS
WRCWTQEWLSNSENFGVQFPIDLAVNVKALALAATFFIDFLYFERIN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR005552Scramblase
Vocabulary: cellular component
TermDefinition
GO:0005886plasma membrane
Vocabulary: biological process
TermDefinition
GO:0017121phospholipid scrambling
Vocabulary: molecular function
TermDefinition
GO:0017128phospholipid scramblase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR005552ScramblasePFAMPF03803Scramblasecoord: 19..245
e-value: 2.8E-50
score: 170.7
IPR005552ScramblasePANTHERPTHR23248PHOSPHOLIPID SCRAMBLASE-RELATEDcoord: 13..245