Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16

Overview
NamePre-mRNA-splicing factor ATP-dependent RNA helicase DHX16
Smed IDSMED30011852
Length (bp)2717
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 (SMED30011852) t-SNE clustered cells

Violin plots show distribution of expression levels for Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 (SMED30011852) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 (SMED30011852) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 (SMED30011852) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011852

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30011852h1SMcG0007280 SmedASXL_015555SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30011852h1SMcG0007280 SmedASXL_015555SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 vs. Ensembl Human
Match: DHX16 (DEAH-box helicase 16 [Source:HGNC Symbol;Acc:HGNC:2739])

HSP 1 Score: 815.839 bits (2106), Expect = 0.000e+0
Identity = 426/887 (48.03%), Postives = 609/887 (68.66%), Query Frame = 3
Query:   90 RENNKKTSEDEEHLTEKQRIKE------YSQRISEKEKSKNKNYVSGQTNEKKFRSQA-----MKYRDNETVTENIRIKSRQEYLLKRKADKIEDLHYDLIEDELYFKKEELTNRELKEKEAKKMI------YKVAKMQEKSVKKVNEKYYTIPS---NDSTIVMNVTEERKKSRKGGLNEWETLQLKNAIDQ--GKVSRRQDDEYELLVDEFVDYEQEETLIPQNPEELTEKVIEKIDEKDLAISQVQKLLPIYRLKNELIKMIAENQIVVIEGETGSGKTTQIPQYLYEAGYCVEDKIIGCTQPXXXXXXXXXXXXXQEMNVKLGDKVGYSVRFEAKVSEQTQIKYMTDGMLLREFLNDPTVGMYSVLIIDEAHERTLQTDILFGLLSAVTEVRKDLKIIISSATCDVEKFCQFFE-APFFKIPGRRYPVETFYTKDQEADFVEAAVVTILQIHITQSDGDILVFLTGQEDIEEAMDSLQERIKALGTKIRELIVLPIYSALPSEKQAKIFLPTPPGARKVVLATNIAETSLTIDGIRFVIDCGYCKVKCYDPRSRMDSLKVVPITKANAIQRSGRAGRIAPGKCFRLYKKYTFDEEFEDQAIPEIQRTNLGNVVLLLKSLGIEDILDFDYMDPPFEKSLLAAIEELYYLSAIDSKGGLSLIGRKMVEIPCDPMISNMILKSEKYGCSEEIITIAAMLSLDNTIFYSPKNKKLYASQAHRAFMQEEGDHLTLLKVYNEYANNDYSSDWCKDNYIQSRSMKMARNIRDQLVNLADRLELKLISNSEDTVGICKAITAGFFLNTARFNGDSYRRIKSKDSVYMQMNSVFRILDEHPRYVVFNNIVNTTKEYMRTCTRIEPRWLTDIAPHIYKDIDFEGDSKYKRMPK 2681
            ++  K  SEDE   TE++R+++      +++R+ +++K + +N +  + ++KK   +A     M   D + +   +R KSR+EYL KR+ +K+EDL  +L ++E  F   EL+  E +E + K+ +      Y+ A  QEK ++  N   Y +P          +++ EE   +       WE  +L  A  +   + +  Q+ +Y+L+++E    E       Q  EE +        ++  +I  V++ LP++  + EL+  IA +Q+++IEGETGSGKTTQIPQYL+E GY  +   I CTQPRRVAAMSVA+RVA+EM VKLG++VGYS+RFE   SE+T ++YMTDGMLLREFL++P +  YSV+++DEAHERTL TDILFGL+  V   R +LK++++SAT D  +F  FF+ AP F+IPGRR+PV+ FYTK  EAD++EA VV++LQIH+TQ  GDILVFLTGQE+IE A + LQ+R + LG+KIREL+VLPIY+ LPS+ QA+IF PTPPGARKVV+ATNIAETSLTI+GI +V+D G+CK K Y+PR+ M+SL V P +KA+A QR+GRAGR+A GKCFRLY  + +  E E+  +PEIQRT+LGNVVLLLKSLGI D++ FD++DPP  ++LL A+E+LY L A++  G L+  GRKM E+P DPM+S MIL SEKY CSEEI+T+AAMLS++N+IFY PK+K ++A  A   F    GDHL LL VY ++A + YSS WC +N++Q RSM+ AR++R+QL  L +R+E+ L S   D + + KAITAG+F +TAR     YR +K + +V++  NS   + ++ PR+++++ +V TTKE+MR    IE  WL ++APH YK  + E D   K+MPK
Sbjct:  153 QQTEKPESEDEWERTERERLQDLEERDAFAERVRQRDKDRTRNVL--ERSDKKAYEEAQKRLKMAEEDRKAMVPELRKKSRREYLAKREREKLEDLEAELADEEFLFGDVELSRHERQELKYKRRVRDLAREYRAAGEQEK-LEATNR--YHMPKETRGQPARAVDLVEEESGAPGEEQRRWEEARLGAASLKFGARDAASQEPKYQLVLEEEETIEFVRATQLQGDEEPSAPPTSTQAQQKESIQAVRRSLPVFPFREELLAAIANHQVLIIEGETGSGKTTQIPQYLFEEGYTNKGMKIACTQPRRVAAMSVAARVAREMGVKLGNEVGYSIRFEDCTSERTVLRYMTDGMLLREFLSEPDLASYSVVMVDEAHERTLHTDILFGLIKDVARFRPELKVLVASATMDTARFSTFFDDAPVFRIPGRRFPVDIFYTKAPEADYLEACVVSVLQIHVTQPPGDILVFLTGQEEIEAACEMLQDRCRRLGSKIRELLVLPIYANLPSDMQARIFQPTPPGARKVVVATNIAETSLTIEGIIYVLDPGFCKQKSYNPRTGMESLTVTPCSKASANQRAGRAGRVAAGKCFRLYTAWAYQHELEETTVPEIQRTSLGNVVLLLKSLGIHDLMHFDFLDPPPYETLLLALEQLYALGALNHLGELTTSGRKMAELPVDPMLSKMILASEKYSCSEEILTVAAMLSVNNSIFYRPKDKVVHADNARVNFFLPGGDHLVLLNVYTQWAESGYSSQWCYENFVQFRSMRRARDVREQLEGLLERVEVGLSSCQGDYIRVRKAITAGYFYHTARLTRSGYRTVKQQQTVFIHPNS--SLFEQQPRWLLYHELVLTTKEFMRQVLEIESSWLLEVAPHYYKAKELE-DPHAKKMPK 1031          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 vs. Ensembl Human
Match: DHX16 (DEAH-box helicase 16 [Source:HGNC Symbol;Acc:HGNC:2739])

HSP 1 Score: 815.839 bits (2106), Expect = 0.000e+0
Identity = 426/887 (48.03%), Postives = 609/887 (68.66%), Query Frame = 3
Query:   90 RENNKKTSEDEEHLTEKQRIKE------YSQRISEKEKSKNKNYVSGQTNEKKFRSQA-----MKYRDNETVTENIRIKSRQEYLLKRKADKIEDLHYDLIEDELYFKKEELTNRELKEKEAKKMI------YKVAKMQEKSVKKVNEKYYTIPS---NDSTIVMNVTEERKKSRKGGLNEWETLQLKNAIDQ--GKVSRRQDDEYELLVDEFVDYEQEETLIPQNPEELTEKVIEKIDEKDLAISQVQKLLPIYRLKNELIKMIAENQIVVIEGETGSGKTTQIPQYLYEAGYCVEDKIIGCTQPXXXXXXXXXXXXXQEMNVKLGDKVGYSVRFEAKVSEQTQIKYMTDGMLLREFLNDPTVGMYSVLIIDEAHERTLQTDILFGLLSAVTEVRKDLKIIISSATCDVEKFCQFFE-APFFKIPGRRYPVETFYTKDQEADFVEAAVVTILQIHITQSDGDILVFLTGQEDIEEAMDSLQERIKALGTKIRELIVLPIYSALPSEKQAKIFLPTPPGARKVVLATNIAETSLTIDGIRFVIDCGYCKVKCYDPRSRMDSLKVVPITKANAIQRSGRAGRIAPGKCFRLYKKYTFDEEFEDQAIPEIQRTNLGNVVLLLKSLGIEDILDFDYMDPPFEKSLLAAIEELYYLSAIDSKGGLSLIGRKMVEIPCDPMISNMILKSEKYGCSEEIITIAAMLSLDNTIFYSPKNKKLYASQAHRAFMQEEGDHLTLLKVYNEYANNDYSSDWCKDNYIQSRSMKMARNIRDQLVNLADRLELKLISNSEDTVGICKAITAGFFLNTARFNGDSYRRIKSKDSVYMQMNSVFRILDEHPRYVVFNNIVNTTKEYMRTCTRIEPRWLTDIAPHIYKDIDFEGDSKYKRMPK 2681
            ++  K  SEDE   TE++R+++      +++R+ +++K + +N +  + ++KK   +A     M   D + +   +R KSR+EYL KR+ +K+EDL  +L ++E  F   EL+  E +E + K+ +      Y+ A  QEK ++  N   Y +P          +++ EE   +       WE  +L  A  +   + +  Q+ +Y+L+++E    E       Q  EE +        ++  +I  V++ LP++  + EL+  IA +Q+++IEGETGSGKTTQIPQYL+E GY  +   I CTQPRRVAAMSVA+RVA+EM VKLG++VGYS+RFE   SE+T ++YMTDGMLLREFL++P +  YSV+++DEAHERTL TDILFGL+  V   R +LK++++SAT D  +F  FF+ AP F+IPGRR+PV+ FYTK  EAD++EA VV++LQIH+TQ  GDILVFLTGQE+IE A + LQ+R + LG+KIREL+VLPIY+ LPS+ QA+IF PTPPGARKVV+ATNIAETSLTI+GI +V+D G+CK K Y+PR+ M+SL V P +KA+A QR+GRAGR+A GKCFRLY  + +  E E+  +PEIQRT+LGNVVLLLKSLGI D++ FD++DPP  ++LL A+E+LY L A++  G L+  GRKM E+P DPM+S MIL SEKY CSEEI+T+AAMLS++N+IFY PK+K ++A  A   F    GDHL LL VY ++A + YSS WC +N++Q RSM+ AR++R+QL  L +R+E+ L S   D + + KAITAG+F +TAR     YR +K + +V++  NS   + ++ PR+++++ +V TTKE+MR    IE  WL ++APH YK  + E D   K+MPK
Sbjct:  153 QQTEKPESEDEWERTERERLQDLEERDAFAERVRQRDKDRTRNVL--ERSDKKAYEEAQKRLKMAEEDRKAMVPELRKKSRREYLAKREREKLEDLEAELADEEFLFGDVELSRHERQELKYKRRVRDLAREYRAAGEQEK-LEATNR--YHMPKETRGQPARAVDLVEEESGAPGEEQRRWEEARLGAASLKFGARDAASQEPKYQLVLEEEETIEFVRATQLQGDEEPSAPPTSTQAQQKESIQAVRRSLPVFPFREELLAAIANHQVLIIEGETGSGKTTQIPQYLFEEGYTNKGMKIACTQPRRVAAMSVAARVAREMGVKLGNEVGYSIRFEDCTSERTVLRYMTDGMLLREFLSEPDLASYSVVMVDEAHERTLHTDILFGLIKDVARFRPELKVLVASATMDTARFSTFFDGAPVFRIPGRRFPVDIFYTKAPEADYLEACVVSVLQIHVTQPPGDILVFLTGQEEIEAACEMLQDRCRRLGSKIRELLVLPIYANLPSDMQARIFQPTPPGARKVVVATNIAETSLTIEGIIYVLDPGFCKQKSYNPRTGMESLTVTPCSKASANQRAGRAGRVAAGKCFRLYTAWAYQHELEETTVPEIQRTSLGNVVLLLKSLGIHDLMHFDFLDPPPYETLLLALEQLYALGALNHLGELTTSGRKMAELPVDPMLSKMILASEKYSCSEEILTVAAMLSVNNSIFYRPKDKVVHADNARVNFFLPGGDHLVLLNVYTQWAESGYSSQWCYENFVQFRSMRRARDVREQLEGLLERVEVGLSSCQGDYIRVRKAITAGYFYHTARLTRSGYRTVKQQQTVFIHPNS--SLFEQQPRWLLYHELVLTTKEFMRQVLEIESSWLLEVAPHYYKAKELE-DPHAKKMPK 1031          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 vs. Ensembl Human
Match: DHX16 (DEAH-box helicase 16 [Source:HGNC Symbol;Acc:HGNC:2739])

HSP 1 Score: 815.839 bits (2106), Expect = 0.000e+0
Identity = 426/887 (48.03%), Postives = 609/887 (68.66%), Query Frame = 3
Query:   90 RENNKKTSEDEEHLTEKQRIKE------YSQRISEKEKSKNKNYVSGQTNEKKFRSQA-----MKYRDNETVTENIRIKSRQEYLLKRKADKIEDLHYDLIEDELYFKKEELTNRELKEKEAKKMI------YKVAKMQEKSVKKVNEKYYTIPS---NDSTIVMNVTEERKKSRKGGLNEWETLQLKNAIDQ--GKVSRRQDDEYELLVDEFVDYEQEETLIPQNPEELTEKVIEKIDEKDLAISQVQKLLPIYRLKNELIKMIAENQIVVIEGETGSGKTTQIPQYLYEAGYCVEDKIIGCTQPXXXXXXXXXXXXXQEMNVKLGDKVGYSVRFEAKVSEQTQIKYMTDGMLLREFLNDPTVGMYSVLIIDEAHERTLQTDILFGLLSAVTEVRKDLKIIISSATCDVEKFCQFFE-APFFKIPGRRYPVETFYTKDQEADFVEAAVVTILQIHITQSDGDILVFLTGQEDIEEAMDSLQERIKALGTKIRELIVLPIYSALPSEKQAKIFLPTPPGARKVVLATNIAETSLTIDGIRFVIDCGYCKVKCYDPRSRMDSLKVVPITKANAIQRSGRAGRIAPGKCFRLYKKYTFDEEFEDQAIPEIQRTNLGNVVLLLKSLGIEDILDFDYMDPPFEKSLLAAIEELYYLSAIDSKGGLSLIGRKMVEIPCDPMISNMILKSEKYGCSEEIITIAAMLSLDNTIFYSPKNKKLYASQAHRAFMQEEGDHLTLLKVYNEYANNDYSSDWCKDNYIQSRSMKMARNIRDQLVNLADRLELKLISNSEDTVGICKAITAGFFLNTARFNGDSYRRIKSKDSVYMQMNSVFRILDEHPRYVVFNNIVNTTKEYMRTCTRIEPRWLTDIAPHIYKDIDFEGDSKYKRMPK 2681
            ++  K  SEDE   TE++R+++      +++R+ +++K + +N +  + ++KK   +A     M   D + +   +R KSR+EYL KR+ +K+EDL  +L ++E  F   EL+  E +E + K+ +      Y+ A  QEK ++  N   Y +P          +++ EE   +       WE  +L  A  +   + +  Q+ +Y+L+++E    E       Q  EE +        ++  +I  V++ LP++  + EL+  IA +Q+++IEGETGSGKTTQIPQYL+E GY  +   I CTQPRRVAAMSVA+RVA+EM VKLG++VGYS+RFE   SE+T ++YMTDGMLLREFL++P +  YSV+++DEAHERTL TDILFGL+  V   R +LK++++SAT D  +F  FF+ AP F+IPGRR+PV+ FYTK  EAD++EA VV++LQIH+TQ  GDILVFLTGQE+IE A + LQ+R + LG+KIREL+VLPIY+ LPS+ QA+IF PTPPGARKVV+ATNIAETSLTI+GI +V+D G+CK K Y+PR+ M+SL V P +KA+A QR+GRAGR+A GKCFRLY  + +  E E+  +PEIQRT+LGNVVLLLKSLGI D++ FD++DPP  ++LL A+E+LY L A++  G L+  GRKM E+P DPM+S MIL SEKY CSEEI+T+AAMLS++N+IFY PK+K ++A  A   F    GDHL LL VY ++A + YSS WC +N++Q RSM+ AR++R+QL  L +R+E+ L S   D + + KAITAG+F +TAR     YR +K + +V++  NS   + ++ PR+++++ +V TTKE+MR    IE  WL ++APH YK  + E D   K+MPK
Sbjct:  153 QQTEKPESEDEWERTERERLQDLEERDAFAERVRQRDKDRTRNVL--ERSDKKAYEEAQKRLKMAEEDRKAMVPELRKKSRREYLAKREREKLEDLEAELADEEFLFGDVELSRHERQELKYKRRVRDLAREYRAAGEQEK-LEATNR--YHMPKETRGQPARAVDLVEEESGAPGEEQRRWEEARLGAASLKFGARDAASQEPKYQLVLEEEETIEFVRATQLQGDEEPSAPPTSTQAQQKESIQAVRRSLPVFPFREELLAAIANHQVLIIEGETGSGKTTQIPQYLFEEGYTNKGMKIACTQPRRVAAMSVAARVAREMGVKLGNEVGYSIRFEDCTSERTVLRYMTDGMLLREFLSEPDLASYSVVMVDEAHERTLHTDILFGLIKDVARFRPELKVLVASATMDTARFSTFFDDAPVFRIPGRRFPVDIFYTKAPEADYLEACVVSVLQIHVTQPPGDILVFLTGQEEIEAACEMLQDRCRRLGSKIRELLVLPIYANLPSDMQARIFQPTPPGARKVVVATNIAETSLTIEGIIYVLDPGFCKQKSYNPRTGMESLTVTPCSKASANQRAGRAGRVAAGKCFRLYTAWAYQHELEETTVPEIQRTSLGNVVLLLKSLGIHDLMHFDFLDPPPYETLLLALEQLYALGALNHLGELTTSGRKMAELPVDPMLSKMILASEKYSCSEEILTVAAMLSVNNSIFYRPKDKVVHADNARVNFFLPGGDHLVLLNVYTQWAESGYSSQWCYENFVQFRSMRRARDVREQLEGLLERVEVGLSSCQGDYIRVRKAITAGYFYHTARLTRSGYRTVKQQQTVFIHPNS--SLFEQQPRWLLYHELVLTTKEFMRQVLEIESSWLLEVAPHYYKAKELE-DPHAKKMPK 1031          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 vs. Ensembl Human
Match: DHX16 (DEAH-box helicase 16 [Source:HGNC Symbol;Acc:HGNC:2739])

HSP 1 Score: 815.839 bits (2106), Expect = 0.000e+0
Identity = 426/887 (48.03%), Postives = 609/887 (68.66%), Query Frame = 3
Query:   90 RENNKKTSEDEEHLTEKQRIKE------YSQRISEKEKSKNKNYVSGQTNEKKFRSQA-----MKYRDNETVTENIRIKSRQEYLLKRKADKIEDLHYDLIEDELYFKKEELTNRELKEKEAKKMI------YKVAKMQEKSVKKVNEKYYTIPS---NDSTIVMNVTEERKKSRKGGLNEWETLQLKNAIDQ--GKVSRRQDDEYELLVDEFVDYEQEETLIPQNPEELTEKVIEKIDEKDLAISQVQKLLPIYRLKNELIKMIAENQIVVIEGETGSGKTTQIPQYLYEAGYCVEDKIIGCTQPXXXXXXXXXXXXXQEMNVKLGDKVGYSVRFEAKVSEQTQIKYMTDGMLLREFLNDPTVGMYSVLIIDEAHERTLQTDILFGLLSAVTEVRKDLKIIISSATCDVEKFCQFFE-APFFKIPGRRYPVETFYTKDQEADFVEAAVVTILQIHITQSDGDILVFLTGQEDIEEAMDSLQERIKALGTKIRELIVLPIYSALPSEKQAKIFLPTPPGARKVVLATNIAETSLTIDGIRFVIDCGYCKVKCYDPRSRMDSLKVVPITKANAIQRSGRAGRIAPGKCFRLYKKYTFDEEFEDQAIPEIQRTNLGNVVLLLKSLGIEDILDFDYMDPPFEKSLLAAIEELYYLSAIDSKGGLSLIGRKMVEIPCDPMISNMILKSEKYGCSEEIITIAAMLSLDNTIFYSPKNKKLYASQAHRAFMQEEGDHLTLLKVYNEYANNDYSSDWCKDNYIQSRSMKMARNIRDQLVNLADRLELKLISNSEDTVGICKAITAGFFLNTARFNGDSYRRIKSKDSVYMQMNSVFRILDEHPRYVVFNNIVNTTKEYMRTCTRIEPRWLTDIAPHIYKDIDFEGDSKYKRMPK 2681
            ++  K  SEDE   TE++R+++      +++R+ +++K + +N +  + ++KK   +A     M   D + +   +R KSR+EYL KR+ +K+EDL  +L ++E  F   EL+  E +E + K+ +      Y+ A  QEK ++  N   Y +P          +++ EE   +       WE  +L  A  +   + +  Q+ +Y+L+++E    E       Q  EE +        ++  +I  V++ LP++  + EL+  IA +Q+++IEGETGSGKTTQIPQYL+E GY  +   I CTQPRRVAAMSVA+RVA+EM VKLG++VGYS+RFE   SE+T ++YMTDGMLLREFL++P +  YSV+++DEAHERTL TDILFGL+  V   R +LK++++SAT D  +F  FF+ AP F+IPGRR+PV+ FYTK  EAD++EA VV++LQIH+TQ  GDILVFLTGQE+IE A + LQ+R + LG+KIREL+VLPIY+ LPS+ QA+IF PTPPGARKVV+ATNIAETSLTI+GI +V+D G+CK K Y+PR+ M+SL V P +KA+A QR+GRAGR+A GKCFRLY  + +  E E+  +PEIQRT+LGNVVLLLKSLGI D++ FD++DPP  ++LL A+E+LY L A++  G L+  GRKM E+P DPM+S MIL SEKY CSEEI+T+AAMLS++N+IFY PK+K ++A  A   F    GDHL LL VY ++A + YSS WC +N++Q RSM+ AR++R+QL  L +R+E+ L S   D + + KAITAG+F +TAR     YR +K + +V++  NS   + ++ PR+++++ +V TTKE+MR    IE  WL ++APH YK  + E D   K+MPK
Sbjct:  153 QQTEKPESEDEWERTERERLQDLEERDAFAERVRQRDKDRTRNVL--ERSDKKAYEEAQKRLKMAEEDRKAMVPELRKKSRREYLAKREREKLEDLEAELADEEFLFGDVELSRHERQELKYKRRVRDLAREYRAAGEQEK-LEATNR--YHMPKETRGQPARAVDLVEEESGAPGEEQRRWEEARLGAASLKFGARDAASQEPKYQLVLEEEETIEFVRATQLQGDEEPSAPPTSTQAQQKESIQAVRRSLPVFPFREELLAAIANHQVLIIEGETGSGKTTQIPQYLFEEGYTNKGMKIACTQPRRVAAMSVAARVAREMGVKLGNEVGYSIRFEDCTSERTVLRYMTDGMLLREFLSEPDLASYSVVMVDEAHERTLHTDILFGLIKDVARFRPELKVLVASATMDTARFSTFFDDAPVFRIPGRRFPVDIFYTKAPEADYLEACVVSVLQIHVTQPPGDILVFLTGQEEIEAACEMLQDRCRRLGSKIRELLVLPIYANLPSDMQARIFQPTPPGARKVVVATNIAETSLTIEGIIYVLDPGFCKQKSYNPRTGMESLTVTPCSKASANQRAGRAGRVAAGKCFRLYTAWAYQHELEETTVPEIQRTSLGNVVLLLKSLGIHDLMHFDFLDPPPYETLLLALEQLYALGALNHLGELTTSGRKMAELPVDPMLSKMILASEKYSCSEEILTVAAMLSVNNSIFYRPKDKVVHADNARVNFFLPGGDHLVLLNVYTQWAESGYSSQWCYENFVQFRSMRRARDVREQLEGLLERVEVGLSSCQGDYIRVRKAITAGYFYHTARLTRSGYRTVKQQQTVFIHPNS--SLFEQQPRWLLYHELVLTTKEFMRQVLEIESSWLLEVAPHYYKAKELE-DPHAKKMPK 1031          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 vs. Ensembl Human
Match: DHX16 (DEAH-box helicase 16 [Source:HGNC Symbol;Acc:HGNC:2739])

HSP 1 Score: 815.839 bits (2106), Expect = 0.000e+0
Identity = 426/887 (48.03%), Postives = 609/887 (68.66%), Query Frame = 3
Query:   90 RENNKKTSEDEEHLTEKQRIKE------YSQRISEKEKSKNKNYVSGQTNEKKFRSQA-----MKYRDNETVTENIRIKSRQEYLLKRKADKIEDLHYDLIEDELYFKKEELTNRELKEKEAKKMI------YKVAKMQEKSVKKVNEKYYTIPS---NDSTIVMNVTEERKKSRKGGLNEWETLQLKNAIDQ--GKVSRRQDDEYELLVDEFVDYEQEETLIPQNPEELTEKVIEKIDEKDLAISQVQKLLPIYRLKNELIKMIAENQIVVIEGETGSGKTTQIPQYLYEAGYCVEDKIIGCTQPXXXXXXXXXXXXXQEMNVKLGDKVGYSVRFEAKVSEQTQIKYMTDGMLLREFLNDPTVGMYSVLIIDEAHERTLQTDILFGLLSAVTEVRKDLKIIISSATCDVEKFCQFFE-APFFKIPGRRYPVETFYTKDQEADFVEAAVVTILQIHITQSDGDILVFLTGQEDIEEAMDSLQERIKALGTKIRELIVLPIYSALPSEKQAKIFLPTPPGARKVVLATNIAETSLTIDGIRFVIDCGYCKVKCYDPRSRMDSLKVVPITKANAIQRSGRAGRIAPGKCFRLYKKYTFDEEFEDQAIPEIQRTNLGNVVLLLKSLGIEDILDFDYMDPPFEKSLLAAIEELYYLSAIDSKGGLSLIGRKMVEIPCDPMISNMILKSEKYGCSEEIITIAAMLSLDNTIFYSPKNKKLYASQAHRAFMQEEGDHLTLLKVYNEYANNDYSSDWCKDNYIQSRSMKMARNIRDQLVNLADRLELKLISNSEDTVGICKAITAGFFLNTARFNGDSYRRIKSKDSVYMQMNSVFRILDEHPRYVVFNNIVNTTKEYMRTCTRIEPRWLTDIAPHIYKDIDFEGDSKYKRMPK 2681
            ++  K  SEDE   TE++R+++      +++R+ +++K + +N +  + ++KK   +A     M   D + +   +R KSR+EYL KR+ +K+EDL  +L ++E  F   EL+  E +E + K+ +      Y+ A  QEK ++  N   Y +P          +++ EE   +       WE  +L  A  +   + +  Q+ +Y+L+++E    E       Q  EE +        ++  +I  V++ LP++  + EL+  IA +Q+++IEGETGSGKTTQIPQYL+E GY  +   I CTQPRRVAAMSVA+RVA+EM VKLG++VGYS+RFE   SE+T ++YMTDGMLLREFL++P +  YSV+++DEAHERTL TDILFGL+  V   R +LK++++SAT D  +F  FF+ AP F+IPGRR+PV+ FYTK  EAD++EA VV++LQIH+TQ  GDILVFLTGQE+IE A + LQ+R + LG+KIREL+VLPIY+ LPS+ QA+IF PTPPGARKVV+ATNIAETSLTI+GI +V+D G+CK K Y+PR+ M+SL V P +KA+A QR+GRAGR+A GKCFRLY  + +  E E+  +PEIQRT+LGNVVLLLKSLGI D++ FD++DPP  ++LL A+E+LY L A++  G L+  GRKM E+P DPM+S MIL SEKY CSEEI+T+AAMLS++N+IFY PK+K ++A  A   F    GDHL LL VY ++A + YSS WC +N++Q RSM+ AR++R+QL  L +R+E+ L S   D + + KAITAG+F +TAR     YR +K + +V++  NS   + ++ PR+++++ +V TTKE+MR    IE  WL ++APH YK  + E D   K+MPK
Sbjct:  153 QQTEKPESEDEWERTERERLQDLEERDAFAERVRQRDKDRTRNVL--ERSDKKAYEEAQKRLKMAEEDRKAMVPELRKKSRREYLAKREREKLEDLEAELADEEFLFGDVELSRHERQELKYKRRVRDLAREYRAAGEQEK-LEATNR--YHMPKETRGQPARAVDLVEEESGAPGEEQRRWEEARLGAASLKFGARDAASQEPKYQLVLEEEETIEFVRATQLQGDEEPSAPPTSTQAQQKESIQAVRRSLPVFPFREELLAAIANHQVLIIEGETGSGKTTQIPQYLFEEGYTNKGMKIACTQPRRVAAMSVAARVAREMGVKLGNEVGYSIRFEDCTSERTVLRYMTDGMLLREFLSEPDLASYSVVMVDEAHERTLHTDILFGLIKDVARFRPELKVLVASATMDTARFSTFFDDAPVFRIPGRRFPVDIFYTKAPEADYLEACVVSVLQIHVTQPPGDILVFLTGQEEIEAACEMLQDRCRRLGSKIRELLVLPIYANLPSDMQARIFQPTPPGARKVVVATNIAETSLTIEGIIYVLDPGFCKQKSYNPRTGMESLTVTPCSKASANQRAGRAGRVAAGKCFRLYTAWAYQHELEETTVPEIQRTSLGNVVLLLKSLGIHDLMHFDFLDPPPYETLLLALEQLYALGALNHLGELTTSGRKMAELPVDPMLSKMILASEKYSCSEEILTVAAMLSVNNSIFYRPKDKVVHADNARVNFFLPGGDHLVLLNVYTQWAESGYSSQWCYENFVQFRSMRRARDVREQLEGLLERVEVGLSSCQGDYIRVRKAITAGYFYHTARLTRSGYRTVKQQQTVFIHPNS--SLFEQQPRWLLYHELVLTTKEFMRQVLEIESSWLLEVAPHYYKAKELE-DPHAKKMPK 1031          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 vs. Ensembl Celegans
Match: mog-4 (Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-4 [Source:UniProtKB/Swiss-Prot;Acc:O45244])

HSP 1 Score: 823.543 bits (2126), Expect = 0.000e+0
Identity = 432/850 (50.82%), Postives = 599/850 (70.47%), Query Frame = 3
Query:  159 SQRISEKEKSKNKNYVSGQTNEKKFRSQAMKYRDNE-TVTENIRIKSRQEYLLKRKADKIEDLHYDLIEDELYFKKEELTNRELKEKEAKKMIYKVAKMQEKSVKKVNEKYYTIPSNDSTIVMN--VTEERKKSRKGGLN-EWETLQLKNAIDQ--GKVSRRQDDEYELLVDEFVDYEQEETLIPQNPEELTEKVIEKIDEKDLAISQVQKLLPIYRLKNELIKMIAENQIVVIEGETGSGKTTQIPQYLYEAGYCVEDKIIGCTQPXXXXXXXXXXXXXQEMNVKLGDKVGYSVRFEAKVSEQTQIKYMTDGMLLREFLNDPTVGMYSVLIIDEAHERTLQTDILFGLLSAVTEVRKDLKIIISSATCDVEKFCQFFE-APFFKIPGRRYPVETFYTKDQEADFVEAAVVTILQIHITQS-DGDILVFLTGQEDIEEAMDSLQERIKALGTKIRELIVLPIYSALPSEKQAKIFLPTPPGARKVVLATNIAETSLTIDGIRFVIDCGYCKVKCYDPRSRMDSLKVVPITKANAIQRSGRAGRIAPGKCFRLYKKYTFDEEFEDQAIPEIQRTNLGNVVLLLKSLGIEDILDFDYMDPPFEKSLLAAIEELYYLSAIDSKGGLSLIGRKMVEIPCDPMISNMILKSEKYGCSEEIITIAAMLSLDNTIFYSPKNKKLYASQAHRAFMQEEGDHLTLLKVYNEYANNDYSSDWCKDNYIQSRSMKMARNIRDQLVNLADRLELKLISNSEDTVGICKAITAGFFLNTARF-NGDSYRRIKSKDSVYMQMNSVFRILDEHPRYVVFNNIVNTTKEYMRTCTRIEPRWLTDIAPHIYKDIDFEGDSKYKRMPK 2681
            + RI++KEK K +N +  + ++ K         D E +  + +R +SR++YL KRK DK+E+L   + +D+  F +E+LT RE  + E +K + +  K   K+   +  K Y +P   +  + +  V ++ +  R GG   +WE  QL  ++     K ++R++ E+ELL+DE VD+ Q    +P   EE+ E   EK   K ++I + +K LP+Y  ++  I+ + E+Q+++IEGETGSGKTTQ+PQYLYEAG+C   K IGCTQPRRVAAMSVA+RVA E+  KLG +VGYS+RFE   SE+T +KYMTDGMLLREFLN+P +  YSV++IDEAHERTL TDILFGL+  +   RKDLK++ISSAT D EKF  FF+ AP F+IPGRR+PV+ +YT+  EAD+V+AA+VTI+QIH+TQ   GDILVFLTGQE+IE   ++L ER KALG+KI+ELI LP+Y+ LPS+ QAKIF PTP  ARKVVLATNIAETS+TIDGI +VID G+ K   +D RS ++ L VV I+KA A QR+GRAGR  PGKCFRLY  + +  E E+Q IPEIQRTNLGNVVL+LKSLGI D++ FD++DPP +++L+ A+E+LY L A++ +G L+ +GR+M E PCDP +S MI+ SEKY CSEEI+TIAAMLS +  +FY PK + ++A  A + F    GDH+TL+ VYN++  + +S  WC +NY+Q R+MK AR++RDQLV L +R+E++  S S DT+ I KAITAG+F N ++  N   Y+ +K K + +   NS   + +E PR+VV+  +V T+KE+MR  + IE  WL ++APH YK  + E D+  K+MPK
Sbjct:  165 AARINKKEKDKTRNVMEKKRDDNK---------DKEGSSMDKLREESRRQYLKKRKVDKLEELEAIVHDDQTLFAREKLTKREKADMEYRKKVLEYTKAHGKAGDVMKMKRYHLPDASTKQIPSQYVEDDEEDFRPGGDGAKWEEEQLMASMLHLGAKDAKRKEQEFELLLDEKVDFIQA-LQMPGTNEEVVETEAEK---KKMSIEETRKSLPVYAFRDAFIEAVKEHQVLIIEGETGSGKTTQLPQYLYEAGFCEGGKRIGCTQPRRVAAMSVAARVADEVGCKLGTQVGYSIRFEDCTSEKTVLKYMTDGMLLREFLNEPDLASYSVMMIDEAHERTLHTDILFGLVKDIARFRKDLKLLISSATLDAEKFSSFFDDAPIFRIPGRRFPVDIYYTQAPEADYVDAAIVTIMQIHLTQPLPGDILVFLTGQEEIETVQEALMERSKALGSKIKELIPLPVYANLPSDLQAKIFEPTPKDARKVVLATNIAETSVTIDGINYVIDPGFSKQNSFDARSGVEHLHVVTISKAAANQRAGRAGRTGPGKCFRLYTAWAYKHELEEQPIPEIQRTNLGNVVLMLKSLGIHDLVHFDFLDPPPQETLVIALEQLYALGALNHRGELTKLGRRMAEFPCDPCMSKMIIASEKYECSEEIVTIAAMLSCNAAVFYRPKAQVIHADSARKGFWSPAGDHITLMNVYNKWQESSFSQRWCVENYVQHRTMKRARDVRDQLVGLLERVEIETKS-STDTIKIRKAITAGYFYNVSKLDNTGHYKTVKHKHTTHPHPNSC--LFEETPRWVVYFELVFTSKEFMREMSEIESGWLLEVAPHYYKGRELE-DATNKKMPK 997          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 vs. Ensembl Celegans
Match: mog-5 (Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-5 [Source:UniProtKB/Swiss-Prot;Acc:Q09530])

HSP 1 Score: 660.218 bits (1702), Expect = 0.000e+0
Identity = 335/648 (51.70%), Postives = 459/648 (70.83%), Query Frame = 3
Query:  747 DLAISQVQKLLPIYRLKNELIKMIAENQIVVIEGETGSGKTTQIPQYLYEAGYCVEDKIIGCTQPXXXXXXXXXXXXXQEMNVKLGDKVGYSVRFEAKVSEQTQIKYMTDGMLLREFLNDPTVGMYSVLIIDEAHERTLQTDILFGLLSAVTEVRKDLKIIISSATCDVEKFCQFF-EAPFFKIPGRRYPVETFYTKDQEADFVEAAVVTILQIHITQSDGDILVFLTGQEDIEEAMDSLQERIKALGTKIRELIVLPIYSALPSEKQAKIFLPTPPGARKVVLATNIAETSLTIDGIRFVIDCGYCKVKCYDPRSRMDSLKVVPITKANAIQRSGRAGRIAPGKCFRLYKKYTFDEEFEDQAIPEIQRTNLGNVVLLLKSLGIEDILDFDYMDPPFEKSLLAAIEELYYLSAIDSKGGLSLIGRKMVEIPCDPMISNMILKSEKYGCSEEIITIAAMLSLDNTIFYSPKNKKLYASQAHRAFMQEEGDHLTLLKVYNEYANNDYSSDWCKDNYIQSRSMKMARNIRDQLVNLADRLELKLISNSEDTVGICKAITAGFFLNTARFNG-DSYRRIKSKDSVYMQMNSVFRILDEHPRYVVFNNIVNTTKEYMRTCTRIEPRWLTDIAPHIYKDIDFEGDSKYKRMPKL 2684
            +L++ + ++ LPI+ LK  L++ + +NQI+V+ GETGSGKTTQ+ QY  EAG     KI GCTQPRRVAAMSVA RVA+E   KLG  VGY++RFE   S+ T IKYMTDGMLLRE L DP +  YS++++DEAHERT+ TD+LFGLL A    R +LK+II+SAT D  KF ++F EAP F IPGR +PVE  YT++ E+D++EAA +T++QIH+T+  GD+LVFLTGQE+I+ + + L ER+K++G  + ELI+LP+Y ALPSE Q +IF P P G RKVV+ATNIAETSLTIDGI +V+D G+ K K Y+P+S MDSL V PI++A A QRSGRAGR  PGKC+RLY +  F +E     +PEIQRTNL + +L LK++GI +++DFD+MD P   S++ A+  L+ LSA+D  G L+ +GR+M E P +P +S +++ S   GCSEE++TI AML++ N IFY PK K+ +A Q    F Q EGDHLTLL VYN + N+ +S  WC +N+IQ RSMK A++IR QL+ + DR +L ++S   D   + KAI +GFF N A+ +  + YR +    +VY+  +S      + P +VV++ +V TTKEYMR  T I+P+WL + AP  +K  D    S +KR  K+
Sbjct:  530 NLSMVEQRESLPIFALKKNLMEAMIDNQILVVVGETGSGKTTQMTQYAIEAGLGRRGKI-GCTQPRRVAAMSVAKRVAEEYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGMLLRECLIDPDLSGYSLIMLDEAHERTIHTDVLFGLLKAAARKRPELKLIITSATLDSVKFSEYFLEAPIFTIPGRTFPVEILYTREPESDYLEAAHITVMQIHLTEPPGDVLVFLTGQEEIDTSCEVLYERMKSMGPDVPELIILPVYGALPSEMQTRIFDPAPAGKRKVVIATNIAETSLTIDGIFYVVDPGFVKQKIYNPKSGMDSLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTERAFRDEMLPTPVPEIQRTNLASTLLQLKAMGINNLIDFDFMDAPPLDSMITALNTLHTLSALDGDGLLTKLGRRMAEFPLEPSLSKLLIMSVDLGCSEEVLTIVAMLNVQN-IFYRPKEKQDHADQKKAKFHQPEGDHLTLLAVYNSWKNHHFSQPWCFENFIQVRSMKRAQDIRKQLLGIMDRHKLLMVSCGRDVSRVQKAICSGFFRNAAKRDPQEGYRTLTDGQNVYIHPSSA--CFQQQPEWVVYHELVMTTKEYMREVTAIDPKWLVEFAPSFFKIGDSTKLSTFKRNQKI 1173          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 vs. Ensembl Celegans
Match: mog-1 (Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-1 [Source:UniProtKB/Swiss-Prot;Acc:P34498])

HSP 1 Score: 593.964 bits (1530), Expect = 0.000e+0
Identity = 302/630 (47.94%), Postives = 423/630 (67.14%), Query Frame = 3
Query:  753 AISQVQKLLPIYRLKNELIKMIAENQIVVIEGETGSGKTTQIPQYLYEAGYCVEDKIIGCTQPXXXXXXXXXXXXXQEMNVKLGDKVGYSVRFEAKVSEQTQIKYMTDGMLLREFLNDPTVGMYSVLIIDEAHERTLQTDILFGLLSAVTEVRKDLKIIISSATCDVEKFCQFF--EAPFFKIPGRRYPVETFYTKDQEADFVEAAVVTILQIHITQSDGDILVFLTGQEDIEEAMDSLQERIKALGTKIRELIVLPIYSALPSEKQAKIFLPTPPGARKVVLATNIAETSLTIDGIRFVIDCGYCKVKCYDPRSRMDSLKVVPITKANAIQRSGRAGRIAPGKCFRLYKKYTFDEEFEDQAIPEIQRTNLGNVVLLLKSLGIEDILDFDYMDPPFEKSLLAAIEELYYLSAIDSKGGLSLIGRKMVEIPCDPMISNMILKSEKYGCSEEIITIAAMLSLDNTIFYSPKNKKLYASQAHRAFMQEEGDHLTLLKVYNEYANNDYSSDWCKDNYIQSRSMKMARNIRDQLVNLADRLELKLISNSEDTVGICKAITAGFFLNTARFNG-DSYRRIKSKDSVYMQMNSVFRILDEHPRYVVFNNIVNTTKEYMRTCTRIEPRWLTDIAPHIY 2633
            +I Q ++ LP++  + +++ +I EN +V+I GETGSGKTTQ+ QYL E G+  +  +IGCTQPRRVAAMSVA RVA EM V LG  VGY++RFE   SE+T IKYMTDG+LLRE L D ++  YS +I+DEAHER+L TD+LFGLL  V   R DLK+I++SAT D +KF  FF    P F IPGR +PVE F+ +    D+V+AAV   + IH+   DGDIL+F+ GQEDIE   + ++E++  L  +   L VLPIYS LPS+ QAKIF   P G RK ++ATNIAETSLT+DGI FVID G+CK+K Y+PR  MD+L + P+++A+A QR+GRAGR  PG+C+RLY +  F +E     +PEIQRTNL NVVLLLKSLG++D+L F +MD P + ++L ++ +L+ L A+D+ G L+ +GRKMVE P DP +S M++ S + GCS+E++TI +MLS+   IF+ PK ++  A      F   E DHLT L VY ++  + YS+ WC DNY+  +++K  R +R QL  +   L+L LISN  +   + K I + +F N AR  G   Y  +++    ++   S    +   P YVV++ ++ T KEYM+  T ++  WL ++ P  Y
Sbjct:  433 SIKQQREYLPVFACRQKMMNVIRENNVVIIVGETGSGKTTQLAQYLLEDGFG-DSGLIGCTQPRRVAAMSVARRVADEMGVDLGQDVGYAIRFEDCTSEKTIIKYMTDGILLRECLGDGSLDQYSAIIMDEAHERSLNTDVLFGLLREVIAKRADLKLIVTSATMDADKFADFFGGNCPTFTIPGRTFPVELFHARTPVEDYVDAAVKQAVTIHLGGMDGDILIFMPGQEDIECTCEMIKEKLGEL-DEAPPLAVLPIYSQLPSDLQAKIFQRAPGGMRKAIVATNIAETSLTVDGILFVIDPGFCKMKVYNPRIGMDALSIFPVSQASANQRTGRAGRTGPGQCYRLYTERQFKDELLKSTVPEIQRTNLANVVLLLKSLGVDDLLKFHFMDAPPQDNMLNSMYQLWTLGALDNTGQLTPMGRKMVEFPLDPTLSKMLIMSAEMGCSDEVLTIVSMLSV-PAIFFRPKGREEEADAKKEKFQVPESDHLTFLNVYIQWRTHKYSAKWCADNYLHVKALKKVREVRAQLKEIMQDLKLPLISNGSEWDIVRKCICSAYFHNAARLKGIGEYVNVRTGIPCFLHPTSALFGMGFMPDYVVYHELIMTAKEYMQCVTAVDAIWLAELGPMFY 1059          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 vs. Ensembl Celegans
Match: mog-1 (Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-1 [Source:UniProtKB/Swiss-Prot;Acc:P34498])

HSP 1 Score: 593.964 bits (1530), Expect = 0.000e+0
Identity = 302/630 (47.94%), Postives = 423/630 (67.14%), Query Frame = 3
Query:  753 AISQVQKLLPIYRLKNELIKMIAENQIVVIEGETGSGKTTQIPQYLYEAGYCVEDKIIGCTQPXXXXXXXXXXXXXQEMNVKLGDKVGYSVRFEAKVSEQTQIKYMTDGMLLREFLNDPTVGMYSVLIIDEAHERTLQTDILFGLLSAVTEVRKDLKIIISSATCDVEKFCQFF--EAPFFKIPGRRYPVETFYTKDQEADFVEAAVVTILQIHITQSDGDILVFLTGQEDIEEAMDSLQERIKALGTKIRELIVLPIYSALPSEKQAKIFLPTPPGARKVVLATNIAETSLTIDGIRFVIDCGYCKVKCYDPRSRMDSLKVVPITKANAIQRSGRAGRIAPGKCFRLYKKYTFDEEFEDQAIPEIQRTNLGNVVLLLKSLGIEDILDFDYMDPPFEKSLLAAIEELYYLSAIDSKGGLSLIGRKMVEIPCDPMISNMILKSEKYGCSEEIITIAAMLSLDNTIFYSPKNKKLYASQAHRAFMQEEGDHLTLLKVYNEYANNDYSSDWCKDNYIQSRSMKMARNIRDQLVNLADRLELKLISNSEDTVGICKAITAGFFLNTARFNG-DSYRRIKSKDSVYMQMNSVFRILDEHPRYVVFNNIVNTTKEYMRTCTRIEPRWLTDIAPHIY 2633
            +I Q ++ LP++  + +++ +I EN +V+I GETGSGKTTQ+ QYL E G+  +  +IGCTQPRRVAAMSVA RVA EM V LG  VGY++RFE   SE+T IKYMTDG+LLRE L D ++  YS +I+DEAHER+L TD+LFGLL  V   R DLK+I++SAT D +KF  FF    P F IPGR +PVE F+ +    D+V+AAV   + IH+   DGDIL+F+ GQEDIE   + ++E++  L  +   L VLPIYS LPS+ QAKIF   P G RK ++ATNIAETSLT+DGI FVID G+CK+K Y+PR  MD+L + P+++A+A QR+GRAGR  PG+C+RLY +  F +E     +PEIQRTNL NVVLLLKSLG++D+L F +MD P + ++L ++ +L+ L A+D+ G L+ +GRKMVE P DP +S M++ S + GCS+E++TI +MLS+   IF+ PK ++  A      F   E DHLT L VY ++  + YS+ WC DNY+  +++K  R +R QL  +   L+L LISN  +   + K I + +F N AR  G   Y  +++    ++   S    +   P YVV++ ++ T KEYM+  T ++  WL ++ P  Y
Sbjct:  433 SIKQQREYLPVFACRQKMMNVIRENNVVIIVGETGSGKTTQLAQYLLEDGFG-DSGLIGCTQPRRVAAMSVARRVADEMGVDLGQDVGYAIRFEDCTSEKTIIKYMTDGILLRECLGDGSLDQYSAIIMDEAHERSLNTDVLFGLLREVIAKRADLKLIVTSATMDADKFADFFGGNCPTFTIPGRTFPVELFHARTPVEDYVDAAVKQAVTIHLGGMDGDILIFMPGQEDIECTCEMIKEKLGEL-DEAPPLAVLPIYSQLPSDLQAKIFQRAPGGMRKAIVATNIAETSLTVDGILFVIDPGFCKMKVYNPRIGMDALSIFPVSQASANQRTGRAGRTGPGQCYRLYTERQFKDELLKSTVPEIQRTNLANVVLLLKSLGVDDLLKFHFMDAPPQDNMLNSMYQLWTLGALDNTGQLTPMGRKMVEFPLDPTLSKMLIMSAEMGCSDEVLTIVSMLSV-PAIFFRPKGREEEADAKKEKFQVPESDHLTFLNVYIQWRTHKYSAKWCADNYLHVKALKKVREVRAQLKEIMQDLKLPLISNGSEWDIVRKCICSAYFHNAARLKGIGEYVNVRTGIPCFLHPTSALFGMGFMPDYVVYHELIMTAKEYMQCVTAVDAIWLAELGPMFY 1059          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 vs. Ensembl Celegans
Match: ddx-15 (Pre-mRNA-splicing factor ATP-dependent RNA helicase ddx-15 [Source:UniProtKB/Swiss-Prot;Acc:Q20875])

HSP 1 Score: 573.933 bits (1478), Expect = 0.000e+0
Identity = 309/660 (46.82%), Postives = 426/660 (64.55%), Query Frame = 3
Query:  753 AISQVQKLLPIYRLKNELIKMIAENQIVVIEGETGSGKTTQIPQYLYE-------AGYCVEDKIIGCTQPXXXXXXXXXXXXXQEMNVKLGDKVGYSVRFEAKVSEQTQIKYMTDGMLLREFLNDPTVGMYSVLIIDEAHERTLQTDILFGLLSAVTEVRKDLKIIISSATCDVEKFCQFFE-APFFKIPGRRYPVETFYTKDQEADFVEAAVVTILQIHITQS-DGDILVFLTGQEDIEEAMDSLQERIKALGTKIRELIVLPIYSALPSEKQAKIFLPTPPG------ARKVVLATNIAETSLTIDGIRFVIDCGYCKVKCYDPRSRMDSLKVVPITKANAIQRSGRAGRIAPGKCFRLYKKYTFDEEFEDQAIPEIQRTNLGNVVLLLKSLGIEDILDFDYMDPPFEKSLLAAIEELYYLSAIDSKGGLSLIGRKMVEIPCDPMISNMILKSEKYGCSEEIITIAAMLSLDNTIFYSPKNKKLYASQAHRAFMQEEGDHLTLLKVYNEYANNDYSSDWCKDNYIQSRSMKMARNIRDQLVNLADRLELKLISN---SED-TVGICKAITAGFFLNTARF-NGDSYRRIKSKDSVYMQMNSVFRILDEHPRYVVFNNIVNTTKEYMRTCTRIEPRWLTDIAPHIYKDIDF-EGDSKYK 2669
            AI + +  LP++  K + ++++  NQ + + GETGSGKTTQIPQ+  E            + +++ CTQPRRVAAMSVA+RVA+EM+V LG +VGYS+RFE  +SE+T +KY TDGMLLRE +N P +  Y VLI+DEAHERTL TDIL GL+  +   R D+K++I SAT D  KF ++FE  P   +PGR +PVE F+T + E D++EAA+ T++QIH+ +  +GDIL+FLTGQE+IEEA   +   I+ALG     L  +P+YS LP   Q +IF P PP       +RK V++TNIAETSLTIDG+ FVID G+ K K Y+PR R++SL V PI+KA+A+QR+GRAGR  PGKCFRLY +  +  E +DQ  PEI R+NLG+VVL LK LG ED++ FD+MDPP  ++L+ A+E L YL AI+  G L+ +G  M E P DP ++ M++ S +  CS EI++I AMLS+    +  P   +  A +A   F   +GDHLTLL VY+ +  N     WC DN+I  R+MK A  +R QL  + D+  L+ +S    S D  + I KA+ AGFF+  A       Y  +K    V +  ++V   LD  P + ++N  V TTK ++RT T + P WL  IAP  Y   +F +GD+K K
Sbjct:   68 AIWEKRSQLPVWEYKEKFMELLRNNQCITLVGETGSGKTTQIPQWAVEFMKQQQQGQPPGQARLVACTQPRRVAAMSVATRVAEEMDVVLGQEVGYSIRFEDCISERTVLKYCTDGMLLREAMNSPLLDKYKVLILDEAHERTLATDILMGLIKEIVRNRADIKVVIMSATLDAGKFQRYFEDCPLLSVPGRTFPVEIFFTPNAEKDYLEAAIRTVIQIHMVEEVEGDILLFLTGQEEIEEACKRIDREIQALGADAGALSCIPLYSTLPPAAQQRIFEPAPPNRPNGAISRKCVISTNIAETSLTIDGVVFVIDPGFSKQKVYNPRIRVESLLVCPISKASAMQRAGRAGRTKPGKCFRLYTETAYGSEMQDQTYPEILRSNLGSVVLQLKKLGTEDLVHFDFMDPPAPETLMRALELLNYLQAINDDGELTELGSLMAEFPLDPQLAKMLITSTELNCSNEILSITAMLSVPQC-WVRPNEMRTEADEAKARFAHIDGDHLTLLNVYHSFKQNQEDPQWCYDNFINYRTMKTADTVRTQLSRVMDKYNLRRVSTDFKSRDYYLNIRKALVAGFFMQVAHLERSGHYVTVKDNQLVNLHPSTV---LDHKPEWALYNEFVLTTKNFIRTVTDVRPEWLLQIAPQYYDLDNFPDGDTKRK 723          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 vs. Ensembl Fly
Match: l(2)37Cb (gene:FBgn0086444 transcript:FBtr0081163)

HSP 1 Score: 833.558 bits (2152), Expect = 0.000e+0
Identity = 432/878 (49.20%), Postives = 612/878 (69.70%), Query Frame = 3
Query:  111 SEDEEHLTEKQRIKEYSQRISEKEKSKNKNYVSGQTN----EKKFRSQAMKYRDNETVTENIRIKSRQEYLLKRKADKIEDLHYDLIEDELYFKKEELTNRELKEKEAKKMIYKVAKMQEKSVKKVNEKYYTIPSN----DSTIVMNVTEERKKSRKGGLNEWETLQLKNA-IDQGKVSRRQDDEYELLVDEFVDYEQEETL------IPQNPEELTEKVIEKIDEKDLAISQVQKLLPIYRLKNELIKMIAENQIVVIEGETGSGKTTQIPQYLYEAGYCVEDKIIGCTQPXXXXXXXXXXXXXQEMNVKLGDKVGYSVRFEAKVSEQTQIKYMTDGMLLREFLNDPTVGMYSVLIIDEAHERTLQTDILFGLLSAVTEVRKDLKIIISSATCDVEKFCQFFE-APFFKIPGRRYPVETFYTKDQEADFVEAAVVTILQIHITQSDGDILVFLTGQEDIEEAMDSLQERIKALGTKIRELIVLPIYSALPSEKQAKIFLPTPPGARKVVLATNIAETSLTIDGIRFVIDCGYCKVKCYDPRSRMDSLKVVPITKANAIQRSGRAGRIAPGKCFRLYKKYTFDEEFEDQAIPEIQRTNLGNVVLLLKSLGIEDILDFDYMDPPFEKSLLAAIEELYYLSAIDSKGGLSLIGRKMVEIPCDPMISNMILKSEKYGCSEEIITIAAMLSLDNTIFYSPKNKKLYASQAHRAFMQEEGDHLTLLKVYNEYANNDYSSDWCKDNYIQSRSMKMARNIRDQLVNLADRLELKLISNSEDTVGICKAITAGFFLNTARFN-GDSYRRIKSKDSVYMQMNSVFRILDEHPRYVVFNNIVNTTKEYMRTCTRIEPRWLTDIAPHIYKDIDFEGDSKYKRMPKLAKK 2693
            SE+E  L + Q   E++ R+ +++  + +N V         E+  +   +++ D + +  ++R++SR++YL KRK DK+ +L  D+++DE  F +  LT RE +E+E KK +  +AK  EK+ +    + Y +P +    + +  + V +E +K       +WE  QL +A    G    + ++EYELL+D+ +D+ Q  TL            ELTEK     + K L + + ++ LP+Y  K +LI  + E+Q+++IEGETGSGKTTQ+PQYL EAG+  + K+IGCTQPRRVAAMSVA+RVA+EM VKLG++VGYS+RFE   S++T +KYMTDG L REFL++P +  YSV+IIDEAHERTL TDILFGL+  +   R +LK++ISSAT D EKF  FF+ AP F+IPGRRYPV+ FYTK  EAD+++A  V++LQIH TQ  GDILVFLTGQ++IE   + L +R+K LG+KIRELIV+P+Y+ LPS+ QAKIF PTPP ARKV+LATNIAETSLTID I +VID G+ K   ++ R+ M+SL VVPI+KA+A QR+GRAGR APGKCFRLY  + +  E ED  +PEIQR NLGN VL+LK+LGI D++ FD++DPP  ++L+ A+E+LY L A++  G L+ +GR+M E P DPM+  M+L SEKY CSEE++TIAAMLS+++ IFY PK+K ++A  A + F    GDHL+LL+VYN++A  DYS+ WC +N+IQ RSMK AR++R+QLV L  R+E+ ++S   +TV + KA TAG+F + AR + G  Y+ IK   +V +  NS   + +E PR+V+++ +V T+KEYMR    IE +WL ++APH YK  + E DS  K+MPK+A +
Sbjct:   21 SEEESRLKDLQERDEFASRLKKRDDDRTRNVVDSTGGRRAIEEATKRLKLEHEDRDKIVPHLRLQSRRQYLEKRKDDKVAELEADILDDEYLFDESVLTKREKEEREYKKQLLNIAKEHEKARELERIQRYNMPQDLKKGERSEYVEV-DEFEKQPNSEQKKWEAEQLASARFHFGAKDAKAEEEYELLLDDQIDFIQALTLDGSREKSSSRQPELTEK-----ERKRLTLDETRRSLPVYPFKEDLIAAVKEHQVLIIEGETGSGKTTQVPQYLVEAGFTKDKKMIGCTQPRRVAAMSVAARVAEEMGVKLGNEVGYSIRFEDCTSDRTILKYMTDGTLHREFLSEPDLASYSVMIIDEAHERTLHTDILFGLVKDIARFRPELKLLISSATLDAEKFSAFFDDAPIFRIPGRRYPVDIFYTKAPEADYIDACCVSVLQIHATQPLGDILVFLTGQDEIETCQEVLHDRVKRLGSKIRELIVIPVYANLPSDMQAKIFEPTPPNARKVILATNIAETSLTIDNIIYVIDPGFAKQNNFNSRTGMESLMVVPISKASANQRAGRAGRTAPGKCFRLYTAWAYKHELEDNTVPEIQRINLGNAVLMLKALGINDLIHFDFLDPPPHETLVLALEQLYALGALNHHGELTKLGRRMAEFPVDPMMGKMLLASEKYKCSEEMVTIAAMLSVNSAIFYRPKDKIIHADTARKNFNHMHGDHLSLLQVYNQWAETDYSTQWCYENFIQYRSMKRARDVREQLVGLMQRVEIDMVSCLPETVNVRKAATAGYFYHVARLSKGGHYKTIKHNQTVMIHPNS--SLFEELPRWVLYHELVFTSKEYMRQVIEIESKWLLEVAPHYYKAKELE-DSTNKKMPKVAGR 889          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 vs. Ensembl Fly
Match: pea (gene:FBgn0086895 transcript:FBtr0087518)

HSP 1 Score: 658.677 bits (1698), Expect = 0.000e+0
Identity = 329/648 (50.77%), Postives = 467/648 (72.07%), Query Frame = 3
Query:  747 DLAISQVQKLLPIYRLKNELIKMIAENQIVVIEGETGSGKTTQIPQYLYEAGYCVEDKIIGCTQPXXXXXXXXXXXXXQEMNVKLGDKVGYSVRFEAKVSEQTQIKYMTDGMLLREFLNDPTVGMYSVLIIDEAHERTLQTDILFGLLSAVTEVRKDLKIIISSATCDVEKFCQ-FFEAPFFKIPGRRYPVETFYTKDQEADFVEAAVVTILQIHITQSDGDILVFLTGQEDIEEAMDSLQERIKALGTKIRELIVLPIYSALPSEKQAKIFLPTPPGARKVVLATNIAETSLTIDGIRFVIDCGYCKVKCYDPRSRMDSLKVVPITKANAIQRSGRAGRIAPGKCFRLYKKYTFDEEFEDQAIPEIQRTNLGNVVLLLKSLGIEDILDFDYMDPPFEKSLLAAIEELYYLSAIDSKGGLSLIGRKMVEIPCDPMISNMILKSEKYGCSEEIITIAAMLSLDNTIFYSPKNKKLYASQAHRAFMQEEGDHLTLLKVYNEYANNDYSSDWCKDNYIQSRSMKMARNIRDQLVNLADRLELKLISNSEDTVGICKAITAGFFLNTARFNG-DSYRRIKSKDSVYMQMNSVFRILDEHPRYVVFNNIVNTTKEYMRTCTRIEPRWLTDIAPHIYKDIDFEGDSKYKRMPKL 2684
            DL + + ++ LPIY+L+++LIK + +NQI+++ GETGSGKTTQI QYL E G+    KI GCTQPRRVAAMSVA RVA+E   +LG +VGY++RFE   S +T IKYMTDGMLLRE L +  +  YSV+++DEAHERT+ TD+LFGLL    + R +LK+I++SAT D  KF Q FF+AP F IPGR +PVE  YTK+ E D+++A+++T++QIH+ +  GDIL+FLTGQE+I+ A + L ER+K+LG  + ELI+LP+YSALPSE Q +IF P P G+RKVV+ATNIAETSLTIDGI +V+D G+ K K Y+ ++ MDSL V PI++A A QR+GRAGR  PGK +RLY +  + +E     +PEIQRTNL   VL LK++GI D+L FD+MD P  +SL+ A+E+L+ LSA+D +G L+ +GR+M E P +P +S M++ S    CS+EI+TI +MLS+ N +FY PK+K+  A Q    F Q EGDHLTLL VYN + NN +S+ WC +N++Q R++K ++++R QL+ + DR +L ++S  +++V I KAI +GFF N A+ +  + YR +     VY+  +S   + +  P +V+++ +V TTKEYMR  T I+P+WL + AP  ++  D    SK+K+  +L
Sbjct:  576 DLTLVEQRQSLPIYKLRDDLIKAVTDNQILIVIGETGSGKTTQITQYLGECGFTARGKI-GCTQPRRVAAMSVAKRVAEEYGCRLGQEVGYTIRFEDCTSPETIIKYMTDGMLLRECLMEAELKSYSVIMLDEAHERTIHTDVLFGLLKTAVQKRPELKLIVTSATLDAVKFSQYFFKAPIFTIPGRTFPVEVLYTKEPETDYLDASLITVMQIHLREPPGDILLFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPAGSRKVVIATNIAETSLTIDGIFYVVDPGFVKQKVYNSKTGMDSLVVTPISQAAAKQRAGRAGRTGPGKTYRLYTERAYRDEMLPTPVPEIQRTNLATTVLQLKTMGINDLLHFDFMDAPPVESLVMALEQLHSLSALDDEGLLTRLGRRMAEFPLEPNLSKMLIMSVALQCSDEILTIVSMLSVQN-VFYRPKDKQALADQKKAKFNQAEGDHLTLLAVYNSWKNNKFSNAWCYENFVQIRTLKRSQDVRKQLLGIMDRHKLDVVSAGKNSVRIQKAICSGFFRNAAKKDPQEGYRTLVDSQVVYIHPSSA--LFNRQPEWVIYHELVQTTKEYMREVTTIDPKWLVEFAPSFFRFSDPTKLSKFKKNQRL 1219          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 vs. Ensembl Fly
Match: l(1)G0007 (gene:FBgn0026713 transcript:FBtr0073900)

HSP 1 Score: 586.26 bits (1510), Expect = 0.000e+0
Identity = 314/713 (44.04%), Postives = 458/713 (64.24%), Query Frame = 3
Query:  510 STIVMNVTEERKKSRKGGLNEWETLQLKNAIDQGKVSRRQDDEYELLVD---EFVDYEQEETLIPQNPEELTEKVIEKIDEKDLAISQVQKLLPIYRLKNELIKMIAENQIVVIEGETGSGKTTQIPQYLYEAGYCVEDKIIGCTQPXXXXXXXXXXXXXQEMNVKLGDKVGYSVRFEAKVSEQTQIKYMTDGMLLREFLNDPTVGMYSVLIIDEAHERTLQTDILFGLLSAVTEVRKDLKIIISSATCDVEKFCQFF-EAPFFKIPGRRYPVETFYTKDQEADFVEAAVVTILQIHITQSDGDILVFLTGQEDIEEAMDSLQERIKALGTKIRELIVLPIYSALPSEKQAKIFLPTPPGARKVVLATNIAETSLTIDGIRFVIDCGYCKVKCYDPRSRMDSLKVVPITKANAIQRSGRAGRIAPGKCFRLYKKYTFDEEFEDQAIPEIQRTNLGNVVLLLKSLGIEDILDFDYMDPPFEKSLLAAIEELYYLSAIDSKGGLSLIGRKMVEIPCDPMISNMILKSEKYGCSEEIITIAAMLSLDNTIFYSPKNKKLYASQAHRAFMQEEGDHLTLLKVYNEYANNDYSSDWCKDNYIQSRSMKMARNIRDQLVNLADRLELKLISNSEDTVGICKAITAGFFLNTARFNG-DSYRRIKSKDSVYMQMNSVFRILDEHPRYVVFNNIVNTTKEYMRTCTRIEPRWLTDIAPHIY 2633
            S +V N  E++++ RK     WE    K     G V R QD++ ++  D   +  DY +++       ++ T    +   +K   IS+ ++ LP++  + EL+ +I EN +++I GETGSGKTTQ+ QYL+E GY  +  +IGCTQPRRVAAMSVA RV+ EM+ +LG+ VGY++RFE   SE+T IKYMTDG+LLRE L DP +  YS +I+DEAHER+L TD+LFGLL  +   R DLK+I++SAT D  KF  FF   P F IPGR +PV+  ++K+   D+VE+AV   LQ+H+T ++GD+L+F+ GQEDIE   + L+ER+  +      L +LPIYS LPS+ QAKIF  +  G RK V+ATNIAETSLT+DGI +VID GYCK+K Y+PR  MD+L++ PI++ANA QRSGRAGR  PG+ +RLY +  + +E     +PEIQRTNL N VLLLKSLG+ D+L F +MDPP + ++L ++ +L+ L A+D  G L+ +GR+M E P DP    M++ + + GCS E++ I +MLS+  +IFY PK ++  A      F + E DHLT L VY ++  N+YSS WC +++I  ++M+  R +R QL ++  +  L +IS   D   + K I + +F   AR  G   Y  +++    ++   S    L   P YVV++ ++ T KEYM+  T ++  WL ++ P  +
Sbjct:  447 SALVRNYREQKER-RKAQKKHWELSGTKLGNIMG-VQRPQDED-DMRFDKEKDKADYRKDQKFADHMRDQDTGGKSDFSRKK--TISEQRRFLPVFASRQELLNVIRENSVIIIVGETGSGKTTQLTQYLHEDGYS-KRGMIGCTQPRRVAAMSVAKRVSDEMDTQLGEDVGYAIRFEDCTSERTVIKYMTDGILLRESLRDPELDSYSAIIMDEAHERSLSTDVLFGLLREIVARRHDLKLIVTSATMDSSKFATFFGNVPTFTIPGRTFPVDVMFSKNTCEDYVESAVKQALQVHLTPNEGDMLIFMPGQEDIEVTCEVLEERLAEIDNAP-ALSILPIYSQLPSDLQAKIFQKSSDGLRKCVVATNIAETSLTVDGIIYVIDSGYCKLKVYNPRIGMDALQIYPISQANANQRSGRAGRTGPGQAYRLYTQRQYKDELLALTVPEIQRTNLANTVLLLKSLGVVDLLQFHFMDPPPQDNILNSLYQLWILGALDHTGALTTLGRQMAEFPLDPPQCQMLIVACRMGCSAEVLIIVSMLSVP-SIFYRPKGREDEADGVREKFQRPESDHLTYLNVYQQWRQNNYSSTWCNEHFIHIKAMRKVREVRQQLKDIMTQQNLSVISCGIDWDIVRKCICSAYFYQAARLKGIGEYVNLRTGMPCHLHPTSALYGLGTTPDYVVYHELIMTAKEYMQCATAVDGYWLAELGPMFF 1151          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 vs. Ensembl Fly
Match: Dhx15 (gene:FBgn0033160 transcript:FBtr0336909)

HSP 1 Score: 583.178 bits (1502), Expect = 0.000e+0
Identity = 310/631 (49.13%), Postives = 426/631 (67.51%), Query Frame = 3
Query:  777 LPIYRLKNELIKMIAENQIVVIEGETGSGKTTQIPQYLYEAGYCVEDKIIGCTQPXXXXXXXXXXXXXQEMNVKLGDKVGYSVRFEAKVSEQTQIKYMTDGMLLREFLNDPTVGMYSVLIIDEAHERTLQTDILFGLLSAVTEVRKDLKIIISSATCDVEKFCQFFE-APFFKIPGRRYPVETFYTKDQEADFVEAAVVTILQIHITQS-DGDILVFLTGQEDIEEAMDSLQERIKALGTKIRELIVLPIYSALPSEKQAKIFLPTPP----GA--RKVVLATNIAETSLTIDGIRFVIDCGYCKVKCYDPRSRMDSLKVVPITKANAIQRSGRAGRIAPGKCFRLYKKYTFDEEFEDQAIPEIQRTNLGNVVLLLKSLGIEDILDFDYMDPPFEKSLLAAIEELYYLSAIDSKGGLSLIGRKMVEIPCDPMISNMILKSEKYGCSEEIITIAAMLSLDNTIFYSPKNKKLYASQAHRAFMQEEGDHLTLLKVYNEYANNDYSSDWCKDNYIQSRSMKMARNIRDQLVNLADRLELKLIS---NSED-TVGICKAITAGFFLNTARFNGDSYRRIKSKDSVYMQMNSVFRILDEHPRYVVFNNIVNTTKEYMRTCTRIEPRWLTDIAPHIY 2633
            LP++  + + +++++ +Q +V+ GETGSGKTTQIPQ+  +       K + CTQPRRVAAMSVA RV++EM+VKLG++VGYS+RFE   + +T +KYMTDGMLLRE ++DP +  Y V+++DEAHERTL TDIL G+L  V   R DLK+++ SAT D  KF Q+F+ AP  K+PGR +PVE FYT + E D++EAA+ T++QIH+ +  +GDIL+FLTGQE+IEEA   ++  I  LG++I EL  +P+YS LP   Q +IF P PP    GA  RKVV++TNIAETSLTIDG+ FVID G+ K K Y+PR R++SL V PI+KA+A QRSGRAGR  PGKCFRLY +  F  E +D   PEI R+NLG VVL LK LGI+D++ FD+MDPP  ++L+ A+E L YL+A+D  G L+ +G  M E P DP ++ M++ S ++ CS EI++I AMLS+    F  P   K  A +A   F   +GDHLTLL VY+ +  +    +WC +N+I  RS+K A N+R QL  + DR  L+  S    S+D  V I KA+  GFF+  A      Y  +  KD+  +Q++     LD  P +V++N  V TTK Y+RT T ++P WL  +AP  Y
Sbjct:   72 LPVFEYQADFMRLLSLHQCIVLVGETGSGKTTQIPQWCVDFAVSKGRKGVSCTQPRRVAAMSVAQRVSEEMDVKLGEEVGYSIRFEDCSTAKTLLKYMTDGMLLREAMSDPMLDQYQVILLDEAHERTLATDILMGVLKEVIRQRSDLKLVVMSATLDAGKFQQYFDNAPLMKVPGRTHPVEIFYTPEPERDYLEAAIRTVIQIHMCEEIEGDILMFLTGQEEIEEACKRIKREIDNLGSEIGELKCIPLYSTLPPNLQQRIFEPAPPPNANGAIGRKVVVSTNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLVSPISKASAQQRSGRAGRTRPGKCFRLYTEKAFKNEMQDNTYPEILRSNLGTVVLQLKKLGIDDLVHFDFMDPPAPETLMRALELLNYLAALDDDGNLTDLGAVMSEFPLDPQLAKMLIASCQHNCSNEILSITAMLSVPQC-FVRPNEAKKAADEAKMRFAHIDGDHLTLLNVYHAFKQSSEDPNWCYENFINFRSLKSADNVRQQLARIMDRFNLRRTSTEFTSKDYYVNIRKALVQGFFMQVAHLERTGY-YLTIKDNQNVQLHPS-TCLDHKPDWVIYNEFVLTTKNYIRTVTDVKPEWLCCLAPQYY 699          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 vs. Ensembl Fly
Match: Dhx15 (gene:FBgn0033160 transcript:FBtr0088966)

HSP 1 Score: 583.178 bits (1502), Expect = 0.000e+0
Identity = 310/631 (49.13%), Postives = 426/631 (67.51%), Query Frame = 3
Query:  777 LPIYRLKNELIKMIAENQIVVIEGETGSGKTTQIPQYLYEAGYCVEDKIIGCTQPXXXXXXXXXXXXXQEMNVKLGDKVGYSVRFEAKVSEQTQIKYMTDGMLLREFLNDPTVGMYSVLIIDEAHERTLQTDILFGLLSAVTEVRKDLKIIISSATCDVEKFCQFFE-APFFKIPGRRYPVETFYTKDQEADFVEAAVVTILQIHITQS-DGDILVFLTGQEDIEEAMDSLQERIKALGTKIRELIVLPIYSALPSEKQAKIFLPTPP----GA--RKVVLATNIAETSLTIDGIRFVIDCGYCKVKCYDPRSRMDSLKVVPITKANAIQRSGRAGRIAPGKCFRLYKKYTFDEEFEDQAIPEIQRTNLGNVVLLLKSLGIEDILDFDYMDPPFEKSLLAAIEELYYLSAIDSKGGLSLIGRKMVEIPCDPMISNMILKSEKYGCSEEIITIAAMLSLDNTIFYSPKNKKLYASQAHRAFMQEEGDHLTLLKVYNEYANNDYSSDWCKDNYIQSRSMKMARNIRDQLVNLADRLELKLIS---NSED-TVGICKAITAGFFLNTARFNGDSYRRIKSKDSVYMQMNSVFRILDEHPRYVVFNNIVNTTKEYMRTCTRIEPRWLTDIAPHIY 2633
            LP++  + + +++++ +Q +V+ GETGSGKTTQIPQ+  +       K + CTQPRRVAAMSVA RV++EM+VKLG++VGYS+RFE   + +T +KYMTDGMLLRE ++DP +  Y V+++DEAHERTL TDIL G+L  V   R DLK+++ SAT D  KF Q+F+ AP  K+PGR +PVE FYT + E D++EAA+ T++QIH+ +  +GDIL+FLTGQE+IEEA   ++  I  LG++I EL  +P+YS LP   Q +IF P PP    GA  RKVV++TNIAETSLTIDG+ FVID G+ K K Y+PR R++SL V PI+KA+A QRSGRAGR  PGKCFRLY +  F  E +D   PEI R+NLG VVL LK LGI+D++ FD+MDPP  ++L+ A+E L YL+A+D  G L+ +G  M E P DP ++ M++ S ++ CS EI++I AMLS+    F  P   K  A +A   F   +GDHLTLL VY+ +  +    +WC +N+I  RS+K A N+R QL  + DR  L+  S    S+D  V I KA+  GFF+  A      Y  +  KD+  +Q++     LD  P +V++N  V TTK Y+RT T ++P WL  +AP  Y
Sbjct:   72 LPVFEYQADFMRLLSLHQCIVLVGETGSGKTTQIPQWCVDFAVSKGRKGVSCTQPRRVAAMSVAQRVSEEMDVKLGEEVGYSIRFEDCSTAKTLLKYMTDGMLLREAMSDPMLDQYQVILLDEAHERTLATDILMGVLKEVIRQRSDLKLVVMSATLDAGKFQQYFDNAPLMKVPGRTHPVEIFYTPEPERDYLEAAIRTVIQIHMCEEIEGDILMFLTGQEEIEEACKRIKREIDNLGSEIGELKCIPLYSTLPPNLQQRIFEPAPPPNANGAIGRKVVVSTNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLVSPISKASAQQRSGRAGRTRPGKCFRLYTEKAFKNEMQDNTYPEILRSNLGTVVLQLKKLGIDDLVHFDFMDPPAPETLMRALELLNYLAALDDDGNLTDLGAVMSEFPLDPQLAKMLIASCQHNCSNEILSITAMLSVPQC-FVRPNEAKKAADEAKMRFAHIDGDHLTLLNVYHAFKQSSEDPNWCYENFINFRSLKSADNVRQQLARIMDRFNLRRTSTEFTSKDYYVNIRKALVQGFFMQVAHLERTGY-YLTIKDNQNVQLHPS-TCLDHKPDWVIYNEFVLTTKNYIRTVTDVKPEWLCCLAPQYY 699          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 vs. Ensembl Zebrafish
Match: dhx16 (DEAH (Asp-Glu-Ala-His) box polypeptide 16 [Source:ZFIN;Acc:ZDB-GENE-030131-8589])

HSP 1 Score: 823.928 bits (2127), Expect = 0.000e+0
Identity = 432/872 (49.54%), Postives = 610/872 (69.95%), Query Frame = 3
Query:  156 YSQRISEKEKSKNKNYVSGQTNEKKFRSQA-----MKYRDNETVTENIRIKSRQEYLLKRKADKIEDLHYDLIEDELYFKKEELTNRELKEKEAKKMIYKVAKMQEKSVKKVNE----KYY--------TIPSNDSTIVMNVTEERKKSRKGGLNEWE-------TLQLKNAIDQGKVSRRQDDEYELLVDE-----FVDYEQEETLIPQNPEELTEKVIEKIDEKDLAISQVQKLLPIYRLKNELIKMIAENQIVVIEGETGSGKTTQIPQYLYEAGYCVEDKIIGCTQPXXXXXXXXXXXXXQEMNVKLGDKVGYSVRFEAKVSEQTQIKYMTDGMLLREFLNDPTVGMYSVLIIDEAHERTLQTDILFGLLSAVTEVRKDLKIIISSATCDVEKFCQFFE-APFFKIPGRRYPVETFYTKDQEADFVEAAVVTILQIHITQSDGDILVFLTGQEDIEEAMDSLQERIKALGTKIRELIVLPIYSALPSEKQAKIFLPTPPGARKVVLATNIAETSLTIDGIRFVIDCGYCKVKCYDPRSRMDSLKVVPITKANAIQRSGRAGRIAPGKCFRLYKKYTFDEEFEDQAIPEIQRTNLGNVVLLLKSLGIEDILDFDYMDPPFEKSLLAAIEELYYLSAIDSKGGLSLIGRKMVEIPCDPMISNMILKSEKYGCSEEIITIAAMLSLDNTIFYSPKNKKLYASQAHRAFMQEEGDHLTLLKVYNEYANNDYSSDWCKDNYIQSRSMKMARNIRDQLVNLADRLELKLISNSEDTVGICKAITAGFFLNTARFNGDSYRRIKSKDSVYMQMNSVFRILDEHPRYVVFNNIVNTTKEYMRTCTRIEPRWLTDIAPHIYKDIDFEGDSKYKRMPK 2681
            +++R+ +K+K K ++ +  + N+KK   +A     M   D   +   +R +SR++YL KR+ +K+EDL  ++ ++E  F  + LT+RE K+ E K+ I  +AK  +K+  K  E    +YY        +IP  D  +     EE  +   G    WE       TLQ     ++ +  + + + Y+L+++E     FV      T+     E+ +E  + + +++  +I +V++ LPI+  + +L+  I ++QI+VIEGETGSGKTTQIPQYL E GY      IGCTQPRRVAAMSVA+RVAQEM+VKLG++VGYS+RFE   SE+T +KYMTDGMLLREFL +P +  YSV+IIDEAHERTL TDILFGL+  +   R DLK++++SAT D E+F  FF+ AP F+IPGRR+PV+ +YTK  EAD++EA VV++LQIH+TQS GD+LVFLTGQE+IE   + LQER + LG+KI EL+VLPIY+ LPS+ QAKIF PTPPGARKVV+ATNIAETSLTIDGI +VID G+CK K Y+ ++ M+SL V P ++A+A QR+GRAGR+A GKCFRLY  + F  E E+  +PEIQRTNLGNVVLLLKSLGI D++ FD+MDPP  ++L+ A+E+LY L A++  G L+ +GR+M E+P DPM+S MIL SE+Y CSEE++TIAAMLS++N+IFY PK+K ++A  A   F+   GDHL LL VY ++  + YS+ WC +N+IQ RSMK AR++RDQL  L DR+E++L S++ D++ I KA+TAG+F +TAR +   Y+ +K + +VY+  NS   + +E PR+++++ +V TTKE+MR    IE  WL ++APH YK+ + E DS  K+MP+
Sbjct:  183 FAERVKQKDKDKTRHIL--ERNDKKAYEEAQKRLKMAEEDQRKMLPELRKQSRRQYLSKREQEKLEDLEAEIKDEEYLFSTQNLTDRERKDLEYKRTIRDMAKEYKKAGAKEQEERKNRYYMPEEKRNKSIPQKDMDLEF---EETPREGGGEQGRWEEARVATATLQFGARQERERRIKEEQERYQLILEEEEMITFVSTAI--TMKGTLSEKESEPELSQAEKQKQSIQEVRRSLPIFPYREDLLAAIGDHQILVIEGETGSGKTTQIPQYLLEEGYTKGGMKIGCTQPRRVAAMSVAARVAQEMSVKLGNEVGYSIRFEDCTSERTILKYMTDGMLLREFLTEPDLASYSVIIIDEAHERTLHTDILFGLIKDIARFRPDLKVLVASATLDTERFSSFFDDAPVFRIPGRRFPVDIYYTKAPEADYLEACVVSVLQIHVTQSPGDVLVFLTGQEEIEACCELLQERCRRLGSKISELLVLPIYANLPSDMQAKIFNPTPPGARKVVVATNIAETSLTIDGIIYVIDPGFCKQKSYNAKTGMESLIVTPCSRASANQRAGRAGRVAAGKCFRLYTAWAFKHEMEETTVPEIQRTNLGNVVLLLKSLGINDLIHFDFMDPPPHETLVLALEQLYALGALNHLGELTKLGRRMAELPVDPMLSKMILASEQYKCSEEVLTIAAMLSVNNSIFYRPKDKVVHADNARMNFVVPGGDHLVLLNVYTQWVESGYSTQWCFENFIQFRSMKRARDVRDQLEGLMDRIEVELCSSNGDSMPIRKAVTAGYFYHTARLSKGGYKTVKHQQTVYVHPNS--SLFEEQPRWMIYHELVFTTKEFMRQVIEIESGWLLEVAPHYYKNKELE-DSSSKKMPR 1044          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 vs. Ensembl Zebrafish
Match: dhx16 (DEAH (Asp-Glu-Ala-His) box polypeptide 16 [Source:ZFIN;Acc:ZDB-GENE-030131-8589])

HSP 1 Score: 823.928 bits (2127), Expect = 0.000e+0
Identity = 432/872 (49.54%), Postives = 610/872 (69.95%), Query Frame = 3
Query:  156 YSQRISEKEKSKNKNYVSGQTNEKKFRSQA-----MKYRDNETVTENIRIKSRQEYLLKRKADKIEDLHYDLIEDELYFKKEELTNRELKEKEAKKMIYKVAKMQEKSVKKVNE----KYY--------TIPSNDSTIVMNVTEERKKSRKGGLNEWE-------TLQLKNAIDQGKVSRRQDDEYELLVDE-----FVDYEQEETLIPQNPEELTEKVIEKIDEKDLAISQVQKLLPIYRLKNELIKMIAENQIVVIEGETGSGKTTQIPQYLYEAGYCVEDKIIGCTQPXXXXXXXXXXXXXQEMNVKLGDKVGYSVRFEAKVSEQTQIKYMTDGMLLREFLNDPTVGMYSVLIIDEAHERTLQTDILFGLLSAVTEVRKDLKIIISSATCDVEKFCQFFE-APFFKIPGRRYPVETFYTKDQEADFVEAAVVTILQIHITQSDGDILVFLTGQEDIEEAMDSLQERIKALGTKIRELIVLPIYSALPSEKQAKIFLPTPPGARKVVLATNIAETSLTIDGIRFVIDCGYCKVKCYDPRSRMDSLKVVPITKANAIQRSGRAGRIAPGKCFRLYKKYTFDEEFEDQAIPEIQRTNLGNVVLLLKSLGIEDILDFDYMDPPFEKSLLAAIEELYYLSAIDSKGGLSLIGRKMVEIPCDPMISNMILKSEKYGCSEEIITIAAMLSLDNTIFYSPKNKKLYASQAHRAFMQEEGDHLTLLKVYNEYANNDYSSDWCKDNYIQSRSMKMARNIRDQLVNLADRLELKLISNSEDTVGICKAITAGFFLNTARFNGDSYRRIKSKDSVYMQMNSVFRILDEHPRYVVFNNIVNTTKEYMRTCTRIEPRWLTDIAPHIYKDIDFEGDSKYKRMPK 2681
            +++R+ +K+K K ++ +  + N+KK   +A     M   D   +   +R +SR++YL KR+ +K+EDL  ++ ++E  F  + LT+RE K+ E K+ I  +AK  +K+  K  E    +YY        +IP  D  +     EE  +   G    WE       TLQ     ++ +  + + + Y+L+++E     FV      T+     E+ +E  + + +++  +I +V++ LPI+  + +L+  I ++QI+VIEGETGSGKTTQIPQYL E GY      IGCTQPRRVAAMSVA+RVAQEM+VKLG++VGYS+RFE   SE+T +KYMTDGMLLREFL +P +  YSV+IIDEAHERTL TDILFGL+  +   R DLK++++SAT D E+F  FF+ AP F+IPGRR+PV+ +YTK  EAD++EA VV++LQIH+TQS GD+LVFLTGQE+IE   + LQER + LG+KI EL+VLPIY+ LPS+ QAKIF PTPPGARKVV+ATNIAETSLTIDGI +VID G+CK K Y+ ++ M+SL V P ++A+A QR+GRAGR+A GKCFRLY  + F  E E+  +PEIQRTNLGNVVLLLKSLGI D++ FD+MDPP  ++L+ A+E+LY L A++  G L+ +GR+M E+P DPM+S MIL SE+Y CSEE++TIAAMLS++N+IFY PK+K ++A  A   F+   GDHL LL VY ++  + YS+ WC +N+IQ RSMK AR++RDQL  L DR+E++L S++ D++ I KA+TAG+F +TAR +   Y+ +K + +VY+  NS   + +E PR+++++ +V TTKE+MR    IE  WL ++APH YK+ + E DS  K+MP+
Sbjct:  183 FAERVKQKDKDKTRHIL--ERNDKKAYEEAQKRLKMAEEDQRKMLPELRKQSRRQYLSKREQEKLEDLEAEIKDEEYLFSTQNLTDRERKDLEYKRTIRDMAKEYKKAGAKEQEERKNRYYMPEEKRNKSIPQKDMDLEF---EETPREGGGEQGRWEEARVATATLQFGARQERERRIKEEQERYQLILEEEEMITFVSTAI--TMKGTLSEKESEPELSQAEKQKQSIQEVRRSLPIFPYREDLLAAIGDHQILVIEGETGSGKTTQIPQYLLEEGYTKGGMKIGCTQPRRVAAMSVAARVAQEMSVKLGNEVGYSIRFEDCTSERTILKYMTDGMLLREFLTEPDLASYSVIIIDEAHERTLHTDILFGLIKDIARFRPDLKVLVASATLDTERFSSFFDDAPVFRIPGRRFPVDIYYTKAPEADYLEACVVSVLQIHVTQSPGDVLVFLTGQEEIEACCELLQERCRRLGSKISELLVLPIYANLPSDMQAKIFNPTPPGARKVVVATNIAETSLTIDGIIYVIDPGFCKQKSYNAKTGMESLIVTPCSRASANQRAGRAGRVAAGKCFRLYTAWAFKHEMEETTVPEIQRTNLGNVVLLLKSLGINDLIHFDFMDPPPHETLVLALEQLYALGALNHLGELTKLGRRMAELPVDPMLSKMILASEQYKCSEEVLTIAAMLSVNNSIFYRPKDKVVHADNARMNFVVPGGDHLVLLNVYTQWVESGYSTQWCFENFIQFRSMKRARDVRDQLEGLMDRIEVELCSSNGDSMPIRKAVTAGYFYHTARLSKGGYKTVKHQQTVYVHPNS--SLFEEQPRWMIYHELVFTTKEFMRQVIEIESGWLLEVAPHYYKNKELE-DSSSKKMPR 1044          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 vs. Ensembl Zebrafish
Match: dhx16 (DEAH (Asp-Glu-Ala-His) box polypeptide 16 [Source:ZFIN;Acc:ZDB-GENE-030131-8589])

HSP 1 Score: 823.928 bits (2127), Expect = 0.000e+0
Identity = 432/872 (49.54%), Postives = 610/872 (69.95%), Query Frame = 3
Query:  156 YSQRISEKEKSKNKNYVSGQTNEKKFRSQA-----MKYRDNETVTENIRIKSRQEYLLKRKADKIEDLHYDLIEDELYFKKEELTNRELKEKEAKKMIYKVAKMQEKSVKKVNE----KYY--------TIPSNDSTIVMNVTEERKKSRKGGLNEWE-------TLQLKNAIDQGKVSRRQDDEYELLVDE-----FVDYEQEETLIPQNPEELTEKVIEKIDEKDLAISQVQKLLPIYRLKNELIKMIAENQIVVIEGETGSGKTTQIPQYLYEAGYCVEDKIIGCTQPXXXXXXXXXXXXXQEMNVKLGDKVGYSVRFEAKVSEQTQIKYMTDGMLLREFLNDPTVGMYSVLIIDEAHERTLQTDILFGLLSAVTEVRKDLKIIISSATCDVEKFCQFFE-APFFKIPGRRYPVETFYTKDQEADFVEAAVVTILQIHITQSDGDILVFLTGQEDIEEAMDSLQERIKALGTKIRELIVLPIYSALPSEKQAKIFLPTPPGARKVVLATNIAETSLTIDGIRFVIDCGYCKVKCYDPRSRMDSLKVVPITKANAIQRSGRAGRIAPGKCFRLYKKYTFDEEFEDQAIPEIQRTNLGNVVLLLKSLGIEDILDFDYMDPPFEKSLLAAIEELYYLSAIDSKGGLSLIGRKMVEIPCDPMISNMILKSEKYGCSEEIITIAAMLSLDNTIFYSPKNKKLYASQAHRAFMQEEGDHLTLLKVYNEYANNDYSSDWCKDNYIQSRSMKMARNIRDQLVNLADRLELKLISNSEDTVGICKAITAGFFLNTARFNGDSYRRIKSKDSVYMQMNSVFRILDEHPRYVVFNNIVNTTKEYMRTCTRIEPRWLTDIAPHIYKDIDFEGDSKYKRMPK 2681
            +++R+ +K+K K ++ +  + N+KK   +A     M   D   +   +R +SR++YL KR+ +K+EDL  ++ ++E  F  + LT+RE K+ E K+ I  +AK  +K+  K  E    +YY        +IP  D  +     EE  +   G    WE       TLQ     ++ +  + + + Y+L+++E     FV      T+     E+ +E  + + +++  +I +V++ LPI+  + +L+  I ++QI+VIEGETGSGKTTQIPQYL E GY      IGCTQPRRVAAMSVA+RVAQEM+VKLG++VGYS+RFE   SE+T +KYMTDGMLLREFL +P +  YSV+IIDEAHERTL TDILFGL+  +   R DLK++++SAT D E+F  FF+ AP F+IPGRR+PV+ +YTK  EAD++EA VV++LQIH+TQS GD+LVFLTGQE+IE   + LQER + LG+KI EL+VLPIY+ LPS+ QAKIF PTPPGARKVV+ATNIAETSLTIDGI +VID G+CK K Y+ ++ M+SL V P ++A+A QR+GRAGR+A GKCFRLY  + F  E E+  +PEIQRTNLGNVVLLLKSLGI D++ FD+MDPP  ++L+ A+E+LY L A++  G L+ +GR+M E+P DPM+S MIL SE+Y CSEE++TIAAMLS++N+IFY PK+K ++A  A   F+   GDHL LL VY ++  + YS+ WC +N+IQ RSMK AR++RDQL  L DR+E++L S++ D++ I KA+TAG+F +TAR +   Y+ +K + +VY+  NS   + +E PR+++++ +V TTKE+MR    IE  WL ++APH YK+ + E DS  K+MP+
Sbjct:  183 FAERVKQKDKDKTRHIL--ERNDKKAYEEAQKRLKMAEEDQRKMLPELRKQSRRQYLSKREQEKLEDLEAEIKDEEYLFSTQNLTDRERKDLEYKRTIRDMAKEYKKAGAKEQEERKNRYYMPEEKRNKSIPQKDMDLEF---EETPREGGGEQGRWEEARVATATLQFGARQERERRIKEEQERYQLILEEEEMITFVSTAI--TMKGTLSEKESEPELSQAEKQKQSIQEVRRSLPIFPYREDLLAAIGDHQILVIEGETGSGKTTQIPQYLLEEGYTKGGMKIGCTQPRRVAAMSVAARVAQEMSVKLGNEVGYSIRFEDCTSERTILKYMTDGMLLREFLTEPDLASYSVIIIDEAHERTLHTDILFGLIKDIARFRPDLKVLVASATLDTERFSSFFDDAPVFRIPGRRFPVDIYYTKAPEADYLEACVVSVLQIHVTQSPGDVLVFLTGQEEIEACCELLQERCRRLGSKISELLVLPIYANLPSDMQAKIFNPTPPGARKVVVATNIAETSLTIDGIIYVIDPGFCKQKSYNAKTGMESLIVTPCSRASANQRAGRAGRVAAGKCFRLYTAWAFKHEMEETTVPEIQRTNLGNVVLLLKSLGINDLIHFDFMDPPPHETLVLALEQLYALGALNHLGELTKLGRRMAELPVDPMLSKMILASEQYKCSEEVLTIAAMLSVNNSIFYRPKDKVVHADNARMNFVVPGGDHLVLLNVYTQWVESGYSTQWCFENFIQFRSMKRARDVRDQLEGLMDRIEVELCSSNGDSMPIRKAVTAGYFYHTARLSKGGYKTVKHQQTVYVHPNS--SLFEEQPRWMIYHELVFTTKEFMRQVIEIESGWLLEVAPHYYKNKELE-DSSSKKMPR 1044          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 vs. Ensembl Zebrafish
Match: AL833789.3 (DEAH (Asp-Glu-Ala-His) box polypeptide 8 [Source:NCBI gene;Acc:606595])

HSP 1 Score: 681.404 bits (1757), Expect = 0.000e+0
Identity = 339/647 (52.40%), Postives = 471/647 (72.80%), Query Frame = 3
Query:  750 LAISQVQKLLPIYRLKNELIKMIAENQIVVIEGETGSGKTTQIPQYLYEAGYCVEDKIIGCTQPXXXXXXXXXXXXXQEMNVKLGDKVGYSVRFEAKVSEQTQIKYMTDGMLLREFLNDPTVGMYSVLIIDEAHERTLQTDILFGLLSAVTEVRKDLKIIISSATCDVEKFCQFF-EAPFFKIPGRRYPVETFYTKDQEADFVEAAVVTILQIHITQSDGDILVFLTGQEDIEEAMDSLQERIKALGTKIRELIVLPIYSALPSEKQAKIFLPTPPGARKVVLATNIAETSLTIDGIRFVIDCGYCKVKCYDPRSRMDSLKVVPITKANAIQRSGRAGRIAPGKCFRLYKKYTFDEEFEDQAIPEIQRTNLGNVVLLLKSLGIEDILDFDYMDPPFEKSLLAAIEELYYLSAIDSKGGLSLIGRKMVEIPCDPMISNMILKSEKYGCSEEIITIAAMLSLDNTIFYSPKNKKLYASQAHRAFMQEEGDHLTLLKVYNEYANNDYSSDWCKDNYIQSRSMKMARNIRDQLVNLADRLELKLISNSEDTVGICKAITAGFFLNTARFNG-DSYRRIKSKDSVYMQMNSVFRILDEHPRYVVFNNIVNTTKEYMRTCTRIEPRWLTDIAPHIYKDIDFEGDSKYKRMPKL 2684
            L+I + ++ LPIY+LK +LI+ + +NQI+++ GETGSGKTTQI QYL EAGY    KI GCTQPRRVAAMSVA RV++E    LG +VGY++RFE   S +T IKYMTDGMLLRE L DP +G Y+++++DEAHERT+ TD+LFGLL    + R D+K+I++SAT D  KF Q+F EAP F IPGR YPVE  YTK+ E D+++A+++T++QIH+T+  GDILVFLTGQE+I+ A + L ER+K+LG  + ELI+LP+YSALPSE Q +IF P PPG+RKVV+ATNIAETSLTIDGI +V+D G+ K K Y+ ++ +D L V PI++A A QR+GRAGR  PGKC+RLY +  + +E     +PEIQRTNL + VL LK++GI D+L FD+MD P  ++L+ A+E+LY L A+D +G L+ +GR+M E P +PM+  M++ S   GCSEE++TI +MLS+ N +FY PK+K+  A Q    F Q EGDHLTLL VYN + NN +S+ WC +N+IQ+RS++ A++IR Q++ + DR +L ++S  + TV + KAI +GFF N A+ +  + YR +  +  VY+  +S   + +  P +VV++ +V TTKEYMR  T I+PRWL + AP  +K  D    SK K+  +L
Sbjct:  493 LSILEQRESLPIYKLKEQLIQAVHDNQILIVIGETGSGKTTQITQYLAEAGYTTRGKI-GCTQPRRVAAMSVAKRVSEEYGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPDLGQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRTDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEVLYTKEPETDYLDASLITVMQIHLTEPPGDILVFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQN-VFYRPKDKQALADQKKAKFHQPEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKATVRVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSA--LFNRQPEWVVYHELVLTTKEYMREVTTIDPRWLVEFAPAFFKVSDPTRLSKQKKQQRL 1135          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 vs. Ensembl Zebrafish
Match: dhx8 (DEAH (Asp-Glu-Ala-His) box polypeptide 8 [Source:ZFIN;Acc:ZDB-GENE-050809-39])

HSP 1 Score: 681.404 bits (1757), Expect = 0.000e+0
Identity = 339/647 (52.40%), Postives = 471/647 (72.80%), Query Frame = 3
Query:  750 LAISQVQKLLPIYRLKNELIKMIAENQIVVIEGETGSGKTTQIPQYLYEAGYCVEDKIIGCTQPXXXXXXXXXXXXXQEMNVKLGDKVGYSVRFEAKVSEQTQIKYMTDGMLLREFLNDPTVGMYSVLIIDEAHERTLQTDILFGLLSAVTEVRKDLKIIISSATCDVEKFCQFF-EAPFFKIPGRRYPVETFYTKDQEADFVEAAVVTILQIHITQSDGDILVFLTGQEDIEEAMDSLQERIKALGTKIRELIVLPIYSALPSEKQAKIFLPTPPGARKVVLATNIAETSLTIDGIRFVIDCGYCKVKCYDPRSRMDSLKVVPITKANAIQRSGRAGRIAPGKCFRLYKKYTFDEEFEDQAIPEIQRTNLGNVVLLLKSLGIEDILDFDYMDPPFEKSLLAAIEELYYLSAIDSKGGLSLIGRKMVEIPCDPMISNMILKSEKYGCSEEIITIAAMLSLDNTIFYSPKNKKLYASQAHRAFMQEEGDHLTLLKVYNEYANNDYSSDWCKDNYIQSRSMKMARNIRDQLVNLADRLELKLISNSEDTVGICKAITAGFFLNTARFNG-DSYRRIKSKDSVYMQMNSVFRILDEHPRYVVFNNIVNTTKEYMRTCTRIEPRWLTDIAPHIYKDIDFEGDSKYKRMPKL 2684
            L+I + ++ LPIY+LK +LI+ + +NQI+++ GETGSGKTTQI QYL EAGY    KI GCTQPRRVAAMSVA RV++E    LG +VGY++RFE   S +T IKYMTDGMLLRE L DP +G Y+++++DEAHERT+ TD+LFGLL    + R D+K+I++SAT D  KF Q+F EAP F IPGR YPVE  YTK+ E D+++A+++T++QIH+T+  GDILVFLTGQE+I+ A + L ER+K+LG  + ELI+LP+YSALPSE Q +IF P PPG+RKVV+ATNIAETSLTIDGI +V+D G+ K K Y+ ++ +D L V PI++A A QR+GRAGR  PGKC+RLY +  + +E     +PEIQRTNL + VL LK++GI D+L FD+MD P  ++L+ A+E+LY L A+D +G L+ +GR+M E P +PM+  M++ S   GCSEE++TI +MLS+ N +FY PK+K+  A Q    F Q EGDHLTLL VYN + NN +S+ WC +N+IQ+RS++ A++IR Q++ + DR +L ++S  + TV + KAI +GFF N A+ +  + YR +  +  VY+  +S   + +  P +VV++ +V TTKEYMR  T I+PRWL + AP  +K  D    SK K+  +L
Sbjct:  546 LSILEQRESLPIYKLKEQLIQAVHDNQILIVIGETGSGKTTQITQYLAEAGYTTRGKI-GCTQPRRVAAMSVAKRVSEEYGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPDLGQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRTDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEVLYTKEPETDYLDASLITVMQIHLTEPPGDILVFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQN-VFYRPKDKQALADQKKAKFHQPEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKATVRVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSA--LFNRQPEWVVYHELVLTTKEYMREVTTIDPRWLVEFAPAFFKVSDPTRLSKQKKQQRL 1188          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 vs. Ensembl Xenopus
Match: dhx16 (DEAH-box helicase 16 [Source:NCBI gene;Acc:100127179])

HSP 1 Score: 823.928 bits (2127), Expect = 0.000e+0
Identity = 438/898 (48.78%), Postives = 620/898 (69.04%), Query Frame = 3
Query:  102 KKTSEDEEHLTEKQRIKE------YSQRISEKEKSKNKNYVSGQTNEKKFRSQAMKY-----RDNETVTENIRIKSRQEYLLKRKADKIEDLHYDLIEDELYFKKEELTNRELKEKEAKKMIYKVAKMQEKSVKK----VNEKYYTIPSNDSTIVMNVTEERKKSRKGGLNEWET-------------LQLKNAIDQGKVSRRQDDEYELLVDE-----FVDYEQEETLIPQNPEELTEKVIEKIDEKDLAISQVQKLLPIYRLKNELIKMIAENQIVVIEGETGSGKTTQIPQYLYEAGYCVEDKIIGCTQPXXXXXXXXXXXXXQEMNVKLGDKVGYSVRFEAKVSEQTQIKYMTDGMLLREFLNDPTVGMYSVLIIDEAHERTLQTDILFGLLSAVTEVRKDLKIIISSATCDVEKFCQFFE-APFFKIPGRRYPVETFYTKDQEADFVEAAVVTILQIHITQSDGDILVFLTGQEDIEEAMDSLQERIKALGTKIRELIVLPIYSALPSEKQAKIFLPTPPGARKVVLATNIAETSLTIDGIRFVIDCGYCKVKCYDPRSRMDSLKVVPITKANAIQRSGRAGRIAPGKCFRLYKKYTFDEEFEDQAIPEIQRTNLGNVVLLLKSLGIEDILDFDYMDPPFEKSLLAAIEELYYLSAIDSKGGLSLIGRKMVEIPCDPMISNMILKSEKYGCSEEIITIAAMLSLDNTIFYSPKNKKLYASQAHRAFMQEEGDHLTLLKVYNEYANNDYSSDWCKDNYIQSRSMKMARNIRDQLVNLADRLELKLISNSEDTVGICKAITAGFFLNTARFNGDSYRRIKSKDSVYMQMNSVFRILDEHPRYVVFNNIVNTTKEYMRTCTRIEPRWLTDIAPHIYKDIDFEGDSKYKRMPKLAKK 2693
            +KTSEDE+   E  R+K+      +++R+ +++K K +N V  + ++KK   +A K       D + +   +R KSR+EYL KR+ +K+EDL  ++ ++E  F + ELT+ E KE E K+ +  +AK  +K+  K     +++Y+    N S  + +  EE     +    E +                 K+A D GK       EY+ +++E     FV   Q +  I  + EE   +V+ + + K L+I +V++ LP++  +++L++ I+++QI++IEGETGSGKTTQIPQYL+E GY      IGCTQPRRVAAMSV++RV+QEM VKLG++VGYS+RFE   SE+T +KYMTDGMLLREFL +P +  YSV+IIDEAHERTL TD+LFGL+  +   R+DLK++++SAT + E+F  FF+ AP F+IPGRRYPV+ +YTK  EAD++EA VV++LQIH+TQ  GDILVFLTGQE+IE   + LQER + LG+KI E++VLPIY+ LPS+ QAKIF PTPPGARKVV+ATNIAETSLTIDGI +VID G+CK K Y+ RS M+SL V P +KA+A QR+GRAGR+A GKCFRLY  + +  E ED  +PEIQRTNLGNVVLLLKSLGI D++ FD+MDPP  ++L+ A+E+LY L A++  G L+ +GR+M E+P DPM+S +IL SE+YGCSE+I+TIAAMLS++NTIFY PK+K ++A  A   F    GDH+ LL VY ++  + +S  WC +N+IQ+RS++ AR++R+QL  L  R+E++L S   D++ + KAITAG+F +TAR     Y+ +K + +VY+  NS     +E PR+V+++ +V TTKEYMR    I+  WL ++APH YK  + E D   K+MP+ A K
Sbjct:  144 QKTSEDEDEKEELARLKDLEERDAFAERVKKRDKEKTRNIV--ERSDKKAYEEAQKRLKLAEEDRKKMIPELRKKSRREYLNKREKEKLEDLEAEIADEEYLFVEPELTSVEQKELEYKRRVRDLAKEYKKAGDKERMEKHDRYFMPEENRSKKIPDRYEEPMSEERFAPREEQRRWEEEHIGAASLRFGAKDAHDHGK------KEYDFVMEENEVIQFVSSAQMKGTI--DKEEENSEVLSESERKKLSIQEVRRSLPVFPYRSDLLQAISDHQILIIEGETGSGKTTQIPQYLHEHGYTKNGLKIGCTQPRRVAAMSVSARVSQEMGVKLGNEVGYSIRFEDCTSERTVLKYMTDGMLLREFLTEPDLASYSVIIIDEAHERTLHTDVLFGLIKDIARFRQDLKVLVASATLNTERFSSFFDDAPVFRIPGRRYPVDIYYTKAPEADYLEACVVSVLQIHVTQPPGDILVFLTGQEEIETCCEMLQERCRRLGSKIAEMLVLPIYANLPSDMQAKIFEPTPPGARKVVIATNIAETSLTIDGIIYVIDPGFCKQKSYNARSGMESLIVTPCSKASANQRAGRAGRVAAGKCFRLYTAWAYKNEMEDTTVPEIQRTNLGNVVLLLKSLGINDLIHFDFMDPPPHETLVLALEQLYALGALNHLGELTKLGRRMAELPVDPMLSKIILASEQYGCSEQILTIAAMLSVNNTIFYRPKDKLVHADTARANFTVPGGDHMVLLNVYTQWVESGHSLQWCYENFIQARSLRRARDVREQLEGLMGRIEIELTSCEGDSIPVRKAITAGYFYHTARLTRSGYKTVKQQQAVYIHPNSSLH--EEQPRWVIYHELVFTTKEYMRQIIEIDSTWLLEVAPHYYKSRELE-DPTSKKMPRKAGK 1028          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 vs. Ensembl Xenopus
Match: dhx16 (DEAH-box helicase 16 [Source:NCBI gene;Acc:100127179])

HSP 1 Score: 823.543 bits (2126), Expect = 0.000e+0
Identity = 438/898 (48.78%), Postives = 620/898 (69.04%), Query Frame = 3
Query:  102 KKTSEDEEHLTEKQRIKE------YSQRISEKEKSKNKNYVSGQTNEKKFRSQAMKY-----RDNETVTENIRIKSRQEYLLKRKADKIEDLHYDLIEDELYFKKEELTNRELKEKEAKKMIYKVAKMQEKSVKK----VNEKYYTIPSNDSTIVMNVTEERKKSRKGGLNEWET-------------LQLKNAIDQGKVSRRQDDEYELLVDE-----FVDYEQEETLIPQNPEELTEKVIEKIDEKDLAISQVQKLLPIYRLKNELIKMIAENQIVVIEGETGSGKTTQIPQYLYEAGYCVEDKIIGCTQPXXXXXXXXXXXXXQEMNVKLGDKVGYSVRFEAKVSEQTQIKYMTDGMLLREFLNDPTVGMYSVLIIDEAHERTLQTDILFGLLSAVTEVRKDLKIIISSATCDVEKFCQFFE-APFFKIPGRRYPVETFYTKDQEADFVEAAVVTILQIHITQSDGDILVFLTGQEDIEEAMDSLQERIKALGTKIRELIVLPIYSALPSEKQAKIFLPTPPGARKVVLATNIAETSLTIDGIRFVIDCGYCKVKCYDPRSRMDSLKVVPITKANAIQRSGRAGRIAPGKCFRLYKKYTFDEEFEDQAIPEIQRTNLGNVVLLLKSLGIEDILDFDYMDPPFEKSLLAAIEELYYLSAIDSKGGLSLIGRKMVEIPCDPMISNMILKSEKYGCSEEIITIAAMLSLDNTIFYSPKNKKLYASQAHRAFMQEEGDHLTLLKVYNEYANNDYSSDWCKDNYIQSRSMKMARNIRDQLVNLADRLELKLISNSEDTVGICKAITAGFFLNTARFNGDSYRRIKSKDSVYMQMNSVFRILDEHPRYVVFNNIVNTTKEYMRTCTRIEPRWLTDIAPHIYKDIDFEGDSKYKRMPKLAKK 2693
            +KTSEDE+   E  R+K+      +++R+ +++K K +N V  + ++KK   +A K       D + +   +R KSR+EYL KR+ +K+EDL  ++ ++E  F + ELT+ E KE E K+ +  +AK  +K+  K     +++Y+    N S  + +  EE     +    E +                 K+A D GK       EY+ +++E     FV   Q +  I  + EE   +V+ + + K L+I +V++ LP++  +++L++ I+++QI++IEGETGSGKTTQIPQYL+E GY      IGCTQPRRVAAMSV++RV+QEM VKLG++VGYS+RFE   SE+T +KYMTDGMLLREFL +P +  YSV+IIDEAHERTL TD+LFGL+  +   R+DLK++++SAT + E+F  FF+ AP F+IPGRRYPV+ +YTK  EAD++EA VV++LQIH+TQ  GDILVFLTGQE+IE   + LQER + LG+KI E++VLPIY+ LPS+ QAKIF PTPPGARKVV+ATNIAETSLTIDGI +VID G+CK K Y+ RS M+SL V P +KA+A QR+GRAGR+A GKCFRLY  + +  E ED  +PEIQRTNLGNVVLLLKSLGI D++ FD+MDPP  ++L+ A+E+LY L A++  G L+ +GR+M E+P DPM+S +IL SE+YGCSE+I+TIAAMLS++NTIFY PK+K ++A  A   F    GDH+ LL VY ++  + +S  WC +N+IQ+RS++ AR++R+QL  L  R+E++L S   D++ + KAITAG+F +TAR     Y+ +K + +VY+  NS     +E PR+V+++ +V TTKEYMR    I+  WL ++APH YK  + E D   K+MP+ A K
Sbjct:  143 QKTSEDEDEKEELARLKDLEERDAFAERVKKRDKEKTRNIV--ERSDKKAYEEAQKRLKLAEEDRKKMIPELRKKSRREYLNKREKEKLEDLEAEIADEEYLFVEPELTSVEQKELEYKRRVRDLAKEYKKAGDKERMEKHDRYFMPEENRSKKIPDRYEEPMSEERFAPREEQRRWEEEHIGAASLRFGAKDAHDHGK------KEYDFVMEENEVIQFVSSAQMKGTI--DKEEENSEVLSESERKKLSIQEVRRSLPVFPYRSDLLQAISDHQILIIEGETGSGKTTQIPQYLHEHGYTKNGLKIGCTQPRRVAAMSVSARVSQEMGVKLGNEVGYSIRFEDCTSERTVLKYMTDGMLLREFLTEPDLASYSVIIIDEAHERTLHTDVLFGLIKDIARFRQDLKVLVASATLNTERFSSFFDDAPVFRIPGRRYPVDIYYTKAPEADYLEACVVSVLQIHVTQPPGDILVFLTGQEEIETCCEMLQERCRRLGSKIAEMLVLPIYANLPSDMQAKIFEPTPPGARKVVIATNIAETSLTIDGIIYVIDPGFCKQKSYNARSGMESLIVTPCSKASANQRAGRAGRVAAGKCFRLYTAWAYKNEMEDTTVPEIQRTNLGNVVLLLKSLGINDLIHFDFMDPPPHETLVLALEQLYALGALNHLGELTKLGRRMAELPVDPMLSKIILASEQYGCSEQILTIAAMLSVNNTIFYRPKDKLVHADTARANFTVPGGDHMVLLNVYTQWVESGHSLQWCYENFIQARSLRRARDVREQLEGLMGRIEIELTSCEGDSIPVRKAITAGYFYHTARLTRSGYKTVKQQQAVYIHPNSSLH--EEQPRWVIYHELVFTTKEYMRQIIEIDSTWLLEVAPHYYKSRELE-DPTSKKMPRKAGK 1027          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 vs. Ensembl Xenopus
Match: dhx16 (DEAH-box helicase 16 [Source:NCBI gene;Acc:100127179])

HSP 1 Score: 770.385 bits (1988), Expect = 0.000e+0
Identity = 372/659 (56.45%), Postives = 506/659 (76.78%), Query Frame = 3
Query:  720 KVIEKIDEKDLAISQVQKLLPIYRLKNELIKMIAENQIVVIEGETGSGKTTQIPQYLYEAGYCVEDKIIGCTQPXXXXXXXXXXXXXQEMNVKLGDKVGYSVRFEAKVSEQTQIKYMTDGMLLREFLNDPTVGMYSVLIIDEAHERTLQTDILFGLLSAVTEVRKDLKIIISSATCDVEKFCQFFE-APFFKIPGRRYPVETFYTKDQEADFVEAAVVTILQIHITQSDGDILVFLTGQEDIEEAMDSLQERIKALGTKIRELIVLPIYSALPSEKQAKIFLPTPPGARKVVLATNIAETSLTIDGIRFVIDCGYCKVKCYDPRSRMDSLKVVPITKANAIQRSGRAGRIAPGKCFRLYKKYTFDEEFEDQAIPEIQRTNLGNVVLLLKSLGIEDILDFDYMDPPFEKSLLAAIEELYYLSAIDSKGGLSLIGRKMVEIPCDPMISNMILKSEKYGCSEEIITIAAMLSLDNTIFYSPKNKKLYASQAHRAFMQEEGDHLTLLKVYNEYANNDYSSDWCKDNYIQSRSMKMARNIRDQLVNLADRLELKLISNSEDTVGICKAITAGFFLNTARFNGDSYRRIKSKDSVYMQMNSVFRILDEHPRYVVFNNIVNTTKEYMRTCTRIEPRWLTDIAPHIYKDIDFEGDSKYKRMPKLAKK 2693
            +V+ + + K L+I +V++ LP++  +++L++ I+++QI++IEGETGSGKTTQIPQYL+E GY      IGCTQPRRVAAMSV++RV+QEM VKLG++VGYS+RFE   SE+T +KYMTDGMLLREFL +P +  YSV+IIDEAHERTL TD+LFGL+  +   R+DLK++++SAT + E+F  FF+ AP F+IPGRRYPV+ +YTK  EAD++EA VV++LQIH+TQ  GDILVFLTGQE+IE   + LQER + LG+KI E++VLPIY+ LPS+ QAKIF PTPPGARKVV+ATNIAETSLTIDGI +VID G+CK K Y+ RS M+SL V P +KA+A QR+GRAGR+A GKCFRLY  + +  E ED  +PEIQRTNLGNVVLLLKSLGI D++ FD+MDPP  ++L+ A+E+LY L A++  G L+ +GR+M E+P DPM+S +IL SE+YGCSE+I+TIAAMLS++NTIFY PK+K ++A  A   F    GDH+ LL VY ++  + +S  WC +N+IQ+RS++ AR++R+QL  L  R+E++L S   D++ + KAITAG+F +TAR     Y+ +K + +VY+  NS     +E PR+V+++ +V TTKEYMR   +I+  WL ++APH YK  + E D   K+MP+ A K
Sbjct:    8 EVLSESERKKLSIQEVRRSLPVFPYRSDLLQAISDHQILIIEGETGSGKTTQIPQYLHEHGYTKNGLKIGCTQPRRVAAMSVSARVSQEMGVKLGNEVGYSIRFEDCTSERTVLKYMTDGMLLREFLTEPDLASYSVIIIDEAHERTLHTDVLFGLIKDIARFRQDLKVLVASATLNTERFSSFFDDAPVFRIPGRRYPVDIYYTKAPEADYLEACVVSVLQIHVTQPPGDILVFLTGQEEIETCCEMLQERCRRLGSKIAEMLVLPIYANLPSDMQAKIFEPTPPGARKVVIATNIAETSLTIDGIIYVIDPGFCKQKSYNARSGMESLIVTPCSKASANQRAGRAGRVAAGKCFRLYTAWAYKNEMEDTTVPEIQRTNLGNVVLLLKSLGINDLIHFDFMDPPPHETLVLALEQLYALGALNHLGELTKLGRRMAELPVDPMLSKIILASEQYGCSEQILTIAAMLSVNNTIFYRPKDKLVHADTARANFTVPGGDHMVLLNVYTQWVESGHSLQWCYENFIQARSLRRARDVREQLEGLMGRIEIELTSCEGDSIPVRKAITAGYFYHTARLTRSGYKTVKQQQAVYIHPNSSLH--EEQPRWVIYHELVFTTKEYMRQ-VKIDSTWLLEVAPHYYKSRELE-DPTSKKMPRKAGK 662          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 vs. Ensembl Xenopus
Match: dhx16 (DEAH-box helicase 16 [Source:NCBI gene;Acc:100127179])

HSP 1 Score: 759.214 bits (1959), Expect = 0.000e+0
Identity = 383/707 (54.17%), Postives = 519/707 (73.41%), Query Frame = 3
Query:  591 KNAIDQGKVSRRQDDEYELLVDE-----FVDYEQEETLIPQNPEELTEKVIEKIDEKDLAISQVQKLLPIYRLKNELIKMIAENQIVVIEGETGSGKTTQIPQYLYEAGYCVEDKIIGCTQPXXXXXXXXXXXXXQEMNVKLGDKVGYSVRFEAKVSEQTQIKYMTDGMLLREFLNDPTVGMYSVLIIDEAHERTLQTDILFGLLSAVTEVRKDLKIIISSATCDVEKFCQFFE-APFFKIPGRRYPVETFYTKDQEADFVEAAVVTILQIHITQSDGDILVFLTGQEDIEEAMDSLQERIKALGTKIRELIVLPIYSALPSEKQAKIFLPTPPGARKVVLATNIAETSLTIDGIRFVIDCGYCKVKCYDPRSRMDSLKVVPITKANAIQRSGRAGRIAPGKCFRLYKKYTFDEEFEDQAIPEIQRTNLGNVVLLLKSLGIEDILDFDYMDPPFEKSLLAAIEELYYLSAIDSKGGLSLIGRKMVEIPCDPMISNMILKSEKYGCSEEIITIAAMLSLDNTIFYSPKNKKLYASQAHRAFMQEEGDHLTLLKVYNEYANNDYSSDWCKDNYIQSRSMKMARNIRDQLVNLADRLELKLISNSEDTVGICKAITAGFFLNTARFNGDSYRRIKSKDSVYMQMNSVFRILDEHPRYVVFNNIVNTTKEYMRTCTRIEPRWLTDIAPHIYKDIDFEGDSKYKRMPKLAKK 2693
            K+A D GK       EY+ +++E     FV   Q +  I +  E    +V+ + + K L+I +V++ LP++  +++L++ I+++QI++IEGETGSGKTTQIPQYL+E GY      IGCTQPRRVAAMSV++RV+QEM VKLG++VGYS+RFE   SE+T +KYMTDGMLLREFL +P +  YSV+IIDEAHERTL TD+LFGL+  +   R+DLK++++SAT + E+F  FF+ AP F+IPGRRYPV+ +YTK  EAD++EA VV++LQIH+TQ  GDILVFLTGQE+IE   + LQER + LG+KI E++VLPIY+ LPS+ QAKIF PTPPGARKVV+ATNIAETSLTIDGI +VID G+CK K Y+ RS M+SL V P +KA+A QR+GRAGR+A GKCFRLY  + +  E ED  +PEIQRTNLGNVVLLLKSLGI D++ FD+MDPP  ++L+ A+E+LY L A++  G L+ +GR+M E+P DPM+S +IL SE+YGCSE+I+TIAAMLS++NTIFY PK+K ++A  A   F    GDH+ LL VY +   + +S  WC +N+IQ+RS++ AR++R+QL  L  R+E++ I        I  AITAG+F +TAR     Y+ +K + +VY+  NS     +E PR+V+++ +V TTKEYMR    I+  WL ++APH YK  + E D   K+MP+ A K
Sbjct:   59 KDAHDHGK------KEYDFVMEENEVIQFVSSAQMKGTIDKVQE--NSEVLSESERKKLSIQEVRRSLPVFPYRSDLLQAISDHQILIIEGETGSGKTTQIPQYLHEHGYTKNGLKIGCTQPRRVAAMSVSARVSQEMGVKLGNEVGYSIRFEDCTSERTVLKYMTDGMLLREFLTEPDLASYSVIIIDEAHERTLHTDVLFGLIKDIARFRQDLKVLVASATLNTERFSSFFDDAPVFRIPGRRYPVDIYYTKAPEADYLEACVVSVLQIHVTQPPGDILVFLTGQEEIETCCEMLQERCRRLGSKIAEMLVLPIYANLPSDMQAKIFEPTPPGARKVVIATNIAETSLTIDGIIYVIDPGFCKQKSYNARSGMESLIVTPCSKASANQRAGRAGRVAAGKCFRLYTAWAYKNEMEDTTVPEIQRTNLGNVVLLLKSLGINDLIHFDFMDPPPHETLVLALEQLYALGALNHLGELTKLGRRMAELPVDPMLSKIILASEQYGCSEQILTIAAMLSVNNTIFYRPKDKLVHADTARANFTVPGGDHMVLLNVYTQ---SGHSLQWCYENFIQARSLRRARDVREQLEGLMGRIEIEYIFRY-----ILNAITAGYFYHTARLTRSGYKTVKQQQAVYIHPNSSLH--EEQPRWVIYHELVFTTKEYMRQIIEIDSTWLLEVAPHYYKSRELE-DPTSKKMPRKAGK 746          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 vs. Ensembl Xenopus
Match: rps15a (ribosomal protein S15a [Source:Xenbase;Acc:XB-GENE-981311])

HSP 1 Score: 678.322 bits (1749), Expect = 0.000e+0
Identity = 336/647 (51.93%), Postives = 470/647 (72.64%), Query Frame = 3
Query:  750 LAISQVQKLLPIYRLKNELIKMIAENQIVVIEGETGSGKTTQIPQYLYEAGYCVEDKIIGCTQPXXXXXXXXXXXXXQEMNVKLGDKVGYSVRFEAKVSEQTQIKYMTDGMLLREFLNDPTVGMYSVLIIDEAHERTLQTDILFGLLSAVTEVRKDLKIIISSATCDVEKFCQFF-EAPFFKIPGRRYPVETFYTKDQEADFVEAAVVTILQIHITQSDGDILVFLTGQEDIEEAMDSLQERIKALGTKIRELIVLPIYSALPSEKQAKIFLPTPPGARKVVLATNIAETSLTIDGIRFVIDCGYCKVKCYDPRSRMDSLKVVPITKANAIQRSGRAGRIAPGKCFRLYKKYTFDEEFEDQAIPEIQRTNLGNVVLLLKSLGIEDILDFDYMDPPFEKSLLAAIEELYYLSAIDSKGGLSLIGRKMVEIPCDPMISNMILKSEKYGCSEEIITIAAMLSLDNTIFYSPKNKKLYASQAHRAFMQEEGDHLTLLKVYNEYANNDYSSDWCKDNYIQSRSMKMARNIRDQLVNLADRLELKLISNSEDTVGICKAITAGFFLNTARFNG-DSYRRIKSKDSVYMQMNSVFRILDEHPRYVVFNNIVNTTKEYMRTCTRIEPRWLTDIAPHIYKDIDFEGDSKYKRMPKL 2684
            ++I + ++ LPIY+LK +L++ + +NQI+++ GETGSGKTTQI QYL EAGY    KI GCTQPRRVAAMSVA RV++E    LG +VGY++RFE   S +T IKYMTDGMLLRE L DP +  Y+++++DEAHERT+ TD+LFGLL    + R D+K+I++SAT D  KF Q+F EAP F IPGR YPVE  YTK+ E D+++A+++T++QIH+T+  GDILVFLTGQE+I+ A + L ER+K+LG  + ELI+LP+YSALPSE Q +IF P PPG+RKVV+ATNIAETSLTIDGI +V+D G+ K K Y+ ++ +D L V PI++A A QR+GRAGR  PGKC+RLY +  + +E     +PEIQRTNL + VL LK++GI D+L FD+MD P  ++L+ A+E+LY L A+D +G L+ +GR+M E P +PM+  M++ S   GCSEE++TI +MLS+ N +FY PK+K+  A Q    F Q EGDHLTLL VYN + NN +S+ WC +N+IQ+RS++ A++IR Q++ + DR +L ++S  + TV + KAI +GFF N A+ +  + YR +  +  VY+  +S   + +  P +VV++ +V TTKEYMR  T I+PRWL + AP  +K  D    SK K+  +L
Sbjct:  549 MSIVEQRESLPIYKLKEQLVQAVHDNQILIVIGETGSGKTTQITQYLAEAGYTTRGKI-GCTQPRRVAAMSVAKRVSEEYGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPDLTQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRPDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEILYTKEPETDYLDASLITVMQIHLTEPPGDILVFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQN-VFYRPKDKQALADQKKAKFHQTEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKATVRVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSA--LFNRQPEWVVYHELVLTTKEYMREVTTIDPRWLVEFAPAFFKVSDPTKLSKQKKQQRL 1191          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 vs. Ensembl Mouse
Match: Dhx16 (DEAH (Asp-Glu-Ala-His) box polypeptide 16 [Source:MGI Symbol;Acc:MGI:1916442])

HSP 1 Score: 821.617 bits (2121), Expect = 0.000e+0
Identity = 428/885 (48.36%), Postives = 613/885 (69.27%), Query Frame = 3
Query:  102 KKTSEDEEHLTEKQRIKE------YSQRISEKEKSKNKNYVSGQTNEKKFRSQA-----MKYRDNETVTENIRIKSRQEYLLKRKADKIEDLHYDLIEDELYFKKEELTNRELKEKEAKKMI------YKVAKMQEKSVKKVNEKYYTIPS---NDSTIVMNVTEERKKSRKGGLNEWETLQLKNAIDQ--GKVSRRQDDEYELLV--DEFVDYEQEETLIPQNPEELTEKVIEKIDEKDLAISQVQKLLPIYRLKNELIKMIAENQIVVIEGETGSGKTTQIPQYLYEAGYCVEDKIIGCTQPXXXXXXXXXXXXXQEMNVKLGDKVGYSVRFEAKVSEQTQIKYMTDGMLLREFLNDPTVGMYSVLIIDEAHERTLQTDILFGLLSAVTEVRKDLKIIISSATCDVEKFCQFFE-APFFKIPGRRYPVETFYTKDQEADFVEAAVVTILQIHITQSDGDILVFLTGQEDIEEAMDSLQERIKALGTKIRELIVLPIYSALPSEKQAKIFLPTPPGARKVVLATNIAETSLTIDGIRFVIDCGYCKVKCYDPRSRMDSLKVVPITKANAIQRSGRAGRIAPGKCFRLYKKYTFDEEFEDQAIPEIQRTNLGNVVLLLKSLGIEDILDFDYMDPPFEKSLLAAIEELYYLSAIDSKGGLSLIGRKMVEIPCDPMISNMILKSEKYGCSEEIITIAAMLSLDNTIFYSPKNKKLYASQAHRAFMQEEGDHLTLLKVYNEYANNDYSSDWCKDNYIQSRSMKMARNIRDQLVNLADRLELKLISNSEDTVGICKAITAGFFLNTARFNGDSYRRIKSKDSVYMQMNSVFRILDEHPRYVVFNNIVNTTKEYMRTCTRIEPRWLTDIAPHIYKDIDFEGDSKYKRMPK 2681
            K  SEDE   TE++R+++      +++R+ +++K + +N +  + ++KK   +A     M   D + +   +R KSR+EYL KR+ +K+EDL  +L ++E+ F   EL+  E +E + K+ +      Y+ A  QEK ++  N   Y +P          +++ EE   +       WE  QL  A  +   + +  Q+ +Y+L++  DE +++ +   L  Q  EE +   +    ++  +I  V++ LP++  + EL+  IA +Q+++IEGETGSGKTTQIPQYL+E GY  +   I CTQPRRVAAMSVA+RVA+EM VKLG++VGYS+RFE   SE+T ++YMTDGMLLREFL++P +  YSV+++DEAHERTL TDILFGL+  V   R +LK++++SAT D  +F  FF+ AP F+IPGRR+PV+ FYTK  EAD++EA VV++LQIH+TQ  GDILVFLTGQE+IE A + LQ+R + LG+KIREL+VLPIY+ LPS+ QA+IF PTPPGARKVV+ATNIAETSLTI+GI +V+D G+CK K Y+PR+ M+SL V P +KA+A QR+GRAGR+A GKCFRLY  + +  E E+  +PEIQRT+LGNVVLLLKSLGI D++ FD++DPP  ++LL A+E+LY L A++  G L+  GRKM E+P DPM+S MIL SEKY CSEEI+T+AAMLS++N+IFY PK+K ++A  A   F    GDHL LL VY ++A + YSS WC +N++Q RSM+ AR++R+QL  L +R+E+ L S   D V + KAIT+G+F +TAR     YR +K + +V++  NS   + ++ PR+++++ +V TTKE+MR    IE  WL ++APH YK  + E D   K+MPK
Sbjct:  160 KPASEDEWERTERERLQDLEERDAFAERVRQRDKDRTRNVL--ERSDKKAYEEAQKRLKMAEEDRKAMVPELRKKSRREYLAKREREKLEDLEAELADEEVLFGDVELSRHERRELKYKRRVRDLAREYRAAGEQEK-LEATNR--YHMPKETRGQPARTVDIVEEESGAPGEEQRRWEEAQLGAASLKFGARDAAAQEAKYQLVLEEDETIEFVRAAQL--QGDEEPSGPPLSAQAQQKESIQAVRRSLPVFPFREELLAAIANHQVLIIEGETGSGKTTQIPQYLFEEGYTKKGMKIACTQPRRVAAMSVAARVAREMGVKLGNEVGYSIRFEDCTSERTVLRYMTDGMLLREFLSEPDLASYSVVMVDEAHERTLHTDILFGLIKDVARFRPELKVLVASATLDTARFSAFFDDAPVFRIPGRRFPVDIFYTKAPEADYLEACVVSVLQIHVTQPPGDILVFLTGQEEIEAACEMLQDRCRRLGSKIRELLVLPIYANLPSDMQARIFQPTPPGARKVVVATNIAETSLTIEGIIYVLDPGFCKQKSYNPRTGMESLTVTPCSKASANQRAGRAGRVAAGKCFRLYTAWAYQHELEETTVPEIQRTSLGNVVLLLKSLGIHDLMHFDFLDPPPYETLLLALEQLYALGALNHLGELTTSGRKMAELPVDPMLSKMILASEKYSCSEEILTVAAMLSVNNSIFYRPKDKVVHADNARVNFFLPGGDHLVLLNVYTQWAESGYSSQWCYENFVQFRSMRRARDVREQLEGLLERVEVGLTSCQGDYVRVRKAITSGYFYHTARLTRSGYRTVKQQQTVFIHPNS--SLFEQQPRWLLYHELVLTTKEFMRQVLEIESSWLLEVAPHYYKAKELE-DPHAKKMPK 1034          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 vs. Ensembl Mouse
Match: Dhx8 (DEAH (Asp-Glu-Ala-His) box polypeptide 8 [Source:MGI Symbol;Acc:MGI:1306823])

HSP 1 Score: 678.707 bits (1750), Expect = 0.000e+0
Identity = 336/647 (51.93%), Postives = 471/647 (72.80%), Query Frame = 3
Query:  750 LAISQVQKLLPIYRLKNELIKMIAENQIVVIEGETGSGKTTQIPQYLYEAGYCVEDKIIGCTQPXXXXXXXXXXXXXQEMNVKLGDKVGYSVRFEAKVSEQTQIKYMTDGMLLREFLNDPTVGMYSVLIIDEAHERTLQTDILFGLLSAVTEVRKDLKIIISSATCDVEKFCQFF-EAPFFKIPGRRYPVETFYTKDQEADFVEAAVVTILQIHITQSDGDILVFLTGQEDIEEAMDSLQERIKALGTKIRELIVLPIYSALPSEKQAKIFLPTPPGARKVVLATNIAETSLTIDGIRFVIDCGYCKVKCYDPRSRMDSLKVVPITKANAIQRSGRAGRIAPGKCFRLYKKYTFDEEFEDQAIPEIQRTNLGNVVLLLKSLGIEDILDFDYMDPPFEKSLLAAIEELYYLSAIDSKGGLSLIGRKMVEIPCDPMISNMILKSEKYGCSEEIITIAAMLSLDNTIFYSPKNKKLYASQAHRAFMQEEGDHLTLLKVYNEYANNDYSSDWCKDNYIQSRSMKMARNIRDQLVNLADRLELKLISNSEDTVGICKAITAGFFLNTARFNG-DSYRRIKSKDSVYMQMNSVFRILDEHPRYVVFNNIVNTTKEYMRTCTRIEPRWLTDIAPHIYKDIDFEGDSKYKRMPKL 2684
            ++I + ++ LPIY+LK +L++ + +NQI+++ GETGSGKTTQI QYL EAGY    KI GCTQPRRVAAMSVA RV++E    LG +VGY++RFE   S +T IKYMTDGMLLRE L DP +  Y+++++DEAHERT+ TD+LFGLL    + R+D+K+I++SAT D  KF Q+F EAP F IPGR YPVE  YTK+ E D+++A+++T++QIH+T+  GDILVFLTGQE+I+ A + L ER+K+LG  + ELI+LP+YSALPSE Q +IF P PPG+RKVV+ATNIAETSLTIDGI +V+D G+ K K Y+ ++ +D L V PI++A A QR+GRAGR  PGKC+RLY +  + +E     +PEIQRTNL + VL LK++GI D+L FD+MD P  ++L+ A+E+LY L A+D +G L+ +GR+M E P +PM+  M++ S   GCSEE++TI +MLS+ N +FY PK+K+  A Q    F Q EGDHLTLL VYN + NN +S+ WC +N+IQ+RS++ A++IR Q++ + DR +L ++S  + TV + KAI +GFF N A+ +  + YR +  +  VY+  +S   + +  P +VV++ +V TTKEYMR  T I+PRWL + AP  +K  D    SK K+  +L
Sbjct:  527 MSILEQRESLPIYKLKEQLVQAVHDNQILIVIGETGSGKTTQITQYLAEAGYTSRGKI-GCTQPRRVAAMSVAKRVSEEFGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPDLTQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRQDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEILYTKEPETDYLDASLITVMQIHLTEPPGDILVFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQN-VFYRPKDKQALADQKKAKFHQTEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKSTVRVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSA--LFNRQPEWVVYHELVLTTKEYMREVTTIDPRWLVEFAPAFFKVSDPTKLSKQKKQQRL 1169          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 vs. Ensembl Mouse
Match: Dhx8 (DEAH (Asp-Glu-Ala-His) box polypeptide 8 [Source:MGI Symbol;Acc:MGI:1306823])

HSP 1 Score: 678.707 bits (1750), Expect = 0.000e+0
Identity = 336/647 (51.93%), Postives = 471/647 (72.80%), Query Frame = 3
Query:  750 LAISQVQKLLPIYRLKNELIKMIAENQIVVIEGETGSGKTTQIPQYLYEAGYCVEDKIIGCTQPXXXXXXXXXXXXXQEMNVKLGDKVGYSVRFEAKVSEQTQIKYMTDGMLLREFLNDPTVGMYSVLIIDEAHERTLQTDILFGLLSAVTEVRKDLKIIISSATCDVEKFCQFF-EAPFFKIPGRRYPVETFYTKDQEADFVEAAVVTILQIHITQSDGDILVFLTGQEDIEEAMDSLQERIKALGTKIRELIVLPIYSALPSEKQAKIFLPTPPGARKVVLATNIAETSLTIDGIRFVIDCGYCKVKCYDPRSRMDSLKVVPITKANAIQRSGRAGRIAPGKCFRLYKKYTFDEEFEDQAIPEIQRTNLGNVVLLLKSLGIEDILDFDYMDPPFEKSLLAAIEELYYLSAIDSKGGLSLIGRKMVEIPCDPMISNMILKSEKYGCSEEIITIAAMLSLDNTIFYSPKNKKLYASQAHRAFMQEEGDHLTLLKVYNEYANNDYSSDWCKDNYIQSRSMKMARNIRDQLVNLADRLELKLISNSEDTVGICKAITAGFFLNTARFNG-DSYRRIKSKDSVYMQMNSVFRILDEHPRYVVFNNIVNTTKEYMRTCTRIEPRWLTDIAPHIYKDIDFEGDSKYKRMPKL 2684
            ++I + ++ LPIY+LK +L++ + +NQI+++ GETGSGKTTQI QYL EAGY    KI GCTQPRRVAAMSVA RV++E    LG +VGY++RFE   S +T IKYMTDGMLLRE L DP +  Y+++++DEAHERT+ TD+LFGLL    + R+D+K+I++SAT D  KF Q+F EAP F IPGR YPVE  YTK+ E D+++A+++T++QIH+T+  GDILVFLTGQE+I+ A + L ER+K+LG  + ELI+LP+YSALPSE Q +IF P PPG+RKVV+ATNIAETSLTIDGI +V+D G+ K K Y+ ++ +D L V PI++A A QR+GRAGR  PGKC+RLY +  + +E     +PEIQRTNL + VL LK++GI D+L FD+MD P  ++L+ A+E+LY L A+D +G L+ +GR+M E P +PM+  M++ S   GCSEE++TI +MLS+ N +FY PK+K+  A Q    F Q EGDHLTLL VYN + NN +S+ WC +N+IQ+RS++ A++IR Q++ + DR +L ++S  + TV + KAI +GFF N A+ +  + YR +  +  VY+  +S   + +  P +VV++ +V TTKEYMR  T I+PRWL + AP  +K  D    SK K+  +L
Sbjct:  580 MSILEQRESLPIYKLKEQLVQAVHDNQILIVIGETGSGKTTQITQYLAEAGYTSRGKI-GCTQPRRVAAMSVAKRVSEEFGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPDLTQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRQDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEILYTKEPETDYLDASLITVMQIHLTEPPGDILVFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQN-VFYRPKDKQALADQKKAKFHQTEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKSTVRVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSA--LFNRQPEWVVYHELVLTTKEYMREVTTIDPRWLVEFAPAFFKVSDPTKLSKQKKQQRL 1222          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 vs. Ensembl Mouse
Match: Dhx38 (DEAH (Asp-Glu-Ala-His) box polypeptide 38 [Source:MGI Symbol;Acc:MGI:1927617])

HSP 1 Score: 601.668 bits (1550), Expect = 0.000e+0
Identity = 349/844 (41.35%), Postives = 506/844 (59.95%), Query Frame = 3
Query:  108 TSEDEEHLTEKQRIKEYSQRISEKEKSKNKNYVSGQTNEKKFRSQAMKYRDNETVTENIRIKSRQEYLLKRKADKIEDLHYDLIEDELYFKKEELTNRELKEKEAKKMIYKVAKMQEKSVKKVNEKYYTIPSNDSTIVMNVTEERKKSRKGGLNEWETLQLKNAIDQGKVSRRQDDEYELLVDEFVDYEQEETLIPQNPEELTEKVIEKIDEKDLAISQVQKLLPIYRLKNELIKMIAENQIVVIEGETGSGKTTQIPQYLYEAGYCVEDKIIGCTQPXXXXXXXXXXXXXQEMNVKLGDKVGYSVRFEAKVSEQTQIKYMTDGMLLREFLNDPTVGMYSVLIIDEAHERTLQTDILFGLLSAVTEVRKDLKIIISSATCDVEKFCQFF-EAPFFKIPGRRYPVETFYTKDQEADFVEAAVVTILQIHITQSDGDILVFLTGQEDIEEAMDSLQERIKALGTKIRELIVLPIYSALPSEKQAKIFLPTPPGARKVVLATNIAETSLTIDGIRFVIDCGYCKVKCYDPRSRMDSLKVVPITKANAIQRSGRAGRIAPGKCFRLYKKYTFDEEFEDQAIPEIQRTNLGNVVLLLKSLGIEDILDFDYMDPPFEKSLLAAIEELYYLSAIDSKGGLSLIGRKMVEIPCDPMISNMILKSEKYGCSEEIITIAAMLSLDNTIFYSPKNKKLYASQAHRAFMQEEGDHLTLLKVYNEYANNDYSSDWCKDNYIQSRSMKMARNIRDQLVNLADRLELKLISNSEDTVGICKAITAGFFLNTARFNG-DSYRRIKSKDSVYMQMNSVFRILDEHPRYVVFNNIVNTTKEYMRTCTRIEPRWLTDIAPHIY 2633
            +SED     E+   K+  +RIS + +  N++    +TN         +   +E   E+   K    +L+      + +L    ++  + F K+      +  K+A   +  +A+   ++V+K                     E+K+ RK     WE    K     G V + ++ +  +  D  VDY  E+     + +E +E   E   +K  +I + ++ LPI+ ++ EL+ +I +N IV++ GETGSGKTTQ+ QYL+E GY  +  +IGCTQPRRVAAMSVA RV++EM   LG++VGY++RFE   SE T IKYMTDG+LLRE L +  +  YS +I+DEAHER+L TD+LFGLL  V   R DLK+I++SAT D EKF  FF   P F IPGR +PV+  ++K  + D+VEAAV   LQ+H++ + GDIL+F+ GQEDIE   D + E ++ L      L VLPIYS LPS+ QAKIF   P G RK ++ATNIAETSLT+DGI FVID GYCK+K ++PR  MD+L++ PI++ANA QRSGRAGR  PG+CFRLY +  +  E     +PEIQRTNL NVVLLLKSLG++D+L F +MDPP E ++L ++ +L+ L A+D+ GGL+  GR MVE P DP +S M++ S   GCS EI+ I +MLS+   IFY PK ++  + Q    F   E DHLT L VY ++ NN+YS+ WC D++I +++M+  R +R QL ++  +  + L S   D   + K I A +F   A+  G   Y  I++    ++   S    +   P Y+V++ +V TTKEYM+  T ++  WL ++ P  Y
Sbjct:  344 SSEDYVRRREQHLHKQKQKRISAQRRQINEDNERWETNRMLTSGVVHRLEVDEDFEEDNAAKV---HLM------VHNLVPPFLDGRIVFTKQ--PEPVIPVKDATSDLAIIARKGSQTVRK-------------------HREQKERRKAQHKHWELAGTKLGDIMG-VKKEEEPDKAMTEDGKVDYRTEQKFA-DHMKEKSEASSEFAKKK--SILEQRQYLPIFAVQQELLTIIRDNSIVIVVGETGSGKTTQLTQYLHEDGY-TDYGMIGCTQPRRVAAMSVAKRVSEEMGGNLGEEVGYAIRFEDCTSENTLIKYMTDGILLRESLREADLDHYSAVIMDEAHERSLNTDVLFGLLREVVARRSDLKLIVTSATMDAEKFAAFFGNVPIFHIPGRTFPVDILFSKTPQEDYVEAAVKQSLQVHLSGAPGDILIFMPGQEDIEVTSDQIVEHLEEL-ENAPALAVLPIYSQLPSDLQAKIFQKAPDGVRKCIVATNIAETSLTVDGIMFVIDSGYCKLKVFNPRIGMDALQIYPISQANANQRSGRAGRTGPGQCFRLYTQSAYKNELLTTTVPEIQRTNLANVVLLLKSLGVQDLLQFHFMDPPPEDNMLNSMYQLWILGALDNTGGLTSTGRLMVEFPLDPALSKMLIVSCDMGCSSEILLIVSMLSVP-AIFYRPKGREEESDQIREKFAVPESDHLTYLNVYLQWKNNNYSTIWCNDHFIHAKAMRKVREVRAQLKDIMVQQRMSLASCGTDWDIVRKCICAAYFHQAAKLKGIGEYVNIRTGMPCHLHPTSSLFGMGYTPDYIVYHELVMTTKEYMQCVTAVDGEWLAELGPMFY 1150          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 vs. Ensembl Mouse
Match: Dhx15 (DEAH (Asp-Glu-Ala-His) box polypeptide 15 [Source:MGI Symbol;Acc:MGI:1099786])

HSP 1 Score: 568.54 bits (1464), Expect = 0.000e+0
Identity = 309/645 (47.91%), Postives = 418/645 (64.81%), Query Frame = 3
Query:  777 LPIYRLKNELIKMIAENQIVVIEGETGSGKTTQIPQYLYEAGYCVE--------DKIIGCTQPXXXXXXXXXXXXXQEMNVKLGDKVGYSVRFEAKVSEQTQIKYMTDGMLLREFLNDPTVGMYSVLIIDEAHERTLQTDILFGLLSAVTEVRKDLKIIISSATCDVEKFCQFFE-APFFKIPGRRYPVETFYTKDQEADFVEAAVVTILQIHITQSD-GDILVFLTGQEDIEEAMDSLQERIKALGTKIRELIVLPIYSALPSEKQAKIFLPTPP----GA--RKVVLATNIAETSLTIDGIRFVIDCGYCKVKCYDPRSRMDSLKVVPITKANAIQRSGRAGRIAPGKCFRLYKKYTFDEEFEDQAIPEIQRTNLGNVVLLLKSLGIEDILDFDYMDPPFEKSLLAAIEELYYLSAIDSKGGLSLIGRKMVEIPCDPMISNMILKSEKYGCSEEIITIAAMLSLDNTIFYSPKNKKLYASQAHRAFMQEEGDHLTLLKVYNEYANNDYSSDWCKDNYIQSRSMKMARNIRDQLVNLADRLELKLIS---NSED-TVGICKAITAGFFLNTARF-NGDSYRRIKSKDSVYMQMNSVFRILDEHPRYVVFNNIVNTTKEYMRTCTRIEPRWLTDIAPHIYKDIDF 2648
            LP++  K+    ++  +Q  V+ GETGSGKTTQIPQ+      CVE         + + CTQPRRVAAMSVA RVA EM+V LG +VGYS+RFE   S +T +KYMTDGMLLRE +NDP +  Y V+I+DEAHERTL TDIL G+L  V   R DLK+I+ SAT D  KF  +F+  P   IPGR +PVE FYT + E D++EAA+ T++QIH+ + + GD+L+FLTGQE+I+EA   ++  +  LG ++ ++ ++P+YS LP ++Q +IF P PP    GA  RKVV++TNIAETSLTIDG+ FVID G+ K K Y+PR R++SL V  I+KA+A QR+GRAGR  PGKCFRLY +  +  E +D   PEI R+NLG+VVL LK LGI+D++ FD+MDPP  ++L+ A+E L YL+A++  G L+ +G  M E P DP ++ M++ S  Y CS E+++I AMLS+    F  P   K  A +A   F   +GDHLTLL VY+ +  N  S  WC DN+I  RS+  A N+R QL  + DR  L   S    S D  + I KA+  G+F+  A       Y  +K    V +  ++V   LD  P +V++N  V TTK Y+RTCT I+P WL  IAP  Y   +F
Sbjct:  137 LPVWEYKDRFTDILVRHQSFVLVGETGSGKTTQIPQW------CVEYMRSLPGPKRGVACTQPRRVAAMSVAQRVADEMDVMLGQEVGYSIRFEDCSSAKTILKYMTDGMLLREAMNDPLLERYGVIILDEAHERTLATDILMGVLKEVVRQRSDLKVIVMSATLDAGKFQIYFDNCPLLTIPGRTHPVEIFYTPEPERDYLEAAIRTVIQIHMCEEEEGDLLLFLTGQEEIDEACKRIKREVDDLGPEVGDIKIIPLYSTLPPQQQQRIFEPPPPKKQNGAIGRKVVVSTNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLVTAISKASAQQRAGRAGRTRPGKCFRLYTEKAYKTEMQDNTYPEILRSNLGSVVLQLKKLGIDDLVHFDFMDPPAPETLMRALELLNYLAALNDDGDLTELGSMMAEFPLDPQLAKMVIASCDYNCSNEVLSITAMLSVPQC-FVRPTEAKKAADEAKMRFAHIDGDHLTLLNVYHAFKQNHESVQWCYDNFINYRSLMSADNVRQQLSRIMDRFNLPRRSTDFTSRDYYINIRKALVTGYFMQVAHLERTGHYLTVKDNQVVQLHPSTV---LDHKPEWVLYNEFVLTTKNYIRTCTDIKPEWLVKIAPQYYDMSNF 771          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 vs. UniProt/SwissProt
Match: sp|O45244|DHX16_CAEEL (Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-4 OS=Caenorhabditis elegans OX=6239 GN=mog-4 PE=1 SV=2)

HSP 1 Score: 823.543 bits (2126), Expect = 0.000e+0
Identity = 432/850 (50.82%), Postives = 599/850 (70.47%), Query Frame = 3
Query:  159 SQRISEKEKSKNKNYVSGQTNEKKFRSQAMKYRDNE-TVTENIRIKSRQEYLLKRKADKIEDLHYDLIEDELYFKKEELTNRELKEKEAKKMIYKVAKMQEKSVKKVNEKYYTIPSNDSTIVMN--VTEERKKSRKGGLN-EWETLQLKNAIDQ--GKVSRRQDDEYELLVDEFVDYEQEETLIPQNPEELTEKVIEKIDEKDLAISQVQKLLPIYRLKNELIKMIAENQIVVIEGETGSGKTTQIPQYLYEAGYCVEDKIIGCTQPXXXXXXXXXXXXXQEMNVKLGDKVGYSVRFEAKVSEQTQIKYMTDGMLLREFLNDPTVGMYSVLIIDEAHERTLQTDILFGLLSAVTEVRKDLKIIISSATCDVEKFCQFFE-APFFKIPGRRYPVETFYTKDQEADFVEAAVVTILQIHITQS-DGDILVFLTGQEDIEEAMDSLQERIKALGTKIRELIVLPIYSALPSEKQAKIFLPTPPGARKVVLATNIAETSLTIDGIRFVIDCGYCKVKCYDPRSRMDSLKVVPITKANAIQRSGRAGRIAPGKCFRLYKKYTFDEEFEDQAIPEIQRTNLGNVVLLLKSLGIEDILDFDYMDPPFEKSLLAAIEELYYLSAIDSKGGLSLIGRKMVEIPCDPMISNMILKSEKYGCSEEIITIAAMLSLDNTIFYSPKNKKLYASQAHRAFMQEEGDHLTLLKVYNEYANNDYSSDWCKDNYIQSRSMKMARNIRDQLVNLADRLELKLISNSEDTVGICKAITAGFFLNTARF-NGDSYRRIKSKDSVYMQMNSVFRILDEHPRYVVFNNIVNTTKEYMRTCTRIEPRWLTDIAPHIYKDIDFEGDSKYKRMPK 2681
            + RI++KEK K +N +  + ++ K         D E +  + +R +SR++YL KRK DK+E+L   + +D+  F +E+LT RE  + E +K + +  K   K+   +  K Y +P   +  + +  V ++ +  R GG   +WE  QL  ++     K ++R++ E+ELL+DE VD+ Q    +P   EE+ E   EK   K ++I + +K LP+Y  ++  I+ + E+Q+++IEGETGSGKTTQ+PQYLYEAG+C   K IGCTQPRRVAAMSVA+RVA E+  KLG +VGYS+RFE   SE+T +KYMTDGMLLREFLN+P +  YSV++IDEAHERTL TDILFGL+  +   RKDLK++ISSAT D EKF  FF+ AP F+IPGRR+PV+ +YT+  EAD+V+AA+VTI+QIH+TQ   GDILVFLTGQE+IE   ++L ER KALG+KI+ELI LP+Y+ LPS+ QAKIF PTP  ARKVVLATNIAETS+TIDGI +VID G+ K   +D RS ++ L VV I+KA A QR+GRAGR  PGKCFRLY  + +  E E+Q IPEIQRTNLGNVVL+LKSLGI D++ FD++DPP +++L+ A+E+LY L A++ +G L+ +GR+M E PCDP +S MI+ SEKY CSEEI+TIAAMLS +  +FY PK + ++A  A + F    GDH+TL+ VYN++  + +S  WC +NY+Q R+MK AR++RDQLV L +R+E++  S S DT+ I KAITAG+F N ++  N   Y+ +K K + +   NS   + +E PR+VV+  +V T+KE+MR  + IE  WL ++APH YK  + E D+  K+MPK
Sbjct:  165 AARINKKEKDKTRNVMEKKRDDNK---------DKEGSSMDKLREESRRQYLKKRKVDKLEELEAIVHDDQTLFAREKLTKREKADMEYRKKVLEYTKAHGKAGDVMKMKRYHLPDASTKQIPSQYVEDDEEDFRPGGDGAKWEEEQLMASMLHLGAKDAKRKEQEFELLLDEKVDFIQA-LQMPGTNEEVVETEAEK---KKMSIEETRKSLPVYAFRDAFIEAVKEHQVLIIEGETGSGKTTQLPQYLYEAGFCEGGKRIGCTQPRRVAAMSVAARVADEVGCKLGTQVGYSIRFEDCTSEKTVLKYMTDGMLLREFLNEPDLASYSVMMIDEAHERTLHTDILFGLVKDIARFRKDLKLLISSATLDAEKFSSFFDDAPIFRIPGRRFPVDIYYTQAPEADYVDAAIVTIMQIHLTQPLPGDILVFLTGQEEIETVQEALMERSKALGSKIKELIPLPVYANLPSDLQAKIFEPTPKDARKVVLATNIAETSVTIDGINYVIDPGFSKQNSFDARSGVEHLHVVTISKAAANQRAGRAGRTGPGKCFRLYTAWAYKHELEEQPIPEIQRTNLGNVVLMLKSLGIHDLVHFDFLDPPPQETLVIALEQLYALGALNHRGELTKLGRRMAEFPCDPCMSKMIIASEKYECSEEIVTIAAMLSCNAAVFYRPKAQVIHADSARKGFWSPAGDHITLMNVYNKWQESSFSQRWCVENYVQHRTMKRARDVRDQLVGLLERVEIETKS-STDTIKIRKAITAGYFYNVSKLDNTGHYKTVKHKHTTHPHPNSC--LFEETPRWVVYFELVFTSKEFMREMSEIESGWLLEVAPHYYKGRELE-DATNKKMPK 997          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 vs. UniProt/SwissProt
Match: sp|Q767K6|DHX16_PIG (Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 OS=Sus scrofa OX=9823 GN=DHX16 PE=3 SV=1)

HSP 1 Score: 820.846 bits (2119), Expect = 0.000e+0
Identity = 430/900 (47.78%), Postives = 613/900 (68.11%), Query Frame = 3
Query:   51 IPHEALDLQFGHARENNKKTSEDEEHLTEKQRIKE------YSQRISEKEKSKNKNYVSGQTNEKKFRSQA-----MKYRDNETVTENIRIKSRQEYLLKRKADKIEDLHYDLIEDELYFKKEELTNRELKEKEAKKMI------YKVAKMQEKSVKKVNEKYYTIPS---NDSTIVMNVTEERKKSRKGGLNEWETLQLKNAIDQ--GKVSRRQDDEYELLVDEFVDYEQEETLIPQNPEELTEKVIEKIDEKDLAISQVQKLLPIYRLKNELIKMIAENQIVVIEGETGSGKTTQIPQYLYEAGYCVEDKIIGCTQPXXXXXXXXXXXXXQEMNVKLGDKVGYSVRFEAKVSEQTQIKYMTDGMLLREFLNDPTVGMYSVLIIDEAHERTLQTDILFGLLSAVTEVRKDLKIIISSATCDVEKFCQFFE-APFFKIPGRRYPVETFYTKDQEADFVEAAVVTILQIHITQSDGDILVFLTGQEDIEEAMDSLQERIKALGTKIRELIVLPIYSALPSEKQAKIFLPTPPGARKVVLATNIAETSLTIDGIRFVIDCGYCKVKCYDPRSRMDSLKVVPITKANAIQRSGRAGRIAPGKCFRLYKKYTFDEEFEDQAIPEIQRTNLGNVVLLLKSLGIEDILDFDYMDPPFEKSLLAAIEELYYLSAIDSKGGLSLIGRKMVEIPCDPMISNMILKSEKYGCSEEIITIAAMLSLDNTIFYSPKNKKLYASQAHRAFMQEEGDHLTLLKVYNEYANNDYSSDWCKDNYIQSRSMKMARNIRDQLVNLADRLELKLISNSEDTVGICKAITAGFFLNTARFNGDSYRRIKSKDSVYMQMNSVFRILDEHPRYVVFNNIVNTTKEYMRTCTRIEPRWLTDIAPHIYKDIDFEGDSKYKRMPK 2681
            +P +      G+  +  K  SEDE   TE++R+++      +++R+ +++K + +N +  + ++KK   +A     M   D + +   +R KSR+EYL KR+ +K+EDL  +L ++E  F   EL+  E +E + K+ +      Y+ A  QEK ++  N   Y +P       T  +++ EE   +       WE  +L  A  +   + +  Q+ +Y+L+++E    E       Q  EE          ++  +I  V++ LP++  + EL+  +A +QI++IEGETGSGKTTQIPQYL+E GY  +   I CTQPRRVAAMSVA+RVA+EM VKLG++VGYS+RFE   SE+T ++YMTDGMLLREFL++P +  YSV+++DEAHERTL TDILFGL+  V   R +LK++++SAT D  +F  FF+ AP F+IPGRR+PV+ FYTK  EAD++EA VV++LQIH+TQ  GDILVFLTGQE+IE A + LQ+R + LG+KIREL+VLPIY+ LPS+ QA+IF PTPPGARKVV+ATNIAETSLTI+GI +V+D G+CK K Y+PR+ M+SL V P +KA+A QR+GRAGR+A GKCFRLY  + +  E E+  +PEIQRT+LGNVVLLLKSLGI D++ FD++DPP  ++LL A+E+LY L A++  G L+  GRKM E+P DPM+S MIL SEKY CSEEI+T+AAMLS++N+IFY PK+K ++A  A   F    GDHL LL VY ++A + YSS WC +N++Q RSM+ AR++R+QL  L +R+E+ L S   D + + KAITAG+F +TAR     YR +K + +V++  NS   + +E PR+++++ +V TTKE+MR    IE  WL ++APH YK  + E D   K+MPK
Sbjct:  144 VPEKGKKTTGGNKPQTEKPESEDEWERTERERLQDLEERDAFAERVRQRDKDRTRNVL--ERSDKKAYEEAQKRLKMAEEDRKAMVPELRKKSRREYLAKREREKLEDLEAELADEEFLFGDVELSRHERRELKYKRRVRDLAREYRAAGEQEK-LEATNR--YHMPEETRGQPTRAVDLVEEESGAPGEEQRRWEEARLGAASLKFGARDAASQEPKYQLVLEEEETIEFVRATQLQGDEEPAAPPAPTQAQQKESIQAVRRSLPVFPFREELLAAVANHQILIIEGETGSGKTTQIPQYLFEEGYTQKGMKIACTQPRRVAAMSVAARVAREMGVKLGNEVGYSIRFEDCTSERTVLRYMTDGMLLREFLSEPDLASYSVVMVDEAHERTLHTDILFGLIKDVARFRPELKVLVASATLDTARFSTFFDDAPVFRIPGRRFPVDIFYTKAPEADYLEACVVSVLQIHVTQPPGDILVFLTGQEEIEAACEMLQDRCRRLGSKIRELLVLPIYANLPSDMQARIFQPTPPGARKVVVATNIAETSLTIEGIIYVLDPGFCKQKSYNPRTGMESLTVTPCSKASANQRAGRAGRVAAGKCFRLYTAWAYQHELEETTVPEIQRTSLGNVVLLLKSLGIHDLMHFDFLDPPPYETLLLALEQLYALGALNHLGELTTSGRKMAELPVDPMLSKMILASEKYSCSEEILTVAAMLSVNNSIFYRPKDKVVHADNARVNFFLPGGDHLVLLNVYTQWAESGYSSQWCYENFVQFRSMRRARDVREQLEGLLERVEVGLSSCQGDYIRVRKAITAGYFYHTARLTRSGYRTVKQQQTVFIHPNS--SLFEEQPRWLLYHELVLTTKEFMRQVLEIESSWLLEVAPHYYKAKELE-DPHAKKMPK 1035          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 vs. UniProt/SwissProt
Match: sp|Q7YR39|DHX16_PANTR (Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 OS=Pan troglodytes OX=9598 GN=DHX16 PE=3 SV=1)

HSP 1 Score: 815.839 bits (2106), Expect = 0.000e+0
Identity = 426/887 (48.03%), Postives = 609/887 (68.66%), Query Frame = 3
Query:   90 RENNKKTSEDEEHLTEKQRIKE------YSQRISEKEKSKNKNYVSGQTNEKKFRSQA-----MKYRDNETVTENIRIKSRQEYLLKRKADKIEDLHYDLIEDELYFKKEELTNRELKEKEAKKMI------YKVAKMQEKSVKKVNEKYYTIPS---NDSTIVMNVTEERKKSRKGGLNEWETLQLKNAIDQ--GKVSRRQDDEYELLVDEFVDYEQEETLIPQNPEELTEKVIEKIDEKDLAISQVQKLLPIYRLKNELIKMIAENQIVVIEGETGSGKTTQIPQYLYEAGYCVEDKIIGCTQPXXXXXXXXXXXXXQEMNVKLGDKVGYSVRFEAKVSEQTQIKYMTDGMLLREFLNDPTVGMYSVLIIDEAHERTLQTDILFGLLSAVTEVRKDLKIIISSATCDVEKFCQFFE-APFFKIPGRRYPVETFYTKDQEADFVEAAVVTILQIHITQSDGDILVFLTGQEDIEEAMDSLQERIKALGTKIRELIVLPIYSALPSEKQAKIFLPTPPGARKVVLATNIAETSLTIDGIRFVIDCGYCKVKCYDPRSRMDSLKVVPITKANAIQRSGRAGRIAPGKCFRLYKKYTFDEEFEDQAIPEIQRTNLGNVVLLLKSLGIEDILDFDYMDPPFEKSLLAAIEELYYLSAIDSKGGLSLIGRKMVEIPCDPMISNMILKSEKYGCSEEIITIAAMLSLDNTIFYSPKNKKLYASQAHRAFMQEEGDHLTLLKVYNEYANNDYSSDWCKDNYIQSRSMKMARNIRDQLVNLADRLELKLISNSEDTVGICKAITAGFFLNTARFNGDSYRRIKSKDSVYMQMNSVFRILDEHPRYVVFNNIVNTTKEYMRTCTRIEPRWLTDIAPHIYKDIDFEGDSKYKRMPK 2681
            ++  K  SEDE   TE++R+++      +++R+ +++K + +N +  + ++KK   +A     M   D + +   +R KSR+EYL KR+ +K+EDL  +L ++E  F   EL+  E +E + K+ +      Y+ A  QEK ++  N   Y +P          +++ EE   +       WE  +L  A  +   + +  Q+ +Y+L+++E    E       Q  EE +        ++  +I  V++ LP++  + EL+  IA +Q+++IEGETGSGKTTQIPQYL+E GY  +   I CTQPRRVAAMSVA+RVA+EM VKLG++VGYS+RFE   SE+T ++YMTDGMLLREFL++P +  YSV+++DEAHERTL TDILFGL+  V   R +LK++++SAT D  +F  FF+ AP F+IPGRR+PV+ FYTK  EAD++EA VV++LQIH+TQ  GDILVFLTGQE+IE A + LQ+R + LG+KIREL+VLPIY+ LPS+ QA+IF PTPPGARKVV+ATNIAETSLTI+GI +V+D G+CK K Y+PR+ M+SL V P +KA+A QR+GRAGR+A GKCFRLY  + +  E E+  +PEIQRT+LGNVVLLLKSLGI D++ FD++DPP  ++LL A+E+LY L A++  G L+  GRKM E+P DPM+S MIL SEKY CSEEI+T+AAMLS++N+IFY PK+K ++A  A   F    GDHL LL VY ++A + YSS WC +N++Q RSM+ AR++R+QL  L +R+E+ L S   D + + KAITAG+F +TAR     YR +K + +V++  NS   + ++ PR+++++ +V TTKE+MR    IE  WL ++APH YK  + E D   K+MPK
Sbjct:  156 QQTEKPESEDEWERTERERLQDLEERDAFAERVRQRDKDRTRNVL--ERSDKKAYEEAQKRLKMAEEDRKAMVPELRKKSRREYLAKREREKLEDLEAELADEEFLFGDVELSRHERQELKYKRRVRDLAREYRAAGEQEK-LEATNR--YHMPKETRGQPARAVDLVEEESGAPGEEQRRWEEARLGAASLKFGARDAASQEPKYQLVLEEEETIEFVRATQLQGNEEPSAPPTSTQAQQKESIQAVRRSLPVFPFREELLAAIANHQVLIIEGETGSGKTTQIPQYLFEEGYTNKGMKIACTQPRRVAAMSVAARVAREMGVKLGNEVGYSIRFEDCTSERTVLRYMTDGMLLREFLSEPDLASYSVVMVDEAHERTLHTDILFGLIKDVARFRPELKVLVASATMDTARFSTFFDDAPVFRIPGRRFPVDIFYTKAPEADYLEACVVSVLQIHVTQPPGDILVFLTGQEEIEAACEMLQDRCRRLGSKIRELLVLPIYANLPSDMQARIFQPTPPGARKVVVATNIAETSLTIEGIIYVLDPGFCKQKSYNPRTGMESLTVTPCSKASANQRAGRAGRVAAGKCFRLYTAWAYQHELEETTVPEIQRTSLGNVVLLLKSLGIHDLMHFDFLDPPPYETLLLALEQLYALGALNHLGELTTSGRKMAELPVDPMLSKMILASEKYSCSEEILTVAAMLSVNNSIFYRPKDKVVHADNARVNFFLPGGDHLVLLNVYTQWAESGYSSQWCYENFVQFRSMRRARDVREQLEGLLERVEVGLSSCQGDYIRVRKAITAGYFYHTARLTRSGYRTVKQQQTVFIHPNS--SLFEQQPRWLLYHELVLTTKEFMRQVLEIESSWLLEVAPHYYKAKELE-DPHAKKMPK 1034          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 vs. UniProt/SwissProt
Match: sp|O60231|DHX16_HUMAN (Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 OS=Homo sapiens OX=9606 GN=DHX16 PE=1 SV=2)

HSP 1 Score: 815.839 bits (2106), Expect = 0.000e+0
Identity = 426/887 (48.03%), Postives = 609/887 (68.66%), Query Frame = 3
Query:   90 RENNKKTSEDEEHLTEKQRIKE------YSQRISEKEKSKNKNYVSGQTNEKKFRSQA-----MKYRDNETVTENIRIKSRQEYLLKRKADKIEDLHYDLIEDELYFKKEELTNRELKEKEAKKMI------YKVAKMQEKSVKKVNEKYYTIPS---NDSTIVMNVTEERKKSRKGGLNEWETLQLKNAIDQ--GKVSRRQDDEYELLVDEFVDYEQEETLIPQNPEELTEKVIEKIDEKDLAISQVQKLLPIYRLKNELIKMIAENQIVVIEGETGSGKTTQIPQYLYEAGYCVEDKIIGCTQPXXXXXXXXXXXXXQEMNVKLGDKVGYSVRFEAKVSEQTQIKYMTDGMLLREFLNDPTVGMYSVLIIDEAHERTLQTDILFGLLSAVTEVRKDLKIIISSATCDVEKFCQFFE-APFFKIPGRRYPVETFYTKDQEADFVEAAVVTILQIHITQSDGDILVFLTGQEDIEEAMDSLQERIKALGTKIRELIVLPIYSALPSEKQAKIFLPTPPGARKVVLATNIAETSLTIDGIRFVIDCGYCKVKCYDPRSRMDSLKVVPITKANAIQRSGRAGRIAPGKCFRLYKKYTFDEEFEDQAIPEIQRTNLGNVVLLLKSLGIEDILDFDYMDPPFEKSLLAAIEELYYLSAIDSKGGLSLIGRKMVEIPCDPMISNMILKSEKYGCSEEIITIAAMLSLDNTIFYSPKNKKLYASQAHRAFMQEEGDHLTLLKVYNEYANNDYSSDWCKDNYIQSRSMKMARNIRDQLVNLADRLELKLISNSEDTVGICKAITAGFFLNTARFNGDSYRRIKSKDSVYMQMNSVFRILDEHPRYVVFNNIVNTTKEYMRTCTRIEPRWLTDIAPHIYKDIDFEGDSKYKRMPK 2681
            ++  K  SEDE   TE++R+++      +++R+ +++K + +N +  + ++KK   +A     M   D + +   +R KSR+EYL KR+ +K+EDL  +L ++E  F   EL+  E +E + K+ +      Y+ A  QEK ++  N   Y +P          +++ EE   +       WE  +L  A  +   + +  Q+ +Y+L+++E    E       Q  EE +        ++  +I  V++ LP++  + EL+  IA +Q+++IEGETGSGKTTQIPQYL+E GY  +   I CTQPRRVAAMSVA+RVA+EM VKLG++VGYS+RFE   SE+T ++YMTDGMLLREFL++P +  YSV+++DEAHERTL TDILFGL+  V   R +LK++++SAT D  +F  FF+ AP F+IPGRR+PV+ FYTK  EAD++EA VV++LQIH+TQ  GDILVFLTGQE+IE A + LQ+R + LG+KIREL+VLPIY+ LPS+ QA+IF PTPPGARKVV+ATNIAETSLTI+GI +V+D G+CK K Y+PR+ M+SL V P +KA+A QR+GRAGR+A GKCFRLY  + +  E E+  +PEIQRT+LGNVVLLLKSLGI D++ FD++DPP  ++LL A+E+LY L A++  G L+  GRKM E+P DPM+S MIL SEKY CSEEI+T+AAMLS++N+IFY PK+K ++A  A   F    GDHL LL VY ++A + YSS WC +N++Q RSM+ AR++R+QL  L +R+E+ L S   D + + KAITAG+F +TAR     YR +K + +V++  NS   + ++ PR+++++ +V TTKE+MR    IE  WL ++APH YK  + E D   K+MPK
Sbjct:  153 QQTEKPESEDEWERTERERLQDLEERDAFAERVRQRDKDRTRNVL--ERSDKKAYEEAQKRLKMAEEDRKAMVPELRKKSRREYLAKREREKLEDLEAELADEEFLFGDVELSRHERQELKYKRRVRDLAREYRAAGEQEK-LEATNR--YHMPKETRGQPARAVDLVEEESGAPGEEQRRWEEARLGAASLKFGARDAASQEPKYQLVLEEEETIEFVRATQLQGDEEPSAPPTSTQAQQKESIQAVRRSLPVFPFREELLAAIANHQVLIIEGETGSGKTTQIPQYLFEEGYTNKGMKIACTQPRRVAAMSVAARVAREMGVKLGNEVGYSIRFEDCTSERTVLRYMTDGMLLREFLSEPDLASYSVVMVDEAHERTLHTDILFGLIKDVARFRPELKVLVASATMDTARFSTFFDDAPVFRIPGRRFPVDIFYTKAPEADYLEACVVSVLQIHVTQPPGDILVFLTGQEEIEAACEMLQDRCRRLGSKIRELLVLPIYANLPSDMQARIFQPTPPGARKVVVATNIAETSLTIEGIIYVLDPGFCKQKSYNPRTGMESLTVTPCSKASANQRAGRAGRVAAGKCFRLYTAWAYQHELEETTVPEIQRTSLGNVVLLLKSLGIHDLMHFDFLDPPPYETLLLALEQLYALGALNHLGELTTSGRKMAELPVDPMLSKMILASEKYSCSEEILTVAAMLSVNNSIFYRPKDKVVHADNARVNFFLPGGDHLVLLNVYTQWAESGYSSQWCYENFVQFRSMRRARDVREQLEGLLERVEVGLSSCQGDYIRVRKAITAGYFYHTARLTRSGYRTVKQQQTVFIHPNS--SLFEQQPRWLLYHELVLTTKEFMRQVLEIESSWLLEVAPHYYKAKELE-DPHAKKMPK 1031          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 vs. UniProt/SwissProt
Match: sp|Q54MH3|DHX16_DICDI (Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 OS=Dictyostelium discoideum OX=44689 GN=dhx16 PE=3 SV=1)

HSP 1 Score: 773.081 bits (1995), Expect = 0.000e+0
Identity = 420/874 (48.05%), Postives = 599/874 (68.54%), Query Frame = 3
Query:  135 EKQRIKEYSQRISEKEKSKNKNYVSGQTNEKKFRSQAMKYRDNETVTENIRIKSRQEYLLKRKADKIEDLHYDLIEDELYFKKEELTNRELKEKEAKKMIYKVAKMQEKSVKKVNEKYYTIPS---NDSTIVMNVTEERKKSRKGG-----------LNEWETLQLKNAIDQGKVSRRQD-----DEYELLVDEFVDYEQEETLIPQNPEELTEKVIEKID----EKDLAISQVQKLLPIYRLKNELIKMIAENQIVVIEGETGSGKTTQIPQYLYEAGYCVEDKIIGCTQPXXXXXXXXXXXXXQEMNVKLGDKVGYSVRFEAKVSEQTQIKYMTDGMLLREFLNDPTVGMYSVLIIDEAHERTLQTDILFGLLSAVTEVRKDLKIIISSATCDVEKFCQFFE-APFFKIPGRRYPVETFYTKDQEADFVEAAVVTILQIHITQSDGDILVFLTGQEDIEEAMDSLQERIKALGTKIRELIVLPIYSALPSEKQAKIFLPTPPGARKVVLATNIAETSLTIDGIRFVIDCGYCKVKCYDPRSRMDSLKVVPITKANAIQRSGRAGRIAPGKCFRLYKKYTFDEEFEDQAIPEIQRTNLGNVVLLLKSLGIEDILDFDYMDPPFEKSLLAAIEELYYLSAIDSKGGLSLIGRKMVEIPCDPMISNMILKSEKYGCSEEIITIAAMLSLDNTIFYSPKNKKLYASQAHRAFMQEEGDHLTLLKVYNEYANNDYSSDWCKDNYIQSRSMKMARNIRDQLVNLADRLELKLISNSEDTVGICKAITAGFFLNTARFNGDS-YRRIKSKDSVYMQMNSVFRILDEHPRYVVFNNIVNTTKEYMRTCTRIEPRWLTDIAPHIYKDIDFEGDSKYKRMPK 2681
            E++ +KE S RI ++++   K  +   +  K+   +  +   NE + E  R KSR++YL+  +  ++  L  ++ E+   FK ++LT +E+K+ E KK +Y++A  Q  +  + ++ YY +PS   +  +++ +      K++KG              EWE  ++K+AI + +     +     +EYE + ++ +++ +EE L  Q  +     +++  D    +  + I +V+K LP+Y  + +LI  + E Q+++I GETGSGKTTQIPQYL+EAG+    KI GCTQPRRVAAMSVA+RVA+E+  KLG++VGYS+RFE   S++T ++YMTDGML+REFL  P +  YSVLIIDEAHERTL TDILFGLL  +T  R DLK++ISSAT D E+F  +F+ AP F IPGR+Y V T YT+  EAD+++AAVVT+LQIHIT+  GDILVFLTGQE++++A + LQ R + LGTKI+ELI+  IYS LP++ QAKIF PTPP ARKVVLATNIAETSLTIDGI +VID G+CK K ++PR+ M+SL + P+++A+A QR GRAGR+APGKCFRL+  + FD E E+  IPEIQRTNLGNVVLLLKS+GI D+++FD+MDPP  ++L+AA+E+LY L A++ +G L+ +GRKM E P DP +S MI+ SEKY CSEEI+TI AMLS+ NTIFY PK+K   A  A + F   +GDHLTL+ V+N++  + Y+  WC +N+IQ RSMK A+++RDQL  L +R+E+ L+SN +DT  I K I +GFF N+A+      +R  K   SV +  +S   +    P++VV++ +V TTKE+MR    I+  WL +IAPHIYK+ D   + K   +PK
Sbjct:  233 EQREVKELSDRIKKRDEKSTKKKIVDDSETKESIERKNRLEQNEQL-ETERTKSRRKYLVGEEQKRLILLKREIEEEYELFKDQKLTEQEIKDFEKKKKLYELAS-QRINESQQSDDYYQLPSEIKDKDSLLKSSYINDNKNKKGNDSSSSSSYNPEQKEWEQNRMKSAISENRGLSTANIGGGNEEYEYVFEDQIEFIKEEVL-KQGQKGDGVMILKPGDDGSAQAKMTIQEVRKSLPVYPYREQLIDAVREYQVLIIVGETGSGKTTQIPQYLHEAGFSKTGKI-GCTQPRRVAAMSVAARVAEEVGCKLGNEVGYSIRFEDCTSQKTVLQYMTDGMLVREFLTAPDLASYSVLIIDEAHERTLHTDILFGLLKDITRFRPDLKLLISSATMDAERFSDYFDGAPTFNIPGRKYEVTTHYTQAPEADYLDAAVVTVLQIHITEPLGDILVFLTGQEEVDQAAEMLQTRTRGLGTKIKELIITRIYSTLPTDLQAKIFEPTPPNARKVVLATNIAETSLTIDGIIYVIDPGFCKQKMFNPRTGMESLVITPVSRASANQRKGRAGRVAPGKCFRLFTAWAFDNELEENTIPEIQRTNLGNVVLLLKSMGINDLMNFDFMDPPPAQTLIAALEQLYALGALNDRGQLTKLGRKMAEFPVDPQLSKMIIASEKYKCSEEILTICAMLSVGNTIFYRPKDKAFAADAARKLFFHPQGDHLTLMNVFNQWRESGYAVQWCFENFIQHRSMKRAQDVRDQLELLLERVEIPLVSNVDDTDSIRKCIASGFFYNSAKLEKSGLFRTTKHNQSVQIHPSSC--LFQSPPKWVVYHELVLTTKEFMRQIVEIQSSWLHEIAPHIYKEKDVNDNQK---LPK 1097          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 vs. TrEMBL
Match: A0A4S2L8H6 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_009555 PE=4 SV=1)

HSP 1 Score: 881.322 bits (2276), Expect = 0.000e+0
Identity = 451/859 (52.50%), Postives = 620/859 (72.18%), Query Frame = 3
Query:  117 DEEHLTEKQRIKE---YSQRISEKEKSKNKNYVSGQTN--EKKFRSQAMKYRDNETVTENIRIKSRQEYLLKRKADKIEDLHYDLIEDELYFKKEELTNRELKEKEAKKMIYKVAKMQEKSVKKVNEKYYTIPSNDSTIVMNVTEERKKSRKGGLNE----WETLQLKNAIDQGKVSRRQDDE--YELLVDEFVDYEQEETLIPQNPEE--LTEKVIEKIDEKDLAISQVQKLLPIYRLKNELIKMIAENQIVVIEGETGSGKTTQIPQYLYEAGYCVEDKIIGCTQPXXXXXXXXXXXXXQEMNVKLGDKVGYSVRFEAKVSEQTQIKYMTDGMLLREFLNDPTVGMYSVLIIDEAHERTLQTDILFGLLSAVTEVRKDLKIIISSATCDVEKFCQFFE-APFFKIPGRRYPVETFYTKDQEADFVEAAVVTILQIHITQSDGDILVFLTGQEDIEEAMDSLQERIKALGTKIRELIVLPIYSALPSEKQAKIFLPTPPGARKVVLATNIAETSLTIDGIRFVIDCGYCKVKCYDPRSRMDSLKVVPITKANAIQRSGRAGRIAPGKCFRLYKKYTFDEEFEDQAIPEIQRTNLGNVVLLLKSLGIEDILDFDYMDPPFEKSLLAAIEELYYLSAIDSKGGLSLIGRKMVEIPCDPMISNMILKSEKYGCSEEIITIAAMLSLDNTIFYSPKNKKLYASQAHRAFMQEEGDHLTLLKVYNEYANNDYSSDWCKDNYIQSRSMKMARNIRDQLVNLADRLELKLISNSEDTVGICKAITAGFFLNTARFNGDSYRRIKSKDSVYMQMNSVFRILDEHPRYVVFNNIVNTTKEYMRTCTRIEPRWLTDIAPHIYKDIDFE 2651
            ++E L+ ++ IKE   + +R+  K+    +   SG  +  E+  R         + + E  + +SR+ YL KR+ADK+ DL  ++ ++EL+F +EELT REL E + K+ +  VA+  +++ +  +   Y IPS +     +  EE   S++ G+NE    WE   L +A+       + + E  ++L++D+ +D+ +  T    N EE  ++E+   K   +   +++ ++LLPIY+ +  L++ IA++Q+++IEGETGSGKTTQIPQYLYEAGYCV  K IGCTQPRRVAAMSVA+RV+QEMNVKLG +VGYS+RFE   SE+T IKYMTDGMLLREFL +P +G YSV++IDEAHERTL TDILFGL+  V   R DLK++ISSAT D EKF +FF+ AP F+IPGRRYPV+ +YTK  EAD++EAAV+++LQIH+TQ  GDILVFLTGQE+IE A + L ER + LG+KIREL++LPIYS LPS+ QA+IF PTPPGARKVVLATNIAETSLTIDGI +VID G+CK K Y  RS ++SL VVPI++A A QR+GRAGR+A GKCFRLY  + +  E E Q +PEIQRTNLGNVVLLLKSLGI+D+L FDYMDPP   SL+ A+E+LY L A++ +G L+ +GR+M E PCDPM+S MIL S+KY CS ++ITIAAMLS++N IFY PK+K ++A  A + F    GDHL LL VYN+++  D+S+ WC +++IQ R+MK AR+IRDQ V+L +R+E+ L SN  + + I KAITAGFF +TARF G+ Y+ +K K +++   NS   + +E P++V+++ +V TTKE+MR    IEP+WL ++APH YK+ + E
Sbjct:   40 EKEELSREKDIKERDEFVKRLLNKDHENTRKLTSGSGSKYEEALRKVEAGEMTRKQLVEEFKKESRRAYLRKRQADKLADLKGEVEDEELFFNQEELTARELAELQYKRTLLAVAQAHQQAGELESANRYFIPSEEKRPDESFQEE---SQEKGVNEEGKRWEQEHLSSALYSFGARDKSEKEAKFDLVLDDEIDFLKTLTRPGANTEEEPVSEEKKTKSASRRETLAEARRLLPIYKFREALLQAIADHQVLIIEGETGSGKTTQIPQYLYEAGYCVGGKRIGCTQPRRVAAMSVAARVSQEMNVKLGSEVGYSIRFEDCTSERTLIKYMTDGMLLREFLLEPDLGGYSVMLIDEAHERTLHTDILFGLVKDVARFRPDLKLLISSATLDAEKFAKFFDDAPVFRIPGRRYPVDIYYTKAPEADYIEAAVISVLQIHVTQPPGDILVFLTGQEEIETANEMLVERTRKLGSKIRELLILPIYSTLPSDMQARIFSPTPPGARKVVLATNIAETSLTIDGIIYVIDTGFCKQKFYSARSGIESLIVVPISQAAADQRAGRAGRVAAGKCFRLYTAHAYRTELEPQPVPEIQRTNLGNVVLLLKSLGIDDLLHFDYMDPPPHDSLIMALEQLYALGALNHRGELTKMGRQMAEFPCDPMLSKMILASDKYKCSGDVITIAAMLSVNNAIFYRPKDKLIHADTARKGFFHTAGDHLMLLNVYNQWSAADFSTHWCYEHFIQYRTMKRARDIRDQFVSLLERVEISLKSNPSEHINIRKAITAGFFYHTARFTGNGYKTVKQKHTIHPHPNSC--LAEELPKWVIYHELVFTTKEFMRQLIEIEPKWLLEVAPHYYKEKEIE 893          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 vs. TrEMBL
Match: A0A2H8TNP7 (Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 OS=Melanaphis sacchari OX=742174 GN=DHX16_0 PE=4 SV=1)

HSP 1 Score: 874.774 bits (2259), Expect = 0.000e+0
Identity = 442/850 (52.00%), Postives = 620/850 (72.94%), Query Frame = 3
Query:  156 YSQRISEKEKSKNKNYVSGQTNEKKFRSQAMKY-----RDNETVTENIRIKSRQEYLLKRKADKIEDLHYDLIEDELYFKKEELTNRELKEKEAKKMIYKVAKMQEKSVKKVNEKYYTIPSNDSTIVMNVTEERKKSRKGGLNEWETLQLKNAIDQGKVSRRQDDEYELLVDEFVDYEQEETLIPQNPE--ELTEKVIEKIDEKDLAISQVQKLLPIYRLKNELIKMIAENQIVVIEGETGSGKTTQIPQYLYEAGYCVEDKIIGCTQPXXXXXXXXXXXXXQEMNVKLGDKVGYSVRFEAKVSEQTQIKYMTDGMLLREFLNDPTVGMYSVLIIDEAHERTLQTDILFGLLSAVTEVRKDLKIIISSATCDVEKFCQFFE-APFFKIPGRRYPVETFYTKDQEADFVEAAVVTILQIHITQSDGDILVFLTGQEDIEEAMDSLQERIKALGTKIRELIVLPIYSALPSEKQAKIFLPTPPGARKVVLATNIAETSLTIDGIRFVIDCGYCKVKCYDPRSRMDSLKVVPITKANAIQRSGRAGRIAPGKCFRLYKKYTFDEEFEDQAIPEIQRTNLGNVVLLLKSLGIEDILDFDYMDPPFEKSLLAAIEELYYLSAIDSKGGLSLIGRKMVEIPCDPMISNMILKSEKYGCSEEIITIAAMLSLDNTIFYSPKNKKLYASQAHRAFMQEEGDHLTLLKVYNEYANNDYSSDWCKDNYIQSRSMKMARNIRDQLVNLADRLELKLISNSEDTVGICKAITAGFFLNTARFNGDSYRRIKSKDSVYMQMNSVFRILDEHPRYVVFNNIVNTTKEYMRTCTRIEPRWLTDIAPHIYKDIDFEGDSKYKRMPK 2681
            +++R+  K+K + +N    ++++K +   A +      R+ E V   +RI+SR++YL KRK DK+ +L  D+I+DE  F KE+LT RE+ ++E KK +  +AK  EK+ +  N + Y +P +     M    E  K+      +WE  Q+ +A+ +    R++ ++YELL+D  +++ Q   L   + E  E+TEK      +K L+I + +K LPIY+ K +LI+ I ++QI++IEGETGSGKTTQIPQYLYEAG+   +KIIGCTQPRRVAAMSVA+RVA+EM+VKLG++VGYS+RFE   SE+T IKYMTDG L REFL++P +  YSV+I+DEAHERTL TDILFGL+  V   R DLK++ISSAT D +KF +FF+ AP F+IPGRR+PV+ +YTK  EAD+++A VV+ILQIH+TQ  GDILVFLTGQE+IE   + LQER++ LG++I+ELI+LP+YS LP+E QAKIF PTPP ARKVVLATNIAETSLTID I +VID G+CK   ++ R+ M+SL VVPI+KA+A QR+GRAGR+A GKCFRLY  + +  E ED  +PEIQR NLGN VL+LK+LGI D++ FD++DPP  ++L+ A+E+LY L A++ KG L+ +GR+M E P DPM++ M+L SEKY CSEEI +IAAML++++ IFY PK+K + A  A + F  + GDHL LL +YN++AN+D+S++WC +NYIQ RSM+ AR++RDQLV L  R+E++++SN  +TV I KAITAG+F + AR +   YR +K   +V +  NS   + +E PR+V+++ +V TTKEYMR  T IE +WL ++APH Y+D + E DS  K++P+
Sbjct:   16 FAERLKRKDKDRTRNIAIPRSDKKAYEEAAKRLKLENEREKEMVIPRLRIESRRKYLEKRKDDKVTELEADIIDDEYLFDKEDLTQREIFDREHKKKLLSLAKEHEKARELENVQRYRMPQDIKDQQMEYEMEVDKAPITEQQKWEEEQMSSAVYKFGAKRQEKEQYELLIDNQIEFIQTANLPGTDEEKHEITEK-----QKKKLSIEETKKSLPIYKFKKDLIRAIKDHQILIIEGETGSGKTTQIPQYLYEAGFTENNKIIGCTQPRRVAAMSVAARVAEEMSVKLGNEVGYSIRFEDCTSERTIIKYMTDGTLHREFLSEPDLQSYSVMIVDEAHERTLHTDILFGLVKDVIRFRPDLKLLISSATLDAQKFSEFFDDAPIFRIPGRRFPVDIYYTKAPEADYIDACVVSILQIHVTQPLGDILVFLTGQEEIETCHELLQERVRRLGSQIKELILLPVYSNLPTEMQAKIFEPTPPNARKVVLATNIAETSLTIDNIIYVIDPGFCKQNNFNSRTGMESLIVVPISKASANQRAGRAGRVAAGKCFRLYTSWAYKSELEDNTVPEIQRINLGNAVLMLKALGIHDLIHFDFLDPPPHETLVLALEQLYALGALNHKGELTKLGRRMAEFPLDPMMAKMLLASEKYKCSEEIASIAAMLNVNSAIFYRPKDKLILADTARKNFFSQGGDHLALLNIYNQWANSDFSTNWCYENYIQHRSMRRARDVRDQLVGLMQRVEMEIVSNPTETVNIRKAITAGYFYHIARLSKGHYRTVKHNQTVIIHPNS--SLFEELPRWVLYHELVLTTKEYMRQVTEIESKWLREVAPHYYQDRELE-DSTNKKVPR 857          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 vs. TrEMBL
Match: G7YS81 (Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 (Fragment) OS=Clonorchis sinensis OX=79923 GN=CLF_109095 PE=4 SV=1)

HSP 1 Score: 874.389 bits (2258), Expect = 0.000e+0
Identity = 451/861 (52.38%), Postives = 617/861 (71.66%), Query Frame = 3
Query:  117 DEEHLTEKQRIKE---YSQRISEKEKSKNKNYVSGQTN--EKKFRSQAMKYRDNETVTENIRIKSRQEYLLKRKADKIEDLHYDLIEDELYFKKEELTNRELKEKEAKKMIYKVAKMQEKSVKKVNEKYYTIPSNDSTIVMNVTEERKKSRKGGLNE----WETLQLKNAIDQGKVSRRQDDE--YELLVDEFVDYEQEETLIPQNPEELTEKVIEKIDEKDLA----ISQVQKLLPIYRLKNELIKMIAENQIVVIEGETGSGKTTQIPQYLYEAGYCVEDKIIGCTQPXXXXXXXXXXXXXQEMNVKLGDKVGYSVRFEAKVSEQTQIKYMTDGMLLREFLNDPTVGMYSVLIIDEAHERTLQTDILFGLLSAVTEVRKDLKIIISSATCDVEKFCQFFE-APFFKIPGRRYPVETFYTKDQEADFVEAAVVTILQIHITQSDGDILVFLTGQEDIEEAMDSLQERIKALGTKIRELIVLPIYSALPSEKQAKIFLPTPPGARKVVLATNIAETSLTIDGIRFVIDCGYCKVKCYDPRSRMDSLKVVPITKANAIQRSGRAGRIAPGKCFRLYKKYTFDEEFEDQAIPEIQRTNLGNVVLLLKSLGIEDILDFDYMDPPFEKSLLAAIEELYYLSAIDSKGGLSLIGRKMVEIPCDPMISNMILKSEKYGCSEEIITIAAMLSLDNTIFYSPKNKKLYASQAHRAFMQEEGDHLTLLKVYNEYANNDYSSDWCKDNYIQSRSMKMARNIRDQLVNLADRLELKLISNSEDTVGICKAITAGFFLNTARFNGDSYRRIKSKDSVYMQMNSVFRILDEHPRYVVFNNIVNTTKEYMRTCTRIEPRWLTDIAPHIYKDIDFE 2651
            ++E L  ++ IKE   + +R+  K+    +   SG  +  E+  R         + + E  + +SR+ YL KR+ADK+ DL  ++ ++EL+F +EELT REL E + K+ +  VA+  +++ +  +   Y IPS +     +  EE   S++ G NE    WE   L +A+       + + E  ++L++D+ +D+ +  T    N EE  E V E+   K ++    +++ ++ LPIY+ +  L++ IA++Q+++IEGETGSGKTTQIPQYLYEAGYCV  K IGCTQPRRVAAMSVA+RV+QEMNVKLG +VGYS+RFE   SE+T IKYMTDGMLLREFL +P +G YSV++IDEAHERTL TDILFGL+  V   R DLK++ISSAT D EKF +FF+ AP F+IPGRRYPV+ +YTK  EAD++EAAV+++LQIH+TQ  GD+LVFLTGQE+IE A + L ER + LG+KIREL++LPIYS LPS+ QA+IF PTPPGARKVVLATNIAETSLTIDGI +VID G+CK K Y  RS ++SL VVPI++A A QR+GRAGR+A GKCFRLY  + +  E E Q +PEIQRTNLGNVVLLLKSLGI+D+L FDYMDPP   SL+ A+E+LY L A++ +G L+ +GR+M E PCDPM+S MIL S+KY CS + ITIAAMLS++N IFY PK+K ++A  A + F    GDHL LL VYN+++  D+S+ WC +++IQ R+MK AR+IRDQ V+L +R+E+ L SN  + + I KAITAGFF +TARF G+ Y+ +K K +++   NS   + +E P++V+++ +V TTKE+MR    IEP+WL ++APH YK+ + E
Sbjct:   16 EKEELNREKDIKERDAFVKRLLSKDHESTRKLTSGSGSKYEEALRKVEAGEMTRKQLVEEFKKESRRAYLRKRQADKLADLKGEVEDEELFFDQEELTARELAELQYKRTLLAVAQAHQQAGELESANRYFIPSEEKRPDESFQEE---SQEKGANEEGKRWEQEHLSSALYSFGARDKSEKEAKFDLVLDDEIDFLKTLTRPGANTEE--EPVSEEKKPKSVSRRETLAEARRSLPIYKFREALLQAIADHQVLIIEGETGSGKTTQIPQYLYEAGYCVGGKRIGCTQPRRVAAMSVAARVSQEMNVKLGSEVGYSIRFEDCTSERTLIKYMTDGMLLREFLLEPDLGGYSVMLIDEAHERTLHTDILFGLVKDVARFRPDLKLLISSATLDAEKFAKFFDDAPVFRIPGRRYPVDIYYTKAPEADYIEAAVISVLQIHVTQPPGDVLVFLTGQEEIETANEMLVERTRKLGSKIRELLILPIYSTLPSDMQARIFSPTPPGARKVVLATNIAETSLTIDGIIYVIDTGFCKQKFYSARSGIESLIVVPISQAAADQRAGRAGRVAAGKCFRLYTAHAYRTELEPQPVPEIQRTNLGNVVLLLKSLGIDDLLHFDYMDPPPHDSLIMALEQLYALGALNHRGELTKMGRQMAEFPCDPMLSKMILASDKYKCSGDAITIAAMLSVNNAIFYRPKDKLIHADTARKGFFHTAGDHLMLLNVYNQWSAADFSTHWCYEHFIQYRTMKRARDIRDQFVSLLERVEISLKSNPSEHINIRKAITAGFFYHTARFTGNGYKTVKQKHTIHPHPNSC--LAEELPKWVIYHELVFTTKEFMRQLIEIEPKWLLEVAPHYYKEKEIE 869          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 vs. TrEMBL
Match: J9K200 (Uncharacterized protein OS=Acyrthosiphon pisum OX=7029 GN=100165872 PE=4 SV=1)

HSP 1 Score: 872.848 bits (2254), Expect = 0.000e+0
Identity = 443/852 (52.00%), Postives = 616/852 (72.30%), Query Frame = 3
Query:  156 YSQRISEKEKSKNKNYVSGQTNEKKFRSQAMKY-----RDNETVTENIRIKSRQEYLLKRKADKIEDLHYDLIEDELYFKKEELTNRELKEKEAKKMIYKVAKMQEKSVKKVNEKYYTIPSNDSTIVMNVTEERKKSRKGGLNEWETLQLKNAIDQGKVSRRQDDEYELLVDEFVDYEQEETLIPQNPEELTEKVIEKIDEKDLAISQVQKLLPIYRLKNELIKMIAENQIVVIEGETGSGKTTQIPQYLYEAGYCVEDKIIGCTQPXXXXXXXXXXXXXQEMNVKLGDKVGYSVRFEAKVSEQTQIKYMTDGMLLREFLNDPTVGMYSVLIIDEAHERTLQTDILFGLLSAVTEVRKDLKIIISSATCDVEKFCQFFE-APFFKIPGRRYPVETFYTKDQEADFVEAAVVTILQIHITQSDGDILVFLTGQEDIEEAMDSLQERIKALGTKIRELIVLPIYSALPSEKQAKIFLPTPPGARKVVLATNIAETSLTIDGIRFVIDCGYCKVKCYDPRSRMDSLKVVPITKANAIQRSGRAGRIAPGKCFRLYKKYTFDEEFEDQAIPEIQRTNLGNVVLLLKSLGIEDILDFDYMDPPFEKSLLAAIEELYYLSAIDSKGGLSLIGRKMVEIPCDPMISNMILKSEKYGCSEEIITIAAMLSLDNTIFYSPKNKKLYASQAHRAFMQEEGDHLTLLKVYNEYANNDYSSDWCKDNYIQSRSMKMARNIRDQLVNLADRLELKLISNSEDTVGICKAITAGFFLNTARFNGDSYRRIKSKDSVYMQMNSVFRILDEHPRYVVFNNIVNTTKEYMRTCTRIEPRWLTDIAPHIYKDIDFEGDSKYKRMPKLAKK 2693
            +++R+  K+K + +N    ++++K +   A +      R+ E V   +RI+SR++YL KRK DK+ +L  D+I+DE  F  E+L+ RE+ ++E KK +  +AK  EK+ +  N + Y +P +     M    E  K+      +WE  Q+ +A+ +    R++ ++YELL+D  +D+ Q   L P   E+   ++ EK  +K L I + +K LPIY+ K +LI+ I ++QI++IEGETGSGKTTQIPQYL+EAG+   +KIIGCTQPRRVAAMSVA+RVA EM+VKLG++VGYS+RFE   SE+T IKYMTDG L REFL++P +  YSV+I+DEAHERTL TDILFGL+  V   R DLK++ISSAT D +KF +FF+ AP F+IPGRR+PV+ +YTK  EAD+++A VV+ILQIH+TQ  GDILVFLTGQE+IE   + LQER++ LG++I+ELIVLP+YS LP+E QAKIF PTPP ARKVVLATNIAETSLTID I +VID G+CK   ++ R+ M+SL VVPI+KA+A QR+GRAGR+A GKCFRLY  + +  E ED  +PEIQR NLGN VL+LK+LGI D++ FD++DPP  ++L+ A+E+LY L A++ KG L+ +GR+M E P DPM++ M+L SEKY CSEEI TIAAML++++ IFY PK+K + A  A + F  + GDHL LL +YN++AN D+S++WC +NYIQ RSM+ AR++RDQLV L  R+E+ ++SN  +TV I KAITAG+F + AR +   YR +K   +V +  NS   + +E PR+V+++ +V TTKEYMR  T IE +WL ++APH Y+D + E DS  K++PK   K
Sbjct:   16 FAERLKRKDKDRTRNIAIPRSDKKAYEEAAKRLKIENEREKEMVIPRLRIESRRKYLEKRKDDKVTELEADIIDDEYLFDAEDLSQREIFDREHKKKLLSLAKEHEKARELENVQRYRMPQDIKDDQMEYDMEVDKAPITEQQKWEEEQMSSAVYKFGAKRQEKEQYELLIDNQIDFIQTANL-PGTHEDEKPEITEK-QKKKLNIEETKKSLPIYKFKKDLIRAIKDHQILIIEGETGSGKTTQIPQYLHEAGFTENNKIIGCTQPRRVAAMSVAARVADEMSVKLGNEVGYSIRFEDCTSERTIIKYMTDGTLHREFLSEPDLQSYSVMIVDEAHERTLHTDILFGLVKDVIRFRPDLKLLISSATLDAQKFSEFFDDAPIFRIPGRRFPVDIYYTKAPEADYIDACVVSILQIHVTQPLGDILVFLTGQEEIETCNELLQERVRRLGSQIKELIVLPVYSNLPTEMQAKIFEPTPPNARKVVLATNIAETSLTIDNIIYVIDPGFCKQNNFNSRTGMESLIVVPISKASANQRAGRAGRVAAGKCFRLYTAWAYKSELEDNTVPEIQRINLGNAVLMLKALGIHDLIHFDFLDPPPHETLVLALEQLYALGALNHKGELTKLGRRMAEFPLDPMMAKMLLASEKYKCSEEIATIAAMLNVNSAIFYRPKDKLILADTARKNFFSQGGDHLALLNIYNQWANTDFSTNWCYENYIQHRSMRRARDVRDQLVGLMQRVEMDIVSNPSETVNIRKAITAGYFYHIARLSKGHYRTVKHNQTVIIHPNS--SLFEELPRWVLYHELVLTTKEYMRQVTEIESKWLREVAPHYYQDRELE-DSTNKKLPKTLGK 862          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 vs. TrEMBL
Match: A0A0R3S807 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS229 PE=4 SV=2)

HSP 1 Score: 871.307 bits (2250), Expect = 0.000e+0
Identity = 444/854 (51.99%), Postives = 604/854 (70.73%), Query Frame = 3
Query:  156 YSQRISEKEKSKNKNYVSGQTNEKKFRSQAMKYRDNETVTENIRIKSRQEYLLKRKADKIEDLHYDLIEDELYFKKEELTNRELKEKEAKKMIYKVAKMQEKSVKKVNEKYYTIPSNDSTIVMNVTE-ERKKSRKGGLNEWETLQLKNAIDQ--GKVSRRQDDEYELLVDEFVDYEQEETLIPQN--------PEELTEKVIEKIDEKDLAISQVQKLLPIYRLKNELIKMIAENQIVVIEGETGSGKTTQIPQYLYEAGYCVEDKIIGCTQPXXXXXXXXXXXXXQEMNVKLGDKVGYSVRFEAKVSEQTQIKYMTDGMLLREFLNDPTVGMYSVLIIDEAHERTLQTDILFGLLSAVTEVRKDLKIIISSATCDVEKFCQFFE-APFFKIPGRRYPVETFYTKDQEADFVEAAVVTILQIHITQSDGDILVFLTGQEDIEEAMDSLQERIKALGTKIRELIVLPIYSALPSEKQAKIFLPTPPGARKVVLATNIAETSLTIDGIRFVIDCGYCKVKCYDPRSRMDSLKVVPITKANAIQRSGRAGRIAPGKCFRLYKKYTFDEEFEDQAIPEIQRTNLGNVVLLLKSLGIEDILDFDYMDPPFEKSLLAAIEELYYLSAIDSKGGLSLIGRKMVEIPCDPMISNMILKSEKYGCSEEIITIAAMLSLDNTIFYSPKNKKLYASQAHRAFMQEEGDHLTLLKVYNEYANNDYSSDWCKDNYIQSRSMKMARNIRDQLVNLADRLELKLISNSEDTVGICKAITAGFFLNTARFNGDSYRRIKSKDSVYMQMNSVFRILDEHPRYVVFNNIVNTTKEYMRTCTRIEPRWLTDIAPHIYKDIDFEGDSKYKRMPK 2681
            + QR+  ++    K +  G   E+  +         E + + ++ KSR +YL KR+ DK+ DL  ++ ++E +F ++ELT  E  + + K+ I + A + +    +   ++Y IP+ +     +  E E +K   G    WE   + +A+ +   K   +  ++Y+L++++ +++ +  T    N        PEEL  +  E   ++   + + +K LP+Y  +  L+  I ++QI+VIEGETGSGKTTQIPQYLYEAGYC + K IGCTQPRRVAAMSVASRVAQEMNVKLG +VGYS+RFE   S++T +KYMTDGMLLREFL +P +  YSV++IDEAHERTL TD+LFGL+  V   R DLK++ISSAT D +KF QFF+ AP F+IPGRRYPV+ +YTK  EAD++EAA+VT+LQIH+TQ  GDIL F TGQE+IE A ++L ER K +G+K+RELIVLPIYS LPS+ QA+IF PTPPGARKVVLATNIAETSLTIDGI +VID G+CK   Y  RS ++SL VVPI++A A QR+GRAGR+A GKCFRLY  + +  E E Q +PEIQRTNLGNVVLLLKSLGI+D+L FDYMDPP   SL+ A+E+LY L A++ KG L+  GR+M E PCDPM+S MIL SEKY CSEE ITIA+MLS++N IFY PK+K ++A  A +AF    GDHLTL+ VYN++A+ D+++ WC +++IQ R+MK AR+IRDQ V L +R+E+K  SN  D VGI KA+TAGFF +TARF G+ Y+ +K + +++   NS   + +E PR+V+++ +V TT+E+MR  T IEPRWLT++APH YK  + E  +  K+MPK
Sbjct:   58 FVQRLLSRDHEATKKFARGSRFEEDLKRLERGELTREELIKELKKKSRWDYLKKRQLDKLHDLEAEIHDEENFFGEDELTELEKIDLKYKRTILEAATVHKAVTAEQTAQHYFIPTEEKRPDDSYYEIEAEKGPHGENRRWEQEHISSALFKLGAKDISKAQEKYDLILEDEIEFLKALTQPGSNVAVEPELTPEELARRAAE---DRKKTLQETRKSLPVYAFREALLDAIKDHQILVIEGETGSGKTTQIPQYLYEAGYCADGKAIGCTQPRRVAAMSVASRVAQEMNVKLGMEVGYSIRFEDCTSDRTVVKYMTDGMLLREFLTEPDLVSYSVMMIDEAHERTLHTDVLFGLVKDVARFRPDLKLLISSATLDAQKFSQFFDDAPIFRIPGRRYPVDIYYTKAPEADYIEAAIVTVLQIHVTQPPGDILAFFTGQEEIETANEALLERTKKMGSKMRELIVLPIYSTLPSDMQARIFAPTPPGARKVVLATNIAETSLTIDGIIYVIDTGFCKQNFYSARSGIESLLVVPISRAAADQRAGRAGRVAAGKCFRLYTSHAYHTELEAQPVPEIQRTNLGNVVLLLKSLGIDDLLHFDYMDPPPHDSLVMALEQLYALGALNHKGELTKTGRRMAEFPCDPMLSKMILASEKYKCSEEAITIASMLSVNNAIFYRPKDKLVHADAARKAFNHITGDHLTLMNVYNQWADADFTAQWCYEHFIQHRTMKRARDIRDQFVTLLERVEIKPTSNPGDHVGIRKALTAGFFYHTARFTGNGYKTVKHQHTIHPHPNSA--LAEEQPRWVLYHELVFTTREFMRQVTEIEPRWLTEVAPHYYKASEIEEAT--KKMPK 904          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 vs. Ensembl Cavefish
Match: dhx16 (DEAH-box helicase 16 [Source:NCBI gene;Acc:103040087])

HSP 1 Score: 811.987 bits (2096), Expect = 0.000e+0
Identity = 423/872 (48.51%), Postives = 608/872 (69.72%), Query Frame = 3
Query:  156 YSQRISEKEKSKNKNYVSGQTNEKKFRSQA-----MKYRDNETVTENIRIKSRQEYLLKRKADKIEDLHYDLIEDELYFKKEELTNRELKEKEAKKMI------YKVAKMQEKSVKKVNEKYY--------TIPSNDSTIVMNVTEERKKSRKGGLNEWE-------TLQLKNAIDQGKVSRRQDDEYELLVDE--FVDYEQEE-TLIPQNPEELTEKVIEKIDEKDLAISQVQKLLPIYRLKNELIKMIAENQIVVIEGETGSGKTTQIPQYLYEAGYCVEDKIIGCTQPXXXXXXXXXXXXXQEMNVKLGDKVGYSVRFEAKVSEQTQIKYMTDGMLLREFLNDPTVGMYSVLIIDEAHERTLQTDILFGLLSAVTEVRKDLKIIISSATCDVEKFCQFFE-APFFKIPGRRYPVETFYTKDQEADFVEAAVVTILQIHITQSDGDILVFLTGQEDIEEAMDSLQERIKALGTKIRELIVLPIYSALPSEKQAKIFLPTPPGARKVVLATNIAETSLTIDGIRFVIDCGYCKVKCYDPRSRMDSLKVVPITKANAIQRSGRAGRIAPGKCFRLYKKYTFDEEFEDQAIPEIQRTNLGNVVLLLKSLGIEDILDFDYMDPPFEKSLLAAIEELYYLSAIDSKGGLSLIGRKMVEIPCDPMISNMILKSEKYGCSEEIITIAAMLSLDNTIFYSPKNKKLYASQAHRAFMQEEGDHLTLLKVYNEYANNDYSSDWCKDNYIQSRSMKMARNIRDQLVNLADRLELKLISNSEDTVGICKAITAGFFLNTARFNGDSYRRIKSKDSVYMQMNSVFRILDEHPRYVVFNNIVNTTKEYMRTCTRIEPRWLTDIAPHIYKDIDFEGDSKYKRMPK 2681
            +++R+ +++K K ++ +  + N+KK   +A     M   D + +   +R +SR +YL KR+ +K+EDL  +++++E  F  + LT+RE KE + K+ I      YK A  +EK  +K   +YY        +IP  D  +     EE  +   G    WE       TLQ     ++ +  + + ++Y+L+++E   +++     T+     E+  E  + + +++  +I +V++ LP++  + +L+  I ++QI+VIEGETGSGKTTQIPQYL E GY      IGCTQPRRVAAMSV++RVAQE+ VKLG++VGYS+RFE   SE+T +KYMTDGMLLREFL +P +  YSV+IIDEAHERTL TDILFGL+  +   R DLK++++SAT D E+F  FF+ AP F+IPGRR+PV+ FYTK  EAD+++A VV++LQIH+TQ  GDILVFLTGQE+IE   ++LQER + LG+KI EL+VLPIY+ LPS+ QAKIF PTPPGARKVV+ATNIAETSLTIDGI +VID G+CK K Y+ R+ M+SL V P ++A+A QR+GRAGR+A GKCFRLY  + F  E E+  +PEIQRTNLGNVVLLLKSLGI D++ FD+MDPP  ++L+ A+E+LY L A++  G L+ +GR+M E+P DPM+S MIL SE+Y CSEE++TIAAMLS++N+IFY PK+K ++A  A   F+   GDHL LL VY ++  + +S+ WC +N+IQ RSMK AR++R+QL  L +R+E+++ S + D+  I K+ITAG+F +TAR +   Y+ +K + +VY+  NS   + +E PR+++++ +V TTKE+MR    I+  WL ++APH YK  + E DS  K+MP+
Sbjct:  182 FAERVKQRDKEKTRHIL--ERNDKKAYEEAQKRLKMAEEDQKKMLPELRKQSRWDYLAKREQEKLEDLEAEILDEEYLFSSDNLTDRERKELDYKRQIRDLARDYKTAGAKEKEERK--NRYYMPEENRKKSIPQRDLELEF---EETPREGGGEQGRWEEARVATATLQFGAKAERERRLKEEKEKYQLVLEEEEMINFVSTAITMKGTQSEKDIEPELSQAEKQKQSIQEVRRSLPVFPYRQDLLNAIRDHQILVIEGETGSGKTTQIPQYLMEDGYTKGGMKIGCTQPRRVAAMSVSARVAQEVGVKLGNEVGYSIRFEDCTSERTVLKYMTDGMLLREFLTEPDLASYSVIIIDEAHERTLHTDILFGLIKDIARFRPDLKVLVASATLDTERFSCFFDDAPVFRIPGRRFPVDIFYTKAPEADYLDACVVSVLQIHVTQPPGDILVFLTGQEEIESCCENLQERCRRLGSKISELLVLPIYANLPSDMQAKIFNPTPPGARKVVVATNIAETSLTIDGIIYVIDPGFCKQKSYNARTGMESLIVTPCSRASANQRAGRAGRVAAGKCFRLYTAWAFKHEMEETTVPEIQRTNLGNVVLLLKSLGINDLIHFDFMDPPPHETLVLALEQLYALGALNHLGELTKLGRRMAELPVDPMLSKMILASEQYKCSEEVLTIAAMLSVNNSIFYRPKDKVVHADNARMNFIVPGGDHLVLLNVYTQWVESGFSTQWCFENFIQFRSMKRARDVREQLEGLMERIEVEVCSANGDSTPIRKSITAGYFYHTARLSKGGYKTVKHQQTVYVHPNS--SLFEEQPRWLIYHELVFTTKEFMRQVIEIDSAWLLEVAPHYYKSKELE-DSTNKKMPR 1043          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 vs. Ensembl Cavefish
Match: dhx16 (DEAH-box helicase 16 [Source:NCBI gene;Acc:103040087])

HSP 1 Score: 805.823 bits (2080), Expect = 0.000e+0
Identity = 420/867 (48.44%), Postives = 602/867 (69.43%), Query Frame = 3
Query:  156 YSQRISEKEKSKNKNYVSGQTNEKKFRSQAMKYRDNETVTENIRIKSRQEYLLKRKADKIEDLHYDLIEDELYFKKEELTNRELKEKEAKKMI------YKVAKMQEKSVKKVNEKYY--------TIPSNDSTIVMNVTEERKKSRKGGLNEWE-------TLQLKNAIDQGKVSRRQDDEYELLVDE--FVDYEQEE-TLIPQNPEELTEKVIEKIDEKDLAISQVQKLLPIYRLKNELIKMIAENQIVVIEGETGSGKTTQIPQYLYEAGYCVEDKIIGCTQPXXXXXXXXXXXXXQEMNVKLGDKVGYSVRFEAKVSEQTQIKYMTDGMLLREFLNDPTVGMYSVLIIDEAHERTLQTDILFGLLSAVTEVRKDLKIIISSATCDVEKFCQFFE-APFFKIPGRRYPVETFYTKDQEADFVEAAVVTILQIHITQSDGDILVFLTGQEDIEEAMDSLQERIKALGTKIRELIVLPIYSALPSEKQAKIFLPTPPGARKVVLATNIAETSLTIDGIRFVIDCGYCKVKCYDPRSRMDSLKVVPITKANAIQRSGRAGRIAPGKCFRLYKKYTFDEEFEDQAIPEIQRTNLGNVVLLLKSLGIEDILDFDYMDPPFEKSLLAAIEELYYLSAIDSKGGLSLIGRKMVEIPCDPMISNMILKSEKYGCSEEIITIAAMLSLDNTIFYSPKNKKLYASQAHRAFMQEEGDHLTLLKVYNEYANNDYSSDWCKDNYIQSRSMKMARNIRDQLVNLADRLELKLISNSEDTVGICKAITAGFFLNTARFNGDSYRRIKSKDSVYMQMNSVFRILDEHPRYVVFNNIVNTTKEYMRTCTRIEPRWLTDIAPHIYKDIDFEGDSKYKRMPK 2681
            +++R+ +++K K ++ +  + N+KK                 +R +SR +YL KR+ +K+EDL  +++++E  F  + LT+RE KE + K+ I      YK A  +EK  +K   +YY        +IP  D  +     EE  +   G    WE       TLQ     ++ +  + + ++Y+L+++E   +++     T+     E+  E  + + +++  +I +V++ LP++  + +L+  I ++QI+VIEGETGSGKTTQIPQYL E GY      IGCTQPRRVAAMSV++RVAQE+ VKLG++VGYS+RFE   SE+T +KYMTDGMLLREFL +P +  YSV+IIDEAHERTL TDILFGL+  +   R DLK++++SAT D E+F  FF+ AP F+IPGRR+PV+ FYTK  EAD+++A VV++LQIH+TQ  GDILVFLTGQE+IE   ++LQER + LG+KI EL+VLPIY+ LPS+ QAKIF PTPPGARKVV+ATNIAETSLTIDGI +VID G+CK K Y+ R+ M+SL V P ++A+A QR+GRAGR+A GKCFRLY  + F  E E+  +PEIQRTNLGNVVLLLKSLGI D++ FD+MDPP  ++L+ A+E+LY L A++  G L+ +GR+M E+P DPM+S MIL SE+Y CSEE++TIAAMLS++N+IFY PK+K ++A  A   F+   GDHL LL VY ++  + +S+ WC +N+IQ RSMK AR++R+QL  L +R+E+++ S + D+  I K+ITAG+F +TAR +   Y+ +K + +VY+  NS   + +E PR+++++ +V TTKE+MR    I+  WL ++APH YK  + E DS  K+MP+
Sbjct:  168 FAERVKQRDKEKTRHIL--ERNDKKL--------------PELRKQSRWDYLAKREQEKLEDLEAEILDEEYLFSSDNLTDRERKELDYKRQIRDLARDYKTAGAKEKEERK--NRYYMPEENRKKSIPQRDLELEF---EETPREGGGEQGRWEEARVATATLQFGAKAERERRLKEEKEKYQLVLEEEEMINFVSTAITMKGTQSEKDIEPELSQAEKQKQSIQEVRRSLPVFPYRQDLLNAIRDHQILVIEGETGSGKTTQIPQYLMEDGYTKGGMKIGCTQPRRVAAMSVSARVAQEVGVKLGNEVGYSIRFEDCTSERTVLKYMTDGMLLREFLTEPDLASYSVIIIDEAHERTLHTDILFGLIKDIARFRPDLKVLVASATLDTERFSCFFDDAPVFRIPGRRFPVDIFYTKAPEADYLDACVVSVLQIHVTQPPGDILVFLTGQEEIESCCENLQERCRRLGSKISELLVLPIYANLPSDMQAKIFNPTPPGARKVVVATNIAETSLTIDGIIYVIDPGFCKQKSYNARTGMESLIVTPCSRASANQRAGRAGRVAAGKCFRLYTAWAFKHEMEETTVPEIQRTNLGNVVLLLKSLGINDLIHFDFMDPPPHETLVLALEQLYALGALNHLGELTKLGRRMAELPVDPMLSKMILASEQYKCSEEVLTIAAMLSVNNSIFYRPKDKVVHADNARMNFIVPGGDHLVLLNVYTQWVESGFSTQWCFENFIQFRSMKRARDVREQLEGLMERIEVEVCSANGDSTPIRKSITAGYFYHTARLSKGGYKTVKHQQTVYVHPNS--SLFEEQPRWLIYHELVFTTKEFMRQVIEIDSAWLLEVAPHYYKSKELE-DSTNKKMPR 1010          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 vs. Ensembl Cavefish
Match: dhx16 (DEAH-box helicase 16 [Source:NCBI gene;Acc:103040087])

HSP 1 Score: 784.252 bits (2024), Expect = 0.000e+0
Identity = 409/838 (48.81%), Postives = 588/838 (70.17%), Query Frame = 3
Query:  156 YSQRISEKEKSKNKNYVSGQTNEKKFRSQA-----MKYRDNETVTENIRIKSRQEYLLKRKADKIEDLHYDLIEDELYFKKEELTNRELKEKEAKKMI------YKVAKMQEKSVKKVNEKYY--------TIPSNDSTIVMNVTEERKKSRKGGLNEWE-------TLQLKNAIDQGKVSRRQDDEYELLVDE--FVDYEQEE-TLIPQNPEELTEKVIEKIDEKDLAISQVQKLLPIYRLKNELIKMIAENQIVVIEGETGSGKTTQIPQYLYEAGYCVEDKIIGCTQPXXXXXXXXXXXXXQEMNVKLGDKVGYSVRFEAKVSEQTQIKYMTDGMLLREFLNDPTVGMYSVLIIDEAHERTLQTDILFGLLSAVTEVRKDLKIIISSATCDVEKFCQFFE-APFFKIPGRRYPVETFYTKDQEADFVEAAVVTILQIHITQSDGDILVFLTGQEDIEEAMDSLQERIKALGTKIRELIVLPIYSALPSEKQAKIFLPTPPGARKVVLATNIAETSLTIDGIRFVIDCGYCKVKCYDPRSRMDSLKVVPITKANAIQRSGRAGRIAPGKCFRLYKKYTFDEEFEDQAIPEIQRTNLGNVVLLLKSLGIEDILDFDYMDPPFEKSLLAAIEELYYLSAIDSKGGLSLIGRKMVEIPCDPMISNMILKSEKYGCSEEIITIAAMLSLDNTIFYSPKNKKLYASQAHRAFMQEEGDHLTLLKVYNEYANNDYSSDWCKDNYIQSRSMKMARNIRDQLVNLADRLELKLISNSEDTVGICKAITAGFFLNTARFNGDSYRRIKSKDSVYMQMNSVFRILDEHPRYVVFNNIVNTTKEYMR 2579
            +++R+ +++K K ++ +  + N+KK   +A     M   D + +   +R +SR +YL KR+ +K+EDL  +++++E  F  + LT+RE KE + K+ I      YK A  +EK  +K   +YY        +IP  D  +     EE  +   G    WE       TLQ     ++ +  + + ++Y+L+++E   +++     T+     E+  E  + + +++  +I +V++ LP++  + +L+  I ++QI+VIEGETGSGKTTQIPQYL E GY      IGCTQPRRVAAMSV++RVAQE+ VKLG++VGYS+RFE   SE+T +KYMTDGMLLREFL +P +  YSV+IIDEAHERTL TDILFGL+  +   R DLK++++SAT D E+F  FF+ AP F+IPGRR+PV+ FYTK  EAD+++A VV++LQIH+TQ  GDILVFLTGQE+IE   ++LQER + LG+KI EL+VLPIY+ LPS+ QAKIF PTPPGARKVV+ATNIAETSLTIDGI +VID G+CK K Y+ R+ M+SL V P ++A+A QR+GRAGR+A GKCFRLY  + F  E E+  +PEIQRTNLGNVVLLLKSLGI D++ FD+MDPP  ++L+ A+E+LY L A++  G L+ +GR+M E+P DPM+S MIL SE+Y CSEE++TIAAMLS++N+IFY PK+K ++A  A   F+   GDHL LL VY ++  + +S+ WC +N+IQ RSMK AR++R+QL  L +R+E+++ S + D+  I K+ITAG+F +TAR +   Y+ +K + +VY+  NS   + +E PR+++++ +V TTKE+MR
Sbjct:  182 FAERVKQRDKEKTRHIL--ERNDKKAYEEAQKRLKMAEEDQKKMLPELRKQSRWDYLAKREQEKLEDLEAEILDEEYLFSSDNLTDRERKELDYKRQIRDLARDYKTAGAKEKEERK--NRYYMPEENRKKSIPQRDLELEF---EETPREGGGEQGRWEEARVATATLQFGAKAERERRLKEEKEKYQLVLEEEEMINFVSTAITMKGTQSEKDIEPELSQAEKQKQSIQEVRRSLPVFPYRQDLLNAIRDHQILVIEGETGSGKTTQIPQYLMEDGYTKGGMKIGCTQPRRVAAMSVSARVAQEVGVKLGNEVGYSIRFEDCTSERTVLKYMTDGMLLREFLTEPDLASYSVIIIDEAHERTLHTDILFGLIKDIARFRPDLKVLVASATLDTERFSCFFDDAPVFRIPGRRFPVDIFYTKAPEADYLDACVVSVLQIHVTQPPGDILVFLTGQEEIESCCENLQERCRRLGSKISELLVLPIYANLPSDMQAKIFNPTPPGARKVVVATNIAETSLTIDGIIYVIDPGFCKQKSYNARTGMESLIVTPCSRASANQRAGRAGRVAAGKCFRLYTAWAFKHEMEETTVPEIQRTNLGNVVLLLKSLGINDLIHFDFMDPPPHETLVLALEQLYALGALNHLGELTKLGRRMAELPVDPMLSKMILASEQYKCSEEVLTIAAMLSVNNSIFYRPKDKVVHADNARMNFIVPGGDHLVLLNVYTQWVESGFSTQWCFENFIQFRSMKRARDVREQLEGLMERIEVEVCSANGDSTPIRKSITAGYFYHTARLSKGGYKTVKHQQTVYVHPNS--SLFEEQPRWLIYHELVFTTKEFMR 1010          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 vs. Ensembl Cavefish
Match: dhx8 (DEAH-box helicase 8 [Source:NCBI gene;Acc:103035799])

HSP 1 Score: 679.863 bits (1753), Expect = 0.000e+0
Identity = 339/647 (52.40%), Postives = 470/647 (72.64%), Query Frame = 3
Query:  750 LAISQVQKLLPIYRLKNELIKMIAENQIVVIEGETGSGKTTQIPQYLYEAGYCVEDKIIGCTQPXXXXXXXXXXXXXQEMNVKLGDKVGYSVRFEAKVSEQTQIKYMTDGMLLREFLNDPTVGMYSVLIIDEAHERTLQTDILFGLLSAVTEVRKDLKIIISSATCDVEKFCQFF-EAPFFKIPGRRYPVETFYTKDQEADFVEAAVVTILQIHITQSDGDILVFLTGQEDIEEAMDSLQERIKALGTKIRELIVLPIYSALPSEKQAKIFLPTPPGARKVVLATNIAETSLTIDGIRFVIDCGYCKVKCYDPRSRMDSLKVVPITKANAIQRSGRAGRIAPGKCFRLYKKYTFDEEFEDQAIPEIQRTNLGNVVLLLKSLGIEDILDFDYMDPPFEKSLLAAIEELYYLSAIDSKGGLSLIGRKMVEIPCDPMISNMILKSEKYGCSEEIITIAAMLSLDNTIFYSPKNKKLYASQAHRAFMQEEGDHLTLLKVYNEYANNDYSSDWCKDNYIQSRSMKMARNIRDQLVNLADRLELKLISNSEDTVGICKAITAGFFLNTARFNG-DSYRRIKSKDSVYMQMNSVFRILDEHPRYVVFNNIVNTTKEYMRTCTRIEPRWLTDIAPHIYKDIDFEGDSKYKRMPKL 2684
            L+I + ++ LPIY+LK +LI+ + +NQI+++ GETGSGKTTQI QYL EAGY    KI GCTQPRRVAAMSVA RV++E    LG +VGY++RFE   S +T IKYMTDGMLLRE L DP +G Y+++++DEAHERT+ TD+LFGLL    + R D+K+I++SAT D  KF Q+F EAP F IPGR YPVE  YTK+ E D+++A+++T++QIH+T+  GDILVFLTGQE+I+ A + L ER+K+LG  + ELI+LP+YSALPSE Q +IF P PPG+RKVV+ATNIAETSLTIDGI +V+D G+ K K Y+ ++ +D L V PI++A A QR+GRAGR  PGKC+RLY +  + +E     +PEIQRTNL + VL LK++GI D+L FD+MD P  ++L+ A+E+LY L A+D +G L+ +GR+M E P +PM+  M++ S   GCSEE++TI +MLS+ N +FY PK+K+  A Q    F Q EGDHLTLL VYN + NN +S+ WC +N+IQ+RS++ A++IR Q++ + DR +L + S  + TV + KAI +GFF N A+ +  + YR +  +  VY+  +S   + +  P +VV++ +V TTKEYMR  T I+PRWL + AP  +K  D    SK K+  +L
Sbjct:  537 LSIIEQRESLPIYKLKEQLIQAVHDNQILIVIGETGSGKTTQITQYLAEAGYTTRGKI-GCTQPRRVAAMSVAKRVSEEYGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPDLGQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRTDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEVLYTKEPETDYLDASLITVMQIHLTEPPGDILVFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQN-VFYRPKDKQALADQKKAKFHQPEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVFSCGKATVRVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSA--LFNRQPEWVVYHELVLTTKEYMREVTTIDPRWLVEFAPAFFKVSDPTRLSKQKKQQRL 1179          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 vs. Ensembl Cavefish
Match: dhx8 (DEAH-box helicase 8 [Source:NCBI gene;Acc:103035799])

HSP 1 Score: 679.478 bits (1752), Expect = 0.000e+0
Identity = 339/647 (52.40%), Postives = 470/647 (72.64%), Query Frame = 3
Query:  750 LAISQVQKLLPIYRLKNELIKMIAENQIVVIEGETGSGKTTQIPQYLYEAGYCVEDKIIGCTQPXXXXXXXXXXXXXQEMNVKLGDKVGYSVRFEAKVSEQTQIKYMTDGMLLREFLNDPTVGMYSVLIIDEAHERTLQTDILFGLLSAVTEVRKDLKIIISSATCDVEKFCQFF-EAPFFKIPGRRYPVETFYTKDQEADFVEAAVVTILQIHITQSDGDILVFLTGQEDIEEAMDSLQERIKALGTKIRELIVLPIYSALPSEKQAKIFLPTPPGARKVVLATNIAETSLTIDGIRFVIDCGYCKVKCYDPRSRMDSLKVVPITKANAIQRSGRAGRIAPGKCFRLYKKYTFDEEFEDQAIPEIQRTNLGNVVLLLKSLGIEDILDFDYMDPPFEKSLLAAIEELYYLSAIDSKGGLSLIGRKMVEIPCDPMISNMILKSEKYGCSEEIITIAAMLSLDNTIFYSPKNKKLYASQAHRAFMQEEGDHLTLLKVYNEYANNDYSSDWCKDNYIQSRSMKMARNIRDQLVNLADRLELKLISNSEDTVGICKAITAGFFLNTARFNG-DSYRRIKSKDSVYMQMNSVFRILDEHPRYVVFNNIVNTTKEYMRTCTRIEPRWLTDIAPHIYKDIDFEGDSKYKRMPKL 2684
            L+I + ++ LPIY+LK +LI+ + +NQI+++ GETGSGKTTQI QYL EAGY    KI GCTQPRRVAAMSVA RV++E    LG +VGY++RFE   S +T IKYMTDGMLLRE L DP +G Y+++++DEAHERT+ TD+LFGLL    + R D+K+I++SAT D  KF Q+F EAP F IPGR YPVE  YTK+ E D+++A+++T++QIH+T+  GDILVFLTGQE+I+ A + L ER+K+LG  + ELI+LP+YSALPSE Q +IF P PPG+RKVV+ATNIAETSLTIDGI +V+D G+ K K Y+ ++ +D L V PI++A A QR+GRAGR  PGKC+RLY +  + +E     +PEIQRTNL + VL LK++GI D+L FD+MD P  ++L+ A+E+LY L A+D +G L+ +GR+M E P +PM+  M++ S   GCSEE++TI +MLS+ N +FY PK+K+  A Q    F Q EGDHLTLL VYN + NN +S+ WC +N+IQ+RS++ A++IR Q++ + DR +L + S  + TV + KAI +GFF N A+ +  + YR +  +  VY+  +S   + +  P +VV++ +V TTKEYMR  T I+PRWL + AP  +K  D    SK K+  +L
Sbjct:  576 LSIIEQRESLPIYKLKEQLIQAVHDNQILIVIGETGSGKTTQITQYLAEAGYTTRGKI-GCTQPRRVAAMSVAKRVSEEYGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPDLGQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRTDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEVLYTKEPETDYLDASLITVMQIHLTEPPGDILVFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQN-VFYRPKDKQALADQKKAKFHQPEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVFSCGKATVRVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSA--LFNRQPEWVVYHELVLTTKEYMREVTTIDPRWLVEFAPAFFKVSDPTRLSKQKKQQRL 1218          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 vs. Ensembl Sea Lamprey
Match: dhx8 (DEAH (Asp-Glu-Ala-His) box polypeptide 8 [Source:ZFIN;Acc:ZDB-GENE-050809-39])

HSP 1 Score: 665.611 bits (1716), Expect = 0.000e+0
Identity = 330/647 (51.00%), Postives = 471/647 (72.80%), Query Frame = 3
Query:  750 LAISQVQKLLPIYRLKNELIKMIAENQIVVIEGETGSGKTTQIPQYLYEAGYCVEDKIIGCTQPXXXXXXXXXXXXXQEMNVKLGDKVGYSVRFEAKVSEQTQIKYMTDGMLLREFLNDPTVGMYSVLIIDEAHERTLQTDILFGLLSAVTEVRKDLKIIISSATCDVEKFCQFF-EAPFFKIPGRRYPVETFYTKDQEADFVEAAVVTILQIHITQSDGDILVFLTGQEDIEEAMDSLQERIKALGTKIRELIVLPIYSALPSEKQAKIFLPTPPGARKVVLATNIAETSLTIDGIRFVIDCGYCKVKCYDPRSRMDSLKVVPITKANAIQRSGRAGRIAPGKCFRLYKKYTFDEEFEDQAIPEIQRTNLGNVVLLLKSLGIEDILDFDYMDPPFEKSLLAAIEELYYLSAIDSKGGLSLIGRKMVEIPCDPMISNMILKSEKYGCSEEIITIAAMLSLDNTIFYSPKNKKLYASQAHRAFMQEEGDHLTLLKVYNEYANNDYSSDWCKDNYIQSRSMKMARNIRDQLVNLADRLELKLISNSEDTVGICKAITAGFFLNTARFNG-DSYRRIKSKDSVYMQMNSVFRILDEHPRYVVFNNIVNTTKEYMRTCTRIEPRWLTDIAPHIYKDIDFEGDSKYKRMPKL 2684
            ++I + ++ LPIY+LK +L++ + +NQI+++ GETGSGKTTQI QYL EAGY    KI GCTQPRRVAAMSVA RV++E    LG +VGY++RFE   S +T+IKYMTDGMLLRE L D  +  YSV+++DEAHERT+ TD+LFGLL    + R D+K+I++SAT D  KF Q+F EAP F IPGR YPVE  YTK+ E D+++A+++T++QIH+T+  GDIL+FLTGQE+I+ A + L ER+K+LG ++ ELI+LP+YSALPSE Q +IF P PPG+RKVV+ATNIAETSLTIDGI +V+D G+ K K Y+ ++ +D L V PI++A A QR+GRAGR  PGK +RLY +  + +E     +PEIQRTNL + VL LK++GI D+L FD+MD P  ++L+ A+E+LY L A+D +G L+ +GR+M E P +PM+  M++ S   GCSEE++TI +MLS+ N +FY PK+K+  A Q    F Q EGDHLTLL VYN + NN +S+ WC +N++Q+R+++ A+++R Q++ + DR +L ++S ++ TV + KA+ +GFF N A+ +  + YR +  +  VY+  +S   + +  P +VV++ +V TTKEYMR  T I+P+WL + AP  +K  D    SK K+  +L
Sbjct:   93 MSIIEQRESLPIYKLKEQLVQAVNDNQILIVIGETGSGKTTQITQYLAEAGYTTRGKI-GCTQPRRVAAMSVAKRVSEEFGCCLGQEVGYTIRFEDCTSPETKIKYMTDGMLLRECLIDSELMQYSVVMLDEAHERTIHTDVLFGLLKKTIKRRLDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEILYTKEPETDYLDASLITVMQIHLTEPPGDILLFLTGQEEIDTACEILYERMKSLGPEVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKTYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYQLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQN-VFYRPKDKQALADQKKAKFNQAEGDHLTLLAVYNSWKNNKFSNAWCYENFVQARTLRRAQDVRKQMLGIMDRHKLDVVSCAKATVRVQKAVLSGFFRNAAKKDPQEGYRTLVDQQVVYIHPSSA--LFNRQPEWVVYHELVLTTKEYMREVTTIDPKWLVEFAPAFFKVSDPTRLSKQKKQQRL 735          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 vs. Ensembl Sea Lamprey
Match: zgc:158828 (DEAH-box helicase 35 [Source:HGNC Symbol;Acc:HGNC:15861])

HSP 1 Score: 399.438 bits (1025), Expect = 1.375e-127
Identity = 233/642 (36.29%), Postives = 374/642 (58.26%), Query Frame = 3
Query:  747 DLAISQVQKLLPIYRLKNELIKMIAENQIVVIEGETGSGKTTQIPQYLYEAGYCVEDKIIGCTQPXXXXXXXXXXXXXQEMNVKLGDKVGYSVRFEAKVSEQ-TQIKYMTDGMLLREFLNDPTVGMYSVLIIDEAHERTLQTDILFGLLSAVTEVRKDLKIIISSATCDVEKFCQFFEAPFFKIPGRRYPVETFYTKDQEADFVEAAVVTILQIHITQSDGDILVFLTGQEDIEEAMDSLQERIKAL-----GTKIRELIVLPIYSALPSEKQAKIFLPTPPGARKVVLATNIAETSLTIDGIRFVIDCGYCKVKCYDPRSRMDSLKVVPITKANAIQRSGRAGRIAPGKCFRLYKKYTFDEEFEDQAIPEIQRTNLGNVVLLLKSLGIEDILDFDYMDPPFEKSLLAAIEELYYL-SAIDSKGGLSLIGRKMVEIPCDPMISNMILKSEKYGCSEEIITIAAMLSLDNTIFYSPKNKKLYASQAHRAFMQEEGDHLTLLKVYNEYANNDYSSDWCKDNYIQSRSMKMARNIRDQLVNLADRLELKLISNSEDTVGICKAITAGFFLNTARFNGDSYRRIKSKDSVYMQMNSVFRILDEHPRYVVFNNIVNTTKEYMRTCTRIE-----PRWLTDIAPHIYK 2636
             L+I Q ++ LPI+  +N ++ ++ + + VVI GETG GK+TQIPQYL EAG+  E  ++  TQPRRVAA +VA+RVA+E    LG +VGY +RF+     Q T+IK++TDGML+RE + DP +  YS L++                  ++ EV      I SS +   E  C   +   +++ G+     ++       D+V+  V TI++IH   +DGDIL FLTGQE++E  + ++ E ++A      G+  R +  LP+Y+ LP   Q K+F       RKVV+ATN+AETS+T+ GI FV+DCG+ K++ YDPR  +D+L V P ++A+A QR+GRAGR  PGKC+RLY +  F  +  +   PE++R+++  V+L LK+LGI+++L F ++ PP  +S++ A+E LY L  A       S +G +M E P  PM + M+L+S  +GCS+EIITIAAM+ + N +F SP N+K+ A++  R F  EEGDH+T+L V+  +  ++ SS WC+ +++  + +  A  ++DQL  L  R  +   SNS +       +     L +A+  G       +  +    + ++  ++  + +++    I +   + +   TR       P WLT++APH ++
Sbjct:   42 SLSIQQQRQRLPIFMHRNHVLYLVEKYRTVVIVGETGCGKSTQIPQYLAEAGWTAEGHVVAITQPRRVAATTVAARVAEERGALLGHEVGYCIRFDDCSDPQATRIKFLTDGMLVREMMADPLLKKYSPLLLRFGDTTAPYPTACSSFNRSLVEVTSS--TIPSSFSRAFECQCCLADYILWRV-GQCTNARSYILMYPVPDYVKTTVETIMKIHNDAADGDILAFLTGQEEVENVVSAVVEEVRAAAARSKGSLHRHVRALPMYAGLPYVDQMKVFERVGRNCRKVVVATNVAETSVTVPGIAFVVDCGFVKLRTYDPRRAVDALLVTPASRASAQQRAGRAGRSRPGKCYRLYPESEF-AKLPEATEPEMRRSDMAPVILQLKALGIDNVLRFSFLSPPPAESMVQAVELLYALGGAWRDASSSSPLGVRMAEFPMGPMYAKMLLESGTFGCSKEIITIAAMMQIQN-VFLSPPNQKIKAARQQRKFAVEEGDHMTMLNVFEAFVKHNKSSAWCQQHFLNYKGLVRAGALQDQLRKLLRRFHIP--SNSSNGTDPKLPLLTWCILTSAKATGFGTATKSNTANPPHPLCTLPALIGTYQQHLNLQKIFSIIHQRICETTRSATIYSGPAWLTELAPHFFQ 676          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 vs. Ensembl Sea Lamprey
Match: dhx34 (DEAH (Asp-Glu-Ala-His) box polypeptide 34 [Source:ZFIN;Acc:ZDB-GENE-061207-30])

HSP 1 Score: 330.872 bits (847), Expect = 3.149e-98
Identity = 202/558 (36.20%), Postives = 329/558 (58.96%), Query Frame = 3
Query:  768 QKLLPIYRLKNELIKMIAENQIVVIEGETGSGKTTQIPQYLYEAGYCVEDKIIGCTQPXXXXXXXXXXXXXQEMNVKLGDKVGYSVRFEAKVSEQTQIKYMTDGMLLREFLNDPTVGMYSVLIIDEAHERTLQTDILFGLLSAVTEVRKDLKIIISSATCDVEKFCQFF-EAPFFKIPGRRYPVETFYTKDQEADFVEAA-------VVTILQI--HITQSD--GDILVFLTGQEDIEEAMDSLQERIKALGTKIRELIVLPIYSALPSEKQAKIFLPTPPGARKVVLATNIAETSLTIDGIRFVIDCGYCKVKCYDPRSRMDSLKVVPITKANAIQRSGRAGRIAPGKCFRLYKKYTFDEEFEDQAIPEIQRTNLGNVVLLLKSLGIEDILDFDYMDPPFEKSLLAAIEELYYLSAIDSKGGLSLIGRKMVEIPCDPMISNMILKSEKYGCSEEIITIAAMLSLDNTIFYSPKNKKLYASQAHRAFMQEEGDHLTLLKVYNEY-----ANNDYSSDWCKDNYIQSRSMKMARNIRDQLVNLADRLELKLISNSEDTV 2390
            Q+ LPI+  +++L++++  +Q+VV+ G+TG GK+TQ+PQYL  AG       + CTQPRR+A MS+A RV+ E   + G ++GY +RFE   +  T++ ++T+G+LLR+   +  +  Y VLI+DE HER L  D+L G+L  +  +R DL++++ SAT +++ F ++  +AP  ++PGR YP++  Y    E +    +        + I+Q   H   +D  GD+LVFL+G  DI    ++ Q    +   + +  IVL ++S L +E+Q K+F   P G RK +++TNIAETS+TIDG+RF++D G  K   YDP+++M  L+   I++A+A QR GRAGR  PG CFRLY +  +D   E  A+PE+QR  L +VVL +KS+G+ D   F +++PP   SL  +++ L    A+D +  L+ IGR +  +P D +   M+L     G  E ++TIAA +S+ +  F+   +     S+A R+   + GD LTLL V+NE+          S  WCK + ++ + +    N++ Q   L   ++  L+   E+ V
Sbjct:  102 QRNLPIHEYRDQLVELVRAHQVVVVAGDTGCGKSTQVPQYLLSAGM----SRVACTQPRRIACMSLAKRVSYESLGEHGSQIGYQIRFETSKTAATKVLFLTEGLLLRQMQTEGFMSRYDVLILDEVHERHLHCDLLLGVLRELLPLRDDLRLVLMSATINIQLFSRYLGDAPVLQVPGRLYPIQVIYRPVPEEEKTGKSERIDPRPYLRIMQSIDHKYPADERGDLLVFLSGMADIARVAEAAQ----SYAVETKRWIVLQLHSTLSAEQQDKVFDLAPEGVRKCIVSTNIAETSVTIDGVRFIVDSGKVKEMSYDPKAKMQRLQEFWISRASAEQRKGRAGRTGPGVCFRLYAESEYD-ALEPYAVPEVQRVPLDSVVLQMKSMGLGDPRLFGFLEPPPASSLETSMQFLQEQGALDEQEELTPIGRVLATLPLDVLTGKMLLVGCVLGAVEPVLTIAAAMSVQSP-FHRNAHTNPDCSRARRSLESDHGDPLTLLNVFNEWVQVKSGGQVPSRKWCKRHGLEEQRLYEIANLQRQFKELL--VQFGLLGGGEEPV 647          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 vs. Ensembl Sea Lamprey
Match: dhx33 (DEAH (Asp-Glu-Ala-His) box polypeptide 33 [Source:NCBI gene;Acc:796505])

HSP 1 Score: 300.827 bits (769), Expect = 1.672e-93
Identity = 165/395 (41.77%), Postives = 242/395 (61.27%), Query Frame = 3
Query:  777 LPIYRLKNELIKMIAE-NQIVVIEGETGSGKTTQIPQYLYEAGYCVEDKIIGCTQPXXXXXXXXXXXXXQEMNVKLGDKVGYSVRFEAKVSEQTQIKYMTDGMLLREFLNDPTVGMYSVLIIDEAHERTLQTDILFGLLSAVTEVR-----KDLKIIISSATCDVEKFCQFFE-APFFKIPGRRYPVETFYTKDQEADFVEAAVVTILQIHITQ-SDGDILVFLTGQEDIEEAMDSLQERIKALGTKIRELIVLPIYSALPSEKQAKIFLPTPP-GARKVVLATNIAETSLTIDGIRFVIDCGYCKVKCYDPRSRMDSLKVVPITKANAIQRSGRAGRIAPGKCFRLYKKYTFDEEFEDQAIPEIQ-RTNLGNVVLLLKSLGIEDILDFDYMDPP 1931
            LPIY ++ EL + + E +  +VI G T  G TTQ+  +  E   C     +   QP    A+ V SR       +  D VGY+VRFE   S  T+++++TDGMLLRE L DP +   S +++DEAHER+L TD LFG++      R     + LK+I+ SAT DV++F  +F  AP   + GR++P++ FYT++  +DF+ A ++TI Q H  Q ++  IL FLTGQE+IE    + ++  + L   +  + V+P+Y+ALP  +Q ++F   PP G RKV+LATNIAETS+TI G+R VIDCG  K K + P + M+ L +  +++A A QR+GR+GR  PG C RLY +  F +   +   PE+Q R NL +V+L L +LGI D+  FD+MD P
Sbjct:   41 LPIYAVRAELTRRLQELHTAIVIFGITAQGSTTQVKSWTGEQD-CPPGGEVAYMQPSHTTAVCVPSRRDFYRQNRGRDVVGYTVRFEDVRSASTRVRFVTDGMLLREALGDPLLLATSAVVLDEAHERSLHTDTLFGVVKGAQRQRWEQKLRPLKVIVMSATMDVDRFVSYFNGAPVLYVEGRQHPIQIFYTREPHSDFLHATLITIFQTHQEQEAEHHILAFLTGQEEIEAMGRACRDLSRQLPPSVPRMCVVPLYAALPHAQQQRVFARAPPKGTRKVILATNIAETSITIPGVRTVIDCGLVKAKMFSPGTGMEVLALQKVSQAQAWQRAGRSGREGPGCCLRLYTEMHF-QSLAENTTPELQSRCNLTSVLLHLLALGISDVASFDFMDKP 433          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 vs. Ensembl Sea Lamprey
Match: dqx1 (DEAQ box RNA-dependent ATPase 1 [Source:ZFIN;Acc:ZDB-GENE-150224-1])

HSP 1 Score: 278.485 bits (711), Expect = 4.991e-84
Identity = 168/473 (35.52%), Postives = 267/473 (56.45%), Query Frame = 3
Query:  753 AISQVQKLLPIYRLKNELIKMIAENQIVVIEGETGSGKTTQIPQYLYEAGYC--VEDKIIGCTQPXXXXXXXXXXXXXQEMNVKLGDKVGYSVRFEAKVSEQTQIKYMTDGMLLREFLNDPTVGMYSVLIIDEAHERTLQTDILFGLLSAVTEVRKDLKIIISSATCDVEKFCQFF-EAPFFKIPGRRYPVETFYTKDQEADFVEAAVVTILQIHITQSDGDILVFLTGQEDIEEAMDSLQERIKALGTKIRELIVLPIYSALPSEKQA------KIFLPTPPGARKVVLATNIAETSLTIDGIRFVIDCGYCKVKCYDPRSRMDSLKVVPITKANAIQRSGRAGRIAP-GKCFRLYKKYTFDEEFEDQAIPEIQRTNLGNVVLLLKSLGIEDILDFDYMDPPFEKSLLAAIEELYYLSAIDSKGGLSLIGRKMVEIPCDPMISNMILKSEKYGCSEEIITIAAMLSLDNTIF 2141
            A+ + ++ LP++  +    + IA   ++++ GE G GK+TQIPQ+  E       E   + C QP  +AA S+A RVA EM++ +G +VGYSV FE   +  T +++ TD MLLRE  +DP +  Y  +++DE  ER+L TD+L GLL  V   R  L++++ +  C  E   +++ + P+ ++ G++  +     + ++ D V AAV  +L+IH     GD+LVFL   +D   A +  +   + L   + EL ++P+    P    A              G R+VVL++ IAE++ + +G+RFVID G      Y+PR R DS  V PI+++ A Q S  A R  P GKCFRLY +  F +E  +   P +  +NL  +VLLLK L I D+   D++D P   +   A+E+L YL+A+D+ G LS +G  M EIP DP ++  +L S ++ C  E++T+AAML++    F
Sbjct:   53 ALLKARRALPVWGAREMFRERIASYPVILVSGEPGVGKSTQIPQWCAEFALSRECEHGTVVCAQPHAMAATSLAVRVADEMDLNVGHEVGYSVPFEDCCTTDTILRFTTDEMLLRELTSDPQLDRYGAIVLDEVQERSLSTDVLMGLLRDVGRQRPGLRVVLVATPCAAEALHRYYGDVPWREVVGQQGQLVYTGVETEQRDVVRAAVKLVLEIHRAAQPGDVLVFLPSDKDASTAYEQARREARQLSPALGELRLVPLLPGHPGGAGALYDAGGAAATAKGRGGRRVVLSSGIAESAFSFEGVRFVIDSGLETKNVYNPRIRADSQVVRPISRSQAEQTSCCAVRAGPAGKCFRLYPESVF-KEMPELPPPRVLESNLTRLVLLLKRLDIADMGQCDFVDRPAPANRTKALEDLDYLAALDNDGNLSEVGIIMSEIPLDPQLAKALLASCEFDCVTEMLTLAAMLTVVPLCF 524          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 vs. Ensembl Yeast
Match: PRP22 (DEAH-box RNA-dependent ATPase/ATP-dependent RNA helicase; associates with lariat intermediates before the second catalytic step of splicing; mediates ATP-dependent mRNA release from the spliceosome and unwinds RNA duplexes; required for proofreading the exon ligation reaction [Source:SGD;Acc:S000000815])

HSP 1 Score: 598.971 bits (1543), Expect = 0.000e+0
Identity = 306/642 (47.66%), Postives = 434/642 (67.60%), Query Frame = 3
Query:  750 LAISQVQKLLPIYRLKNELIKMIAENQIVVIEGETGSGKTTQIPQYLYEAGYCVEDKIIGCTQPXXXXXXXXXXXXXQEMNVKLGDKVGYSVRFEAKVSEQTQIKYMTDGMLLREFLNDPTVGMYSVLIIDEAHERTLQTDILFGLLSAVTEVRKDLKIIISSATCDVEKFCQFF-EAPFFKIPGRRYPVETFYTKDQEADFVEAAVVTILQIHITQSDGDILVFLTGQEDIEEAMDSLQERIKALGTKIRELIVLPIYSALPSEKQAKIFLPTPPGARKVVLATNIAETSLTIDGIRFVIDCGYCKVKCYDPRSRMDSLKVVPITKANAIQRSGRAGRIAPGKCFRLYKKYTFDEEFEDQAIPEIQRTNLGNVVLLLKSLGIEDILDFDYMDPPFEKSLLAAIEELYYLSAIDSKGGLSLIGRKMVEIPCDPMISNMILKSEKYGCSEEIITIAAMLSLDNTIFYSPKNKKLYASQAHRAFMQEEGDHLTLLKVYNEYANNDYSSDWCKDNYIQSRSMKMARNIRDQLVNLADRLELKLISNSEDTVGICKAITAGFFLNTARFNGD-SYRRIKSKDSVYMQMNSVFRILDEHPRYVVFNNIVNTTKEYMRTCTRIEPRWLTDIAPHIYKDIDFEGDSKYK 2669
            L IS  ++ LP+Y +++ELI+ + +NQ +VI GETGSGKTTQI QYL E G+     +IGCTQPRRVAA+SVA RVA+E+  K+G  VGY++RFE      T+IKYMTDGML RE L DP +  YSV+++DEAHERT+ TD+LF LL      R +LK+I++SAT +  KF ++F   P   IPG+ +PVE  Y++  + D++EAA+  ++ IHI +  GDILVFLTGQE+I+   + L +R+K LG  I EL++LP+YSALPSE Q+KIF PTP G+RKVV ATNIAETS+TIDGI +V+D G+ K+  Y+ R+ ++ L V PI++A A QR GRAGR  PGKC+RLY +  F  E  +  +PEIQR NL + +L+LK++GI D+L FD+MDPP +  +L A+ ELY+L ++D +G L+ +G++M   P DP +S  +L S    CS+EI+TI +MLS+ N +FY PK+++L A      F    GDHLTLL VY  +   +YS  +CK N++  R +K AR+++ Q+  +  ++ LKLIS   D   I K   +GFF+N A+ +    Y+ I     V +  +S   +  +   YV++++IV T++EYM   T IEP+WL ++APH YK  D E  S+ K
Sbjct:  474 LPISAQRQTLPVYAMRSELIQAVRDNQFLVIVGETGSGKTTQITQYLDEEGFS-NYGMIGCTQPRRVAAVSVAKRVAEEVGCKVGHDVGYTIRFEDVTGPDTRIKYMTDGMLQREALLDPEMSKYSVIMLDEAHERTVATDVLFALLKKAAIKRPELKVIVTSATLNSAKFSEYFLNCPIINIPGKTFPVEVLYSQTPQMDYIEAALDCVIDIHINEGPGDILVFLTGQEEIDSCCEILYDRVKTLGDSIGELLILPVYSALPSEIQSKIFEPTPKGSRKVVFATNIAETSITIDGIYYVVDPGFAKINIYNARAGIEQLIVSPISQAQANQRKGRAGRTGPGKCYRLYTESAFYNEMLENTVPEIQRQNLSHTILMLKAMGINDLLKFDFMDPPPKNLMLNALTELYHLQSLDDEGKLTNLGKEMSLFPMDPTLSRSLLSSVDNQCSDEIVTIISMLSVQN-VFYRPKDRQLEADSKKAKFHHPYGDHLTLLNVYTRWQQANYSEQYCKTNFLHFRHLKRARDVKSQISMIFKKIGLKLISCHSDPDLIRKTFVSGFFMNAAKRDSQVGYKTINGGTEVGIHPSS--SLYGKEYEYVMYHSIVLTSREYMSQVTSIEPQWLLEVAPHFYKAGDAESQSRKK 1111          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 vs. Ensembl Yeast
Match: PRP43 (RNA helicase in the DEAH-box family; functions in both RNA polymerase I and polymerase II transcript metabolism; catalyzes removal of U2, U5, and U6 snRNPs from the postsplicing lariat-intron ribonucleoprotein complex; required for efficient biogenesis of both small- and large-subunit rRNAs; acts with Sqs1p to promote 20S to 18S rRNA processing catalyzed by endonuclease Nob1p [Source:SGD;Acc:S000003088])

HSP 1 Score: 567.385 bits (1461), Expect = 0.000e+0
Identity = 313/661 (47.35%), Postives = 443/661 (67.02%), Query Frame = 3
Query:  756 ISQVQKLLPIYRLKNELIKMIAENQIVVIEGETGSGKTTQIPQY-LYEAGYCVEDKIIGCTQPXXXXXXXXXXXXXQEMNVKLGDKVGYSVRFEAKVSEQTQIKYMTDGMLLREFLNDPTVGMYSVLIIDEAHERTLQTDILFGLLSAVTEVRKDLKIIISSATCDVEKFCQFF-EAPFFKIPGRRYPVETFYTKDQEADFVEAAVVTILQIHITQSDGDILVFLTGQEDIEEAMDSLQERIKALGTK-IRE-----LIVLPIYSALPSEKQAKIFLPTP------PGARKVVLATNIAETSLTIDGIRFVIDCGYCKVKCYDPRSRMDSLKVVPITKANAIQRSGRAGRIAPGKCFRLYKKYTFDEEFEDQAIPEIQRTNLGNVVLLLKSLGIEDILDFDYMDPPFEKSLLAAIEELYYLSAIDSKGGLSLIGRKMVEIPCDPMISNMILKSEKYGCSEEIITIAAMLSLDNTIFYSPKNKKLYASQAHRAFMQEEGDHLTLLKVYNEYANN---DYS-SDWCKDNYIQSRSMKMARNIRDQLVNLADRLELKLISNSEDTV----GICKAITAGFFLNTA--RFNGDSYRRIKSKDSVYMQMNSVFRILDEHPRYVVFNNIVNTTKEYMRTCTRIEPRWLTDIAPHIYKDIDFE-GDSK 2663
            I ++++ LP++  ++E +K+   NQI+V  GETGSGKTTQIPQ+ L++    +E+  + CTQPRRVAAMSVA RVA+EM+VKLG++VGYS+RFE K S +T +KYMTDGMLLRE + D  +  YS +I+DEAHERTL TDIL GLL  V + R DLKIII SAT D EKF ++F +AP   +PGR YPVE +YT + + D++++A+ T+LQIH T+  GDIL+FLTG+++IE+A+     +I   G + +RE     L V P+Y +LP  +Q +IF P P      PG RKVV++TNIAETSLTIDGI +V+D G+ K K Y+PR R++SL V PI+KA+A QR+GRAGR  PGKCFRLY +  F +E  +Q+ PEI R+NL + VL LK LGI+D++ FD+MDPP  ++++ A+EEL YL+ +D +G L+ +GR   + P DPM++ M++ S ++ CS+EI+TI AMLS+ N +F  P   K  A  A   F   +GDH+TLL VY+ + ++   +Y    WC+D+Y+  RS+  A NIR QL  L +R  L+L +   ++      I KA+ +GFF+  A  R     Y  +K    V +  ++V   L     +V++N  V T+K Y+RT T + P WL +IAP  Y   +F+ GD K
Sbjct:   86 ILKIRRELPVHAQRDEFLKLYQNNQIMVFVGETGSGKTTQIPQFVLFDEMPHLENTQVACTQPRRVAAMSVAQRVAEEMDVKLGEEVGYSIRFENKTSNKTILKYMTDGMLLREAMEDHDLSRYSCIILDEAHERTLATDILMGLLKQVVKRRPDLKIIIMSATLDAEKFQRYFNDAPLLAVPGRTYPVELYYTPEFQRDYLDSAIRTVLQIHATEEAGDILLFLTGEDEIEDAV----RKISLEGDQLVREEGCGPLSVYPLYGSLPPHQQQRIFEPAPESHNGRPG-RKVVISTNIAETSLTIDGIVYVVDPGFSKQKVYNPRIRVESLLVSPISKASAQQRAGRAGRTRPGKCFRLYTEEAFQKELIEQSYPEILRSNLSSTVLELKKLGIDDLVHFDFMDPPAPETMMRALEELNYLACLDDEGNLTPLGRLASQFPLDPMLAVMLIGSFEFQCSQEILTIVAMLSVPN-VFIRPTKDKKRADDAKNIFAHPDGDHITLLNVYHAFKSDEAYEYGIHKWCRDHYLNYRSLSAADNIRSQLERLMNRYNLELNTTDYESPKYFDNIRKALASGFFMQVAKKRSGAKGYITVKDNQDVLIHPSTV---LGHDAEWVIYNEFVLTSKNYIRTVTSVRPEWLIEIAPAYYDLSNFQKGDVK 737          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 vs. Ensembl Yeast
Match: PRP2 (RNA-dependent DExD/H-box ATPase; required for activation of spliceosome before first transesterification step in RNA splicing; implicated in rearranging and proofreading snRNA structure in catalytic activation of spliceosome; ortholog of human protein DHX16 [Source:SGD;Acc:S000005294])

HSP 1 Score: 555.829 bits (1431), Expect = 0.000e+0
Identity = 313/729 (42.94%), Postives = 454/729 (62.28%), Query Frame = 3
Query:  573 WETLQLKNAIDQGKVSRRQD------DEYELL--VDEFVDYEQEET-LIPQNP---EELTEKVIEKIDEKDLAISQVQKLLPIYRLKNELIKMIAENQIVVIEGETGSGKTTQIPQYLYEAGYCVEDKI-IGCTQPXXXXXXXXXXXXXQEMNVKLGDKVGYSVRFEAKVS-EQTQIKYMTDGMLLREFLNDPTVGMYSVLIIDEAHERTLQTDILFGLLSAVTEVRKDLKIIISSATCDVEKFCQFFE-APFFKIPGRRYPVETFYTKDQEADFVEAAVVTILQIHITQS-DGDILVFLTGQEDIEEAMDSLQERIKALGTKIRELIVLPIYSALPSEKQAKIFLPTPPGARKVVLATNIAETSLTIDGIRFVIDCGYCKVKCYDPRSRMDSLKVVPITKANAIQRSGRAGRIAPGKCFRLYKKYTFDEEFEDQAIPEIQRTNLGNVVLLLKSLGIEDILDFDYMDPPFEKSLLAAIEELYYLSAIDSKGGLSLIGRKMVEIPCDPMISNMILKSEKY----GCSEEIITIAAMLSLDNTIFYSPKNKKLYASQAHRAFMQEEGDHLTLLKVYNEYANNDYSSDWCKDNYIQSRSMKMARNIRDQLVNLADRLEL--------KLISNSEDTVG--ICKAITAGFFLNTARFNGDSYRRI-KSKDSVYMQMNSVFRILDEH-------PRYVVFNNIVNTTKEYMRTCTRI-EPRWLTDIAPHIYKDI 2642
            WE  QL+NA+  G+     D      D+Y+ +   D  +DY  EE  L+P+     E    + +E  +++ L I + +KLLP+++ K+EL++ I +NQ+++I GETGSGKTTQ+PQYL E G+  + K+ I  TQPRRVAA SVA+RVA EMNV LG +VGY +RFE K +  +T +KYMTDGMLLREFL D  +  YS ++IDEAHERTL TDIL GLL  +   R  LK++ISSAT + +KF +FF+  P F +PGRRYPV+  YT   EA+++ AA+ TI QIH TQS  GDILVFLTGQE+IE     L+E +  LG++ +++I+ PIY+ LP E+Q KIF PTP   RKVVLATNIAETSLTIDGIR+VID G+ K   Y P + M  L  VP ++A+  QR+GRAGR+ PGKCFR++ K+++  E E    PEI RTNL N VLLL SLG+ D++ F  MD P   +L  ++E LY L A++SKG ++ +G+ M E PC+P  + ++  +  +    G  EE +TI +ML    ++F   K        A     + E DH+  L+++N++ N+ +S  WC+D+ IQ ++M   RNIR+QL   ++++ L          I N    +   I +   +GF +N  +     Y+ + +S   + + ++    +   H        +YV++  ++ T+KE++R C  I +  WL D+ P I+KD+
Sbjct:  144 WEEQQLRNAM-AGQSDHPDDITLEGSDKYDYVFDTDAMIDYTNEEDDLLPEEKLQYEARLAQALETEEKRILTIQEARKLLPVHQYKDELLQEIKKNQVLIIMGETGSGKTTQLPQYLVEDGFTDQGKLQIAITQPRRVAATSVAARVADEMNVVLGKEVGYQIRFEDKTTPNKTVLKYMTDGMLLREFLTDSKLSKYSCIMIDEAHERTLATDILIGLLKDILPQRPTLKLLISSATMNAKKFSEFFDNCPIFNVPGRRYPVDIHYTLQPEANYIHAAITTIFQIHTTQSLPGDILVFLTGQEEIERTKTKLEEIMSKLGSRTKQMIITPIYANLPQEQQLKIFQPTPENCRKVVLATNIAETSLTIDGIRYVIDPGFVKENSYVPSTGMTQLLTVPCSRASVDQRAGRAGRVGPGKCFRIFTKWSYLHELELMPKPEITRTNLSNTVLLLLSLGVTDLIKFPLMDKPSIPTLRKSLENLYILGALNSKGTITRLGKMMCEFPCEPEFAKVLYTAATHEQCQGVLEECLTIVSMLHETPSLFIGQKR-----DAAASVLSEVESDHILYLEIFNQWRNSKFSRSWCQDHKIQFKTMLRVRNIRNQLFRCSEKVGLVEKNDQARMKIGNIAGYINARITRCFISGFPMNIVQLGPTGYQTMGRSSGGLNVSVHPTSILFVNHKEKAQRPSKYVLYQQLMLTSKEFIRDCLVIPKEEWLIDMVPQIFKDL 866          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 vs. Ensembl Yeast
Match: PRP16 (DEAH-box RNA helicase involved in second catalytic step of splicing and in exon ligation; exhibits ATP-dependent RNA unwinding activity; mediates the release of Yju2p and Cwc25p in the second step; in the absence of ATP, stabilizes the binding of Cwc25p to the spliceosome in the first catalytic step; missense mutation in human ortholog DHX38 associated with early-onset retinitis pigmentosa [Source:SGD;Acc:S000001794])

HSP 1 Score: 536.954 bits (1382), Expect = 5.284e-176
Identity = 307/642 (47.82%), Postives = 432/642 (67.29%), Query Frame = 3
Query:  756 ISQVQKLLPIYRLKNELIKMIAENQIVVIEGETGSGKTTQIPQYLYEAGYCVE-DKIIGCTQPXXXXXXXXXXXXXQEMNVKLGDKVGYSVRFE-AKVSEQTQIKYMTDGMLLREFLNDPTVGMYSVLIIDEAHERTLQTDILFGLLSAVTEVRKDLKIIISSATCDVEKFCQFF-EAPFFKIPGRRYPVETFYTKDQEADFVEAAVVTILQIHITQ--SDGDILVFLTGQEDIEEAMDSLQERI-----KALGT----KIRELIVLPIYSALPSEKQAKIFLPTPPGARKVVLATNIAETSLTIDGIRFVIDCGYCKVKCYDPRSRMDSLKVVPITKANAIQRSGRAGRIAPGKCFRLYKKYTFDEEFEDQAIPEIQRTNLGNVVLLLKSLGIEDILD-FDYMDPPFEKSLLAAIEELYYLSAIDSKGGLSLIGRKMVEIPCDPMISNMILKSEKYGCSEEIITIAAMLSLDNTIFYSPKNKKLYASQAHRAFMQEEGDHLTLLKVYNEYANNDYSSDWCKDNYIQSRSMKMARNIRDQLVNLADRLELKLISNSEDTVGICKAITAGFFLNTARFNG-DSYRRIKSKDSVYMQMNSVFRILDEHPRYVVFNNIVNTTKEYMRTCTRIEPRWLTDIAPHIY 2633
            I   ++ LP++R +++L+ +I ENQ+VVI GETGSGKTTQ+ QYLYE GY  +  K I  TQPRRVAA+SVA RVA EM V LG +VGYS+RFE    SE T++K++TDG+LLRE L D T+  YS +IIDEAHER+L TDIL G    +   R+DLK+II+SAT + +KF  FF  AP F IPGR +PV+T YT +   D+VEAAV   ++IH+    S GDIL+F+TGQEDIE   D+LQE+      K  GT    +I ++ +LPIYSALP++ Q KIF       RK+++ATNIAETSLTI GIR+VIDCGY K+K Y+P+  +DSL + PI+KANA QRSGRAGR APG  +RLY + TF E+   Q IPEIQRTNL N +LLLKSL + D L  F ++D P  ++ L+++ EL+++ AID+ G L+ +G +M + P  P +S ++L + + GCS+E++TI +MLS+   +FY PK ++  A  A   F   + DHLTLL V+ ++  N++SS WC  +++Q +S+  AR+IRDQL+ +    ++ +IS+ +D   I K I +GF    A+  G  +Y  +K+  SV +   S    L + P YVV++ ++ T+KEY+   T ++P WL +    +Y
Sbjct:  343 IKHTKEQLPVFRCRSQLLSLIRENQVVVIIGETGSGKTTQLAQYLYEEGYANDRGKSIVVTQPRRVAAISVAKRVAMEMQVPLGKEVGYSIRFEDVTDSECTKLKFVTDGILLRETLLDDTLDKYSCVIIDEAHERSLNTDILLGFFKILLARRRDLKLIITSATMNAKKFSAFFGNAPQFTIPGRTFPVQTIYTSNPVQDYVEAAVSQAVKIHLANDCSSGDILIFMTGQEDIETTFDTLQEKFLQVYSKKFGTANFEEINDIEILPIYSALPADLQFKIFQDLHGTKRKIIIATNIAETSLTIKGIRYVIDCGYSKLKVYNPKIGLDSLVITPISKANADQRSGRAGRTAPGTAYRLYTEDTFKEDMYLQTIPEIQRTNLSNTLLLLKSLDVTDELSKFPFIDKPPLQTFLSSLYELWFIGAIDTSGQLTPLGLQMAKFPLQPSLSKILLIAVRNGCSDEMLTIVSMLSVPQ-VFYRPKERQKEADIARNKFFIAKSDHLTLLNVFEQWRANNFSSHWCNKHFVQYKSLVRARDIRDQLLTILKSQKIPVISSGKDWDIIKKCICSGFAHQAAKITGLRNYVHLKTGVSVQLHPTSALHGLGDLPPYVVYHELLMTSKEYICCVTSVDPFWLMEYGGLLY 983          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 vs. Ensembl Yeast
Match: DHR2 (Predominantly nucleolar DEAH-box ATP-dependent RNA helicase; required for 18S rRNA synthesis [Source:SGD;Acc:S000001561])

HSP 1 Score: 395.201 bits (1014), Expect = 1.188e-125
Identity = 243/650 (37.38%), Postives = 394/650 (60.62%), Query Frame = 3
Query:  762 QVQKLLPIYRLKNELIKMIAENQIVVIEGETGSGKTTQIPQYLYEAGY-CVEDKIIGCTQPXXXXXXXXXXXXXQEMNVKLGDKVGYSVRFEAKVSEQTQIKYMTDGMLLREFLNDPTVGMYSVLIIDEAHERTLQTDILFGLL-SAVTEVRKDLKIIISSATCDVEKFCQFFE-APFFKIPGRRYPVETFYTKDQEADFVEAAVVTILQIHITQSDGDILVFLTGQEDIEEAMDSLQERIKALG--TKIRELIVLPIYSALPSEKQAKIFLPTPPGARKVVLATNIAETSLTIDGIRFVIDCGYCKVKCYDPRSRMDSLKVVPITKANAIQRSGRAGRIAPGKCFRLYKKYTFDEEFEDQAIPEIQRTNLGNVVLLLKSLGIEDILDFDYMDPPFEKSLLAAIEELYYLSAIDSKGGLSLIGRKMVEIPCDPMISNMILKSEKYGCSEEIITIAAMLSLDNTIFY-SPK------NKKLYASQAHRAFMQEEGDHLTLLKVYNEY-----ANNDYSS---DWCKDNYIQSRSMKMARNIRDQLVNLADRL----------ELKLISNSEDTVGICKAITAGFFLNTARFNGD-SYRRIKSKDSVYMQMNSVFRILDEHPRYVVFNNIVNTTKEYMRTCTRIEPRWLTDI 2618
            ++++ LP+Y+ K E++  I  N + V+ GETGSGK+TQIPQ++ E  Y   +   I  TQPRRVAA+++A+RVAQE   KLG++VGYSVRF+   + +T++KY+TDGMLLRE + +  +  YSV++IDEAHERT+ TD++ G L S +   R DL+II+ SAT   EKF +FF  AP   + GR++ V+ +Y K    D V+A +   +QI+  +  GDIL FL GQE+I++A+  +++  K +     +  ++  P+Y+ALP+ +Q+ +F P     RKVV +TNIAETS+TI G++FV+D G  KVK +  +  + +L  VPI++A+A+QRSGRAGR + GK FRLY +  +  +   Q+ PEI R+++ + VL+LK  G++D+L++ + + P +++++  ++ELY L A+D++G ++  G++M  +P  P +S++++K+ + GC  ++I I + LS++N +   SP+       ++L    A + +    GD + L ++++ Y      + D SS   DWCK   I  R  K    +RDQL     RL            K+  + E    I K    GF  NTA    D SYR + + + + +  +S+  +    P  +++   V TTK Y R  +RIE  WL ++
Sbjct:   76 KMRETLPVYQHKREIMSYIESNPVTVLIGETGSGKSTQIPQFVLEKLYDTKKHGSIAVTQPRRVAAINLATRVAQEHGCKLGEQVGYSVRFDNTTTTRTRLKYLTDGMLLRELMMNSDLREYSVIVIDEAHERTVLTDLILGFLKSLIQGPRPDLRIIVMSATLQAEKFSEFFNNAPILFVEGRKFDVKQYYLKAPTDDIVDAVIRCCIQINQGEELGDILCFLPGQEEIDKAVTIMEKIAKYVSDEAPVPLIVPYPLYAALPAVQQSLVFAPIKGFKRKVVFSTNIAETSVTISGVKFVVDSGLRKVKVWRHQLGLATLLTVPISQASAMQRSGRAGRESEGKSFRLYCESDY-VKLPKQSEPEIARSDVTSPVLMLKRYGVDDLLNWTWFENPGKEAIVMGLQELYELGALDTRGKITKRGQQMALLPLQPHLSSVLIKASEVGCLSQVIDIVSCLSVENLLLNPSPEERDEVNERRLSLCNAGKRY----GDLIMLKELFDIYFYELGKSQDASSERNDWCKGLCISIRGFKNVIRVRDQLRVYCKRLFSSISEEDEESKKIGEDGELISKILKCFLTGFIKNTAIGMPDRSYRTVSTGEPISIHPSSMLFMNKSCPG-IMYTEYVFTTKGYARNVSRIELSWLQEV 719          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 vs. Ensembl Nematostella
Match: EDO49560 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGM4])

HSP 1 Score: 526.168 bits (1354), Expect = 1.309e-178
Identity = 250/494 (50.61%), Postives = 355/494 (71.86%), Query Frame = 3
Query: 1209 RKDLKIIISSATCDVEKFCQFF-EAPFFKIPGRRYPVETFYTKDQEADFVEAAVVTILQIHITQSDGDILVFLTGQEDIEEAMDSLQERIKALGTKIRELIVLPIYSALPSEKQAKIFLPTPPGARKVVLATNIAETSLTIDGIRFVIDCGYCKVKCYDPRSRMDSLKVVPITKANAIQRSGRAGRIAPGKCFRLYKKYTFDEEFEDQAIPEIQRTNLGNVVLLLKSLGIEDILDFDYMDPPFEKSLLAAIEELYYLSAIDSKGGLSLIGRKMVEIPCDPMISNMILKSEKYGCSEEIITIAAMLSLDNTIFYSPKNKKLYASQAHRAFMQEEGDHLTLLKVYNEYANNDYSSDWCKDNYIQSRSMKMARNIRDQLVNLADRLELKLISNSEDTVGICKAITAGFFLNTARFNG-DSYRRIKSKDSVYMQMNSVFRILDEHPRYVVFNNIVNTTKEYMRTCTRIEPRWLTDIAPHIYKDIDFEGDSKYKRMPKL 2684
            R DLK+I++SAT D  KF  FF EAP F IPGR +PVE  YTK+ E+D+++AA++T++QIH+T+  GDILVFLTGQE+I+ A + L ER K+LG  + ELI+LP+YSALPSE Q +IF P PPG+RK V+ATNIAETSLTIDGI +V+D G+ K   Y+ +S MD+L V PI++A A QRSGRAGR  PGKC+RLY +  + +E    A+PEIQRTNL + +L LK++GI D+L FD+MDPP  +++++A+E L+ LSA+D++G L+ +GR+M E P +P +S M+++S   GCS+EI+TI +MLS+ N +FY PK+K+  A Q    F Q EGDHLTLL VYN + NN +S+ WC +N++Q+RS++ A++IR Q++ L DR +L ++S  + T  + KAIT+GFF N AR +  + YR +     VY+  +S   + +  P +VV++ +V TTKEYMR  T I+P+WL + AP  ++  D    SK KR  +L
Sbjct:    8 RPDLKLIVTSATLDAVKFSTFFFEAPIFTIPGRTFPVEILYTKEAESDYLDAALITVMQIHLTEPPGDILVFLTGQEEIDTACEILYERTKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKCVIATNIAETSLTIDGIYYVVDPGFVKQNVYNSKSGMDALVVTPISQAQAKQRSGRAGRTGPGKCYRLYTERAYRDEMLATAVPEIQRTNLASTILSLKAMGINDLLSFDFMDPPPMETMISAMEALHSLSALDNEGLLTRLGRRMAEFPLEPQLSKMLIQSVHLGCSDEILTIVSMLSVQN-VFYRPKDKQALADQKKAKFHQPEGDHLTLLAVYNSWKNNKFSNAWCFENFVQARSLRRAQDIRKQMLGLMDRHKLDVVSCGKHTARVQKAITSGFFRNAARKDPQEGYRTVVDNQVVYIHPSSA--LFNRQPEWVVYHELVLTTKEYMREVTTIDPKWLVEFAPSFFRVADPTKLSKRKRHERL 498          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 vs. Ensembl Nematostella
Match: EDO32531 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUS3])

HSP 1 Score: 528.865 bits (1361), Expect = 3.324e-177
Identity = 282/638 (44.20%), Postives = 420/638 (65.83%), Query Frame = 3
Query:  762 QVQKL-LPIYRLKNELIKMIAENQIVVIEGETGSGKTTQIPQYLYEAGYCVEDKIIGCTQPXXXXXXXXXXXXXQEMNVKLGDKVGYSVRFEAKVSEQTQIKYMTDGMLLREFLNDPTVGMYSVLIIDEAHERTLQTDILFGLLSAVTEVRKD-----LKIIISSATCDVEKFCQFF-EAPFFKIPGRRYPVETFYTKDQEADFVEAAVVTILQIHITQS-DGDILVFLTGQEDIEEAMDSLQERIKALGTKIRELIVLPIYSALPSEKQAKIFLPTPPGARKVVLATNIAETSLTIDGIRFVIDCGYCKVKCYDPRSRMDSLKVVPITKANAIQRSGRAGRIAPGKCFRLYKKYTFDEEFEDQAIPEIQRTNLGNVVLLLKSLGIEDILDFDYMDPPFEKSLLAAIEELYYLSAIDSKGG---LSLIGRKMVEIPCDPMISNMILKSEKYGCSEEIITIAAMLSLDNTIFYSPKNKKLYASQAHRAFMQEEGDHLTLLKVYNEYANNDYSSDWCKDNYIQSRSMKMARNIRDQLVNLADRLELKLISNSEDTVGICKAITAGFFLNTARFNGD-SYRRIKSKDSVYMQMNSVFRILDEHPRYVVFNNIVNTTKEYMRTCTRIEPRWLTDIAPHIYKD 2639
            Q QKL LPI+  +  LI  I   Q V+I GETGSGKTTQIPQYLYEA     + +I CTQPRRVAA+S+A RV++EM V+LG++VGY+VRFE   S +T+IKYMTDGMLLRE + D  +  YSV+I+DEAHERT+ TD+LFG++      RKD     LKI++ SAT +  +F ++F  A    I GR++PVE  Y  + + D++ AA++TI+Q+H  +   GDILVFLTGQ++IE     + +          +L+V P+++ALPS +Q ++F P  PGARKV+L+TNIAETS+TI G+++VID GY K K + P++ +D L+V P++KA A QR GRAGR   G C+RLY +  F E+  +  +PEIQR NL +V+L L +LGI DI  FD+MD P   ++  A+++L  L A+    G   L+ +G+KM + P +P ++ +IL SE  GCSEEI+T+ A+LS+D +I Y+P++K+ +A +  + F+  EGD +TLL +Y  Y     +  WC +++I +R MK+  +IR QL  +  RLE+KL S  +D+  + + +  G F+N+A    D +Y+ +  +++V +  +S   +    P YVV+N +V+T+K YMR  + +   WL + AP  +++
Sbjct:   52 QRQKLSLPIFSARKSLITEIRNRQNVIIVGETGSGKTTQIPQYLYEAKV-ARNSVIACTQPRRVAAISIAQRVSREMGVQLGEEVGYTVRFEDVTSTKTRIKYMTDGMLLRESIGDSLLKRYSVIILDEAHERTIHTDVLFGIVKGAQISRKDKGMLPLKIVVMSATLEAHQFSEYFGSAEVLYIEGRQHPVELMYAVEPQVDYMHAALITIMQLHQEKPLGGDILVFLTGQDEIESLSKLVSDCSLHCPPDCPQLLVCPMFAALPSSQQMQVFRPAIPGARKVILSTNIAETSVTIPGVKYVIDTGYVKAKGFHPKTGLDMLRVQPVSKAQARQRLGRAGRECSGVCYRLYTEEQF-EQLAEATVPEIQRCNLSSVILQLMALGIADIASFDFMDKPSADAIDGALKQLVILEALQEINGDYKLTSLGQKMAQFPLEPRLAKVILASETLGCSEEILTVVALLSVD-SITYTPQSKRDHALKVRKKFLSSEGDQITLLNIYRAYKQCGMNKSWCAEHFINTRVMKLVMDIRKQLREICIRLEIKLQSCGKDSATLRQCLCRGLFMNSAELQLDGTYQTLNHRETVAIHPSS--SLFMSKPAYVVYNELVHTSKCYMRDVSVVSCDWLLEAAPGFFQE 684          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 vs. Ensembl Nematostella
Match: EDO32629 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUG0])

HSP 1 Score: 462.611 bits (1189), Expect = 1.089e-154
Identity = 238/467 (50.96%), Postives = 316/467 (67.67%), Query Frame = 3
Query: 1062 KYMTDGMLLREFLNDPTVGMYSVLIIDEAHERTLQTDILFGLLSAVTEVRKDLKIIISSATCDVEKFCQFFE-APFFKIPGRRYPVETFYTKDQEADFVEAAVVTILQIHITQS-DGDILVFLTGQEDIEEAMDSLQERIKALGTKIRELIVLPIYSALPSEKQAKIFLPTPP----GA--RKVVLATNIAETSLTIDGIRFVIDCGYCKVKCYDPRSRMDSLKVVPITKANAIQRSGRAGRIAPGKCFRLYKKYTFDEEFEDQAIPEIQRTNLGNVVLLLKSLGIEDILDFDYMDPPFEKSLLAAIEELYYLSAIDSKGGLSLIGRKMVEIPCDPMISNMILKSEKYGCSEEIITIAAMLSLDNTIFYSPKNKKLYASQAHRAFMQEEGDHLTLLKVYNEYANNDYSSDWCKDNYIQSRSMKMARNIRDQLVNLADRLELKLIS---NSED-TVGICKAITAGFFL 2426
            +YMTDGMLLRE + DP +  Y+V+++DEAHERTL TDIL GLL  V + R DLKIII SAT D  KF  +F+  P   IPGR +PVE FYT + E D++EAA+ T++QIH+ +   GDIL+FLTGQE+IEEA   +++ +  LG++I EL  +P+YS LP  +Q +IF   PP    GA  RK V+ATNIAETSLTIDG+ FVID G+ K K Y+PR R++SL V  I++A+A QR+GRAGR  PGKCFRLY +  F EE      PEI R+NLG VVL LK LGI+D++ FD+MDPP  ++L+ A+E L YL A+D  G L+ +G  M E P DP ++ M++ S ++ CS EI++I +MLS+   +F  P   K  A ++   F   +GDHLTLL VY+ Y  N   + WC DN+IQ RSMK A N+R QL  + DR  L+  S   NS D  + I KA+ +GFF+
Sbjct:    1 RYMTDGMLLREAMTDPLLDRYAVILLDEAHERTLATDILMGLLKEVAKQRDDLKIIIMSATLDAGKFQDYFDHCPLMTIPGRTHPVEIFYTPEPERDYLEAAIRTVIQIHMVEEVKGDILLFLTGQEEIEEACKRIKKEVDNLGSEIGELKCIPLYSTLPPTQQQRIFEAAPPDRPNGAIGRKCVVATNIAETSLTIDGVVFVIDPGFSKQKVYNPRIRVESLLVSAISRASAQQRAGRAGRTRPGKCFRLYTEKAFQEEMPPNTYPEILRSNLGTVVLQLKKLGIDDLVHFDFMDPPAPETLMRALELLNYLGALDDNGDLTELGSMMAEFPLDPQLAKMVIASCEFNCSNEILSITSMLSVPQ-VFLRPNEAKKAADESKMKFAHIDGDHLTLLNVYHAYKQNHEDTQWCYDNFIQHRSMKSADNVRGQLARIMDRFNLQRRSTDFNSRDYYLNIRKALVSGFFM 466          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 vs. Ensembl Nematostella
Match: EDO45861 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRP1])

HSP 1 Score: 453.366 bits (1165), Expect = 3.007e-149
Identity = 252/578 (43.60%), Postives = 370/578 (64.01%), Query Frame = 3
Query:  750 LAISQVQKLLPIYRLKNELIKMIAENQIVVIEGETGSGKTTQIPQYLYEAGYCVEDKIIGCTQPXXXXXXXXXXXXXQEMNVKLGDKVGYSVRFEAKVSEQ-TQIKYMTDGMLLREFLNDPTVGMYSVLIIDEAHERTLQTDILFGLLSAVTEVRKDLKIIISSATCDVEKFCQFFE-----------APFFKIPGRRYPVETFYTKDQEADFVEAAVVTILQIHITQSDGDILVFLTGQEDIEEAMDSLQERIKALGTKIRELIVLPIYSALPSEKQAKIFLPTPPGARKVVLATNIAETSLTIDGIRFVIDCGYCKVKCYDPRSRMDSLKVVPITKANAIQRSGRAGRIAPGKCFRLYKKYTFDEEFEDQAIPEIQRTNLGNVVLLLKSLGIEDILDFDYMDPPFEKSLLAAIEELYYLSAIDSKGGL-SLIGRKMVEIPCDPMISNMILKSEKYGCSEEIITIAAMLSLDNTIFYSPKNKKLYASQAHRAFMQEEGDHLTLLKVYNEYANNDYSSDWCKDNYIQSRSMKMARNIRDQLVNLADRLELKLISNSEDTVGICKAITAGFFLNTARFN 2444
            L+I   ++ LPI++ +  ++ ++ + + V+I GETG GK+TQ+ +YL E+G+  + K IG TQPRRVAA++VA RVA+E +   G +VGY VRF      + T IK+MTDG+LLRE + DP +  YSV++IDEAHERTL TD+L GLL  + + R DL+II+SSAT D E F  FF            A    + GR YPV   Y     A+++++AV T + IH+ +  GDILVFLTGQE++E A+  L ER + +      L VLP+YS LP E+Q  +F   PP  RKV++ATN+AE S+TIDGI +V+DCG+ K++ Y P + ++SL V  I++A+A QR+GRAGR+  GK +RLY +     E +   +PE+QR  +G   +LLKS+GI+++L FD+   P  +S++  +E LY L A+D  G L   +G +M E P +PMI+ M+L S ++ CSEEI+TIAAML + N +F +P ++K  +  A R F   EGDHLT L V+  +  +  SS WC DN++  + +  +  IR+QL  L    ++ ++S   D   +C+ I AGFF N AR++
Sbjct:   30 LSIDIQRQRLPIFKHRTNILYLLEKYETVIIVGETGCGKSTQV-KYLLESGWTADGKKIGITQPRRVAAITVAIRVAEERDTFAGQEVGYCVRFNDCFDPKLTSIKFMTDGILLREVMGDPLLSSYSVIMIDEAHERTLHTDVLLGLLKKIKKKRPDLRIIVSSATLDAEMFKDFFNTNITNDKSKDTAAVLSVEGRSYPVNIEYAISPVANYLQSAVETAMGIHLEEGPGDILVFLTGQEEVESAVSKLIERARGMPKGSSYLKVLPMYSGLPYEEQMLVFKRPPPNTRKVIVATNVAEASITIDGIVYVVDCGFVKLRAYSPATGIESLVVTEISQASAEQRAGRAGRVRAGKAYRLYTEDAL-HELKPVTVPEMQRYFIG---ILLKSMGIDNVLRFDFPARPPAQSMVRGLELLYALDALDDNGKLVDPLGVQMAEFPLEPMIAKMLLISGEFKCSEEILTIAAMLQIKN-VFVTPSSQKAASEHARRKFSVYEGDHLTQLNVHRAFLKHKKSSRWCHDNFVNYKGLMHSVKIREQLKKLLQHFKIPIVSCDGDVDQVCRCIVAGFFSNAARYH 601          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 vs. Ensembl Nematostella
Match: EDO35622 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKZ8])

HSP 1 Score: 380.178 bits (975), Expect = 2.842e-118
Identity = 196/342 (57.31%), Postives = 258/342 (75.44%), Query Frame = 3
Query:  753 AISQVQKLLPIYRLKNELIKMIAENQIVVIEGETGSGKTTQIPQYLYEAGYCVEDKIIGCTQPXXXXXXXXXXXXXQEMNVKLGDKVGYSVRFEAKVSEQTQIKYMTDGMLLREFLNDPTVGMYSVLIIDEAHERTLQTDILFGLLSAVTEVRKDLKIIISSATCDVEKFCQFF-EAPFFKIPGRRYPVETFYTKDQEADFVEAAVVTILQIHITQSDGDILVFLTGQEDIEEAMDSLQERIKALGTKIRELIVLPIYSALPSEKQAKIFLPTPPGARKVVLATNIAETSLTIDGIRFVIDCGYCKVKCYDPRSRMDSLKVVPITKANAIQRSGRAGRIAPG 1775
            ++ Q ++ LPI+ ++ EL+ ++ +NQ+V+I GETGSGKTTQ+ QY++E GY     +IGCTQPRRVAAMSVA RV++EM+  LG++VGY++RFE   S++T IKYMTDG+LLRE L +  +  YSV+I+DEAHER+L TD+LFGLL  V   R+DLK+I++SAT D +KF  FF   P +KIPGR +PVE F+T+    D+V++AV   LQIH+T S GDILVF+ GQEDIE   + + ER+  +  +   L VLPIYS LPS+ QAKIF   P G RK V+ATNIAETSLT+DGI FVID GYCK+K Y+P+  MD+L+V PI++ANA QRSGRAGR  PG
Sbjct:  519 SLVQQRQYLPIFAVRQELLSIVRDNQVVIIVGETGSGKTTQLTQYMHEDGY-TNYGMIGCTQPRRVAAMSVAKRVSEEMDCSLGEEVGYAIRFEDVTSDKTMIKYMTDGILLRESLRESDLDHYSVIIMDEAHERSLNTDVLFGLLRDVVSRRRDLKLIVTSATMDAQKFADFFGNVPTYKIPGRTFPVEIFFTRTVMEDYVDSAVKQALQIHLTPSKGDILVFMPGQEDIEVTCELISERLAEV-EEAPPLAVLPIYSQLPSDLQAKIFQKAPDGVRKCVVATNIAETSLTVDGIMFVIDAGYCKLKVYNPKIGMDALQVYPISQANANQRSGRAGRTGPG 858          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 vs. Ensembl Medaka
Match: dhx16 (DEAH-box helicase 16 [Source:NCBI gene;Acc:101168894])

HSP 1 Score: 805.438 bits (2079), Expect = 0.000e+0
Identity = 425/872 (48.74%), Postives = 604/872 (69.27%), Query Frame = 3
Query:  156 YSQRISEKEKSKNKNYVSGQTNEKKFRSQAMKYR----DNETVTENIRIKSRQEYLLKRKADKIEDLHYDLIEDELYFKKEELTNRELKEKEAKKMIYKVAKMQEKSVKKVNE----KYYT--------IPSNDSTIVMNVTEERKKSRKGGLNEWETLQLKNAI---------DQGKVSRRQDDEYELLVDEFVDYEQEETLIP----QNPEELTEKVIEKIDEKDLAISQVQKLLPIYRLKNELIKMIAENQIVVIEGETGSGKTTQIPQYLYEAGYCVEDKIIGCTQPXXXXXXXXXXXXXQEMNVKLGDKVGYSVRFEAKVSEQTQIKYMTDGMLLREFLNDPTVGMYSVLIIDEAHERTLQTDILFGLLSAVTEVRKDLKIIISSATCDVEKFCQFFE-APFFKIPGRRYPVETFYTKDQEADFVEAAVVTILQIHITQSDGDILVFLTGQEDIEEAMDSLQERIKALGTKIRELIVLPIYSALPSEKQAKIFLPTPPGARKVVLATNIAETSLTIDGIRFVIDCGYCKVKCYDPRSRMDSLKVVPITKANAIQRSGRAGRIAPGKCFRLYKKYTFDEEFEDQAIPEIQRTNLGNVVLLLKSLGIEDILDFDYMDPPFEKSLLAAIEELYYLSAIDSKGGLSLIGRKMVEIPCDPMISNMILKSEKYGCSEEIITIAAMLSLDNTIFYSPKNKKLYASQAHRAFMQEEGDHLTLLKVYNEYANNDYSSDWCKDNYIQSRSMKMARNIRDQLVNLADRLELKLISNSEDTVGICKAITAGFFLNTARFNGDSYRRIKSKDSVYMQMNSVFRILDEHPRYVVFNNIVNTTKEYMRTCTRIEPRWLTDIAPHIYKDIDFEGDSKYKRMPK 2681
            +++R+ +K+K K +N ++ +T++K +     + +    D   +   +R KSRQ YL KR+A+K+EDL  ++ ++E +F  +ELT RE ++ E K+++  +A+  +K+  K  E    +YY         +P  D  +     EE      G    WE  +LK A          +QG   R + + Y+L+++E    E   T I     ++ ++     + + + K  ++ +V++ LPI+  + +L+  I E+Q++VIEGETGSGKTTQIPQYL E GY      IGCTQPRRVAAMSVA+RVA+E+ VKLG++VGYS+RFE   SE+T +KYMTDGMLLREFL +P +  YSV++IDEAHERTL TDILFGL+  +   R DLK++++SAT D E+F  FF+ AP F+IPGRR+PV+ FYTK  EAD+++A VV++LQIH+TQ  GDILVFLTGQE+IE   + LQER + LG+KI EL+VLPIY+ LPS+ QAKIF PTPPGARKVV+ATNIAETSLTIDGI +VID G+CK K Y+ R+ M+SL V P ++A+A QR+GRAGR+A GKCFRLY  + F  E E+  +PEIQRTNLGNVVLLLKSLGI D++ FD+MDPP  ++L+ A+E+LY L A++  G L+ +GR+M E+P DPM+S MIL SE+Y CSEE++TIAAMLS++N+IFY PK+K ++A  A   F+   GDHL LL VY ++  + +S+ WC +N+IQ RSM+ AR++RDQL  L +R+E++++S   + V I KA+TAG+F +TAR +   Y+ +K + +VY   NS   + +E PR+++++ +V TTKE+MR    IE  WL ++APH YK  + E DS  K+MP+
Sbjct:  182 FAERVRQKDKDKTRN-ITERTDKKAYEEAQKRLKMAEDDKNNMLPELRKKSRQSYLKKREAEKLEDLEAEIKDEEYFFSLDELTERERRDLEHKRILRDLAQDYKKAGAKEQEERKNRYYMPEEKRRKDVPERDLEL-----EEIPMELGGEQGRWEEERLKTASLSFGAKKEREQG--MREEQERYQLILEEEEMIEFVTTAITMKGTRSEKDQEAHALSQAELKKQSMQEVRRSLPIFPYREDLLAAINEHQVLVIEGETGSGKTTQIPQYLMEEGYTNGGMKIGCTQPRRVAAMSVAARVAEEIGVKLGNEVGYSIRFEDCTSERTVLKYMTDGMLLREFLTEPDLASYSVILIDEAHERTLHTDILFGLIKDIARFRPDLKVLVASATLDTERFSSFFDDAPVFRIPGRRFPVDIFYTKAPEADYLDACVVSVLQIHVTQPPGDILVFLTGQEEIEACCELLQERCRRLGSKIAELLVLPIYANLPSDMQAKIFTPTPPGARKVVVATNIAETSLTIDGIIYVIDPGFCKQKSYNARTGMESLIVTPCSRASANQRAGRAGRVAAGKCFRLYTAWAFKHEMEETTVPEIQRTNLGNVVLLLKSLGINDLIHFDFMDPPPHETLVLALEQLYALGALNHLGELTKLGRRMAELPVDPMLSKMILASEQYKCSEEVLTIAAMLSVNNSIFYRPKDKVVHADNARMNFVVPGGDHLVLLNVYTQWVESGFSTQWCYENFIQFRSMRRARDVRDQLEGLMERIEVEVVSCQGENVPIRKAVTAGYFYHTARLSKGGYKTVKHQQTVYTHPNS--SLFEEQPRWLIYHELVFTTKEFMRQVIEIESAWLLEVAPHYYKSKELE-DSSNKKMPR 1042          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 vs. Ensembl Medaka
Match: dhx8 (DEAH-box helicase 8 [Source:NCBI gene;Acc:101162325])

HSP 1 Score: 677.167 bits (1746), Expect = 0.000e+0
Identity = 337/647 (52.09%), Postives = 470/647 (72.64%), Query Frame = 3
Query:  750 LAISQVQKLLPIYRLKNELIKMIAENQIVVIEGETGSGKTTQIPQYLYEAGYCVEDKIIGCTQPXXXXXXXXXXXXXQEMNVKLGDKVGYSVRFEAKVSEQTQIKYMTDGMLLREFLNDPTVGMYSVLIIDEAHERTLQTDILFGLLSAVTEVRKDLKIIISSATCDVEKFCQFF-EAPFFKIPGRRYPVETFYTKDQEADFVEAAVVTILQIHITQSDGDILVFLTGQEDIEEAMDSLQERIKALGTKIRELIVLPIYSALPSEKQAKIFLPTPPGARKVVLATNIAETSLTIDGIRFVIDCGYCKVKCYDPRSRMDSLKVVPITKANAIQRSGRAGRIAPGKCFRLYKKYTFDEEFEDQAIPEIQRTNLGNVVLLLKSLGIEDILDFDYMDPPFEKSLLAAIEELYYLSAIDSKGGLSLIGRKMVEIPCDPMISNMILKSEKYGCSEEIITIAAMLSLDNTIFYSPKNKKLYASQAHRAFMQEEGDHLTLLKVYNEYANNDYSSDWCKDNYIQSRSMKMARNIRDQLVNLADRLELKLISNSEDTVGICKAITAGFFLNTARFNG-DSYRRIKSKDSVYMQMNSVFRILDEHPRYVVFNNIVNTTKEYMRTCTRIEPRWLTDIAPHIYKDIDFEGDSKYKRMPKL 2684
            L+I + ++ LPIY+LK +L++ + +NQI+++ GETGSGKTTQI QYL EAGY    KI GCTQPRRVAAMSVA RV++E    LG +VGY++RFE   S +T IKYMTDGMLLRE L D  +G Y+++++DEAHERT+ TD+LFGLL    + R D+K+I++SAT D  KF Q+F EAP F IPGR YPVE  YTK+ E D+++A+++T++QIH+T+  GDILVFLTGQE+I+ A + L ER+K+LG  + ELI+LP+YSALPSE Q +IF P PPG+RKVV+ATNIAETSLTIDGI +V+D G+ K K Y+ ++ +D L V PI++A A QR+GRAGR  PGKC+RLY +  + +E     +PEIQRTNL + VL LK++GI D+L FD+MD P  ++L+ A+E+LY L A+D +G L+ +GR+M E P +PM+  M++ S   GCSEE++TI +MLS+ N +FY PK+K+  A Q    F Q EGDHLTLL VYN + NN +S+ WC +N+IQ+RS++ A++IR Q++ + DR +L ++S  + TV + KAI +GFF N A+ +  + YR +  +  VY+  +S   + +  P +VV++ +V TTKEYMR  T I+PRWL + AP  +K  D    SK K+  +L
Sbjct:  552 LSILEQRESLPIYKLKEQLVQAVHDNQILIVIGETGSGKTTQITQYLAEAGYTARGKI-GCTQPRRVAAMSVAKRVSEEYGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDSELGQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRTDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEVLYTKEPETDYLDASLITVMQIHLTEPPGDILVFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQN-VFYRPKDKQALADQKKAKFHQPEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKATVRVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSA--LFNRQPEWVVYHELVLTTKEYMREVTTIDPRWLVEFAPAFFKVSDPTRLSKQKKQQRL 1194          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 vs. Ensembl Medaka
Match: dhx16 (DEAH-box helicase 16 [Source:NCBI gene;Acc:101168894])

HSP 1 Score: 606.29 bits (1562), Expect = 0.000e+0
Identity = 283/510 (55.49%), Postives = 385/510 (75.49%), Query Frame = 3
Query: 1155 RTLQTDILFGLLSAVTEVRKDLKIIISSATCDVEKFCQFFE-APFFKIPGRRYPVETFYTKDQEADFVEAAVVTILQIHITQSDGDILVFLTGQEDIEEAMDSLQERIKALGTKIRELIVLPIYSALPSEKQAKIFLPTPPGARKVVLATNIAETSLTIDGIRFVIDCGYCKVKCYDPRSRMDSLKVVPITKANAIQRSGRAGRIAPGKCFRLYKKYTFDEEFEDQAIPEIQRTNLGNVVLLLKSLGIEDILDFDYMDPPFEKSLLAAIEELYYLSAIDSKGGLSLIGRKMVEIPCDPMISNMILKSEKYGCSEEIITIAAMLSLDNTIFYSPKNKKLYASQAHRAFMQEEGDHLTLLKVYNEYANNDYSSDWCKDNYIQSRSMKMARNIRDQLVNLADRLELKLISNSEDTVGICKAITAGFFLNTARFNGDSYRRIKSKDSVYMQMNSVFRILDEHPRYVVFNNIVNTTKEYMRTCTRIEPRWLTDIAPHIYKDIDFEGDSKYKRMPK 2681
            RTL TDILFGL+  +   R DLK++++SAT D E+F  FF+ AP F+IPGRR+PV+ FYTK  EAD+++A VV++LQIH+TQ  GDILVFLTGQE+IE   + LQER + LG+KI EL+VLPIY+ LPS+ QAKIF PTPPGARKVV+ATNIAETSLTIDGI +VID G+CK K Y+ R+ M+SL V P ++A+A QR+GRAGR+A GKCFRLY  + F  E E+  +PEIQRTNLGNVVLLLKSLGI D++ FD+MDPP  ++L+ A+E+LY L A++  G L+ +GR+M E+P DPM+S MIL SE+Y CSEE++TIAAMLS++N+IFY PK+K ++A  A   F+   GDHL LL VY ++  + +S+ WC +N+IQ RSM+ AR++RDQL  L +R+E++++S   + V I KA+TAG+F +TAR +   Y+ +K + +VY   NS   + +E PR+++++ +V TTKE+MR    IE  WL ++APH YK  + E DS  K+MP+
Sbjct:    6 RTLHTDILFGLIKDIARFRPDLKVLVASATLDTERFSSFFDDAPVFRIPGRRFPVDIFYTKAPEADYLDACVVSVLQIHVTQPPGDILVFLTGQEEIEACCELLQERCRRLGSKIAELLVLPIYANLPSDMQAKIFTPTPPGARKVVVATNIAETSLTIDGIIYVIDPGFCKQKSYNARTGMESLIVTPCSRASANQRAGRAGRVAAGKCFRLYTAWAFKHEMEETTVPEIQRTNLGNVVLLLKSLGINDLIHFDFMDPPPHETLVLALEQLYALGALNHLGELTKLGRRMAELPVDPMLSKMILASEQYKCSEEVLTIAAMLSVNNSIFYRPKDKVVHADNARMNFVVPGGDHLVLLNVYTQWVESGFSTQWCYENFIQFRSMRRARDVRDQLEGLMERIEVEVVSCQGENVPIRKAVTAGYFYHTARLSKGGYKTVKHQQTVYTHPNS--SLFEEQPRWLIYHELVFTTKEFMRQVIEIESAWLLEVAPHYYKSKELE-DSSNKKMPR 512          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 vs. Ensembl Medaka
Match: dhx38 (DEAH-box helicase 38 [Source:NCBI gene;Acc:101155586])

HSP 1 Score: 600.512 bits (1547), Expect = 0.000e+0
Identity = 304/624 (48.72%), Postives = 422/624 (67.63%), Query Frame = 3
Query:  768 QKLLPIYRLKNELIKMIAENQIVVIEGETGSGKTTQIPQYLYEAGYCVEDKIIGCTQPXXXXXXXXXXXXXQEMNVKLGDKVGYSVRFEAKVSEQTQIKYMTDGMLLREFLNDPTVGMYSVLIIDEAHERTLQTDILFGLLSAVTEVRKDLKIIISSATCDVEKFCQFF-EAPFFKIPGRRYPVETFYTKDQEADFVEAAVVTILQIHITQSDGDILVFLTGQEDIEEAMDSLQERIKALGTKIRELIVLPIYSALPSEKQAKIFLPTPPGARKVVLATNIAETSLTIDGIRFVIDCGYCKVKCYDPRSRMDSLKVVPITKANAIQRSGRAGRIAPGKCFRLYKKYTFDEEFEDQAIPEIQRTNLGNVVLLLKSLGIEDILDFDYMDPPFEKSLLAAIEELYYLSAIDSKGGLSLIGRKMVEIPCDPMISNMILKSEKYGCSEEIITIAAMLSLDNTIFYSPKNKKLYASQAHRAFMQEEGDHLTLLKVYNEYANNDYSSDWCKDNYIQSRSMKMARNIRDQLVNLADRLELKLISNSEDTVGICKAITAGFFLNTARFNG-DSYRRIKSKDSVYMQMNSVFRILDEHPRYVVFNNIVNTTKEYMRTCTRIEPRWLTDIAPHIY 2633
            ++ LPI+ ++ +L+ +I +N IV++ GETGSGKTTQ+ QYL+E GY     ++GCTQPRRVAAMSVA RV++E+   LG++VGY++RFE   SE T IKYMTDG+LLRE L +  +  YS +I+DEAHER+L TD+LFGLL  V   R DLK+I++SAT D +KF  FF   P F IPGR +PV+  ++K  + D+VEAAV   LQIH++   GDIL+F+ GQEDIE   D + ER+  L      L VLPIYS LPS+ QAKIF   P G RK ++ATNIAETSLT+DGI FV+D GYCK+K ++PR  MD+L+V PI++ANA QRSGRAGR  PG+C+RLY +  +  E     IPEIQRTNL NVVLLLKSLG++D+L F +MDPP E ++L ++ +L+ L A+D+ G L+  GR MVE P DP +S M++ S   GCS +I+ I +MLS+   IFY PK ++  + Q    F   E DHLT L VYN++ NN+YSS WC D++I +++M+  R +R QL ++  + ++ L+S   D   I K I A +F   A+  G   Y  +++    ++   S    +   P Y++++ +V TTKEYM+  T ++  WL ++ P  Y
Sbjct:  558 RQYLPIFAVRQQLLNIIRDNSIVIVVGETGSGKTTQLTQYLHEDGY-TRYGMVGCTQPRRVAAMSVAKRVSEEIGSNLGEEVGYAIRFEDCTSESTMIKYMTDGILLRESLRESDLDHYSAVIMDEAHERSLNTDVLFGLLREVVSRRNDLKLIVTSATMDSDKFAAFFGNVPIFHIPGRTFPVDILFSKTPQEDYVEAAVKQALQIHLSGMVGDILIFMPGQEDIEVTSDQIVERLGELDNAP-PLAVLPIYSQLPSDLQAKIFQKAPDGVRKCIVATNIAETSLTVDGIMFVVDSGYCKLKVFNPRIGMDALQVYPISQANANQRSGRAGRTGPGQCYRLYTQSAYKNEMLTTTIPEIQRTNLANVVLLLKSLGVQDLLLFHFMDPPPEDNMLNSMYQLWILGALDNTGALTPTGRLMVEFPLDPALSKMLIVSCDMGCSADILIIVSMLSVP-AIFYRPKGREEESDQVREKFSVPESDHLTYLNVYNQWKNNNYSSIWCNDHFIHTKAMRKVREVRSQLKDIMVQQKMNLVSCGSDWDIIRKCICAAYFHQAAKLKGIGEYVNVRTGMPCHLHPTSSLFGMGYTPDYIIYHELVMTTKEYMQCVTAVDGEWLAELGPMFY 1178          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 vs. Ensembl Medaka
Match: zgc:158828 (DEAH-box helicase 35 [Source:NCBI gene;Acc:101161239])

HSP 1 Score: 573.933 bits (1478), Expect = 0.000e+0
Identity = 292/646 (45.20%), Postives = 436/646 (67.49%), Query Frame = 3
Query:  750 LAISQVQKLLPIYRLKNELIKMIAENQIVVIEGETGSGKTTQIPQYLYEAGYCVEDKIIGCTQPXXXXXXXXXXXXXQEMNVKLGDKVGYSVRFE-AKVSEQTQIKYMTDGMLLREFLNDPTVGMYSVLIIDEAHERTLQTDILFGLLSAVTEVRKDLKIIISSATCDVEKFCQFFE-----------APFFKIPGRRYPVETFYTKDQEADFVEAAVVTILQIHITQSDGDILVFLTGQEDIEEAMDSLQERIKAL---GTKIRELIVLPIYSALPSEKQAKIFLPTPPGARKVVLATNIAETSLTIDGIRFVIDCGYCKVKCYDPRSRMDSLKVVPITKANAIQRSGRAGRIAPGKCFRLYKKYTFDEEFEDQAIPEIQRTNLGNVVLLLKSLGIEDILDFDYMDPPFEKSLLAAIEELYYLSAIDSKGGLS-LIGRKMVEIPCDPMISNMILKSEKYGCSEEIITIAAMLSLDNTIFYSPKNKKLYASQAHRAFMQEEGDHLTLLKVYNEYANNDYSSDWCKDNYIQSRSMKMARNIRDQLVNLADRLELKLISNSEDTVGICKAITAGFFLNTARF-NGDSYRRIKSKDSVYMQMNSVFRILDEHPRYVVFNNIVNTTKEYMRTCTRIEPRWLTDIAPHIYK 2636
            L+I + ++ LP+++ +N ++ ++   Q V++ GETG GKTTQIPQYL EAG+  E K++G TQPRRVAA+SVA+RVA+E    LG +VGY++RF+       T+IK++TDGML+RE + DP +  YSVL++DEAHERTL TDI  GLL  + + R+DL++I++SAT D +KF +FF                 + GR +PV+ FYT     D+V+A V T+++IH T+ DGD+L FLTGQE++E+ +  LQ++ ++L   G K + L +LP+YS LP  +Q ++F   PP  RKVV+ATNIAETS+TI+GI FVIDC + K++ Y+PR+ ++SL V PI+KA+A QR+GRAGR  PGKCFRLY +  +D +     +PE+QRTNL  V+L LK+LGI+++L F ++ PP  ++++ A+E LY L  +D  G L+  +G +M E P  PM + M+L+S  +GCS+EI+TIAAM+ + N IF  P N+K  A++ HR F   EGDHLT+L VY  +  +  SS WC+++++  + +  A  +R+QL  L ++ ++   S+  D   I + I AGFF N AR  +  SYR ++    +++  NSV  + ++ P++VVFN +V T+K YMR  T +E  WL ++APH YK
Sbjct:   43 LSIERQRQKLPVFKHRNNILYLVESFQTVIVVGETGCGKTTQIPQYLVEAGWATEGKVVGVTQPRRVAAISVANRVAEERGALLGHEVGYTIRFDDCSDPHATRIKFLTDGMLVREMMADPLLTKYSVLMLDEAHERTLYTDIAIGLLKKIQKKRRDLRVIVASATLDAKKFHEFFNLNESGDPNKDTCGILTVEGRCFPVDIFYTVSPVPDYVKATVETVMKIHETEDDGDVLAFLTGQEEVEKVVSLLQDQARSLSRYGMK-KHLRILPMYSGLPYAEQMRVFERVPPTVRKVVVATNIAETSITINGIVFVIDCAFVKLRAYNPRTAIESLVVTPISKASASQRAGRAGRNRPGKCFRLYTEEDYD-KLPASTVPEMQRTNLAPVILQLKALGIDNVLRFSFLSPPPAQTMVQALELLYALGGLDHYGRLTDPMGVRMAEFPLSPMFAKMLLESGNFGCSKEIVTIAAMMQIQN-IFVVPPNQKKVAAREHRKFAVAEGDHLTMLNVYEAFMKHQKSSQWCQEHFLNYKGLLRAVTVREQLRRLMNKFKVPRTSSEGDPDVILRCIVAGFFANAARIHHSGSYRTLRDDRELHIHPNSVLYV-EKPPKWVVFNEVVQTSKYYMRDVTAVESSWLVELAPHFYK 684          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 vs. Planmine SMEST
Match: SMESG000030778.1 (SMESG000030778.1)

HSP 1 Score: 1754.57 bits (4543), Expect = 0.000e+0
Identity = 867/869 (99.77%), Postives = 869/869 (100.00%), Query Frame = 3
Query:   87 ARENNKKTSEDEEHLTEKQRIKEYSQRISEKEKSKNKNYVSGQTNEKKFRSQAMKYRDNETVTENIRIKSRQEYLLKRKADKIEDLHYDLIEDELYFKKEELTNRELKEKEAKKMIYKVAKMQEKSVKKVNEKYYTIPSNDSTIVMNVTEERKKSRKGGLNEWETLQLKNAIDQGKVSRRQDDEYELLVDEFVDYEQEETLIPQNPEELTEKVIEKIDEKDLAISQVQKLLPIYRLKNELIKMIAENQIVVIEGETGSGKTTQIPQYLYEAGYCVEDKIIGCTQPXXXXXXXXXXXXXQEMNVKLGDKVGYSVRFEAKVSEQTQIKYMTDGMLLREFLNDPTVGMYSVLIIDEAHERTLQTDILFGLLSAVTEVRKDLKIIISSATCDVEKFCQFFEAPFFKIPGRRYPVETFYTKDQEADFVEAAVVTILQIHITQSDGDILVFLTGQEDIEEAMDSLQERIKALGTKIRELIVLPIYSALPSEKQAKIFLPTPPGARKVVLATNIAETSLTIDGIRFVIDCGYCKVKCYDPRSRMDSLKVVPITKANAIQRSGRAGRIAPGKCFRLYKKYTFDEEFEDQAIPEIQRTNLGNVVLLLKSLGIEDILDFDYMDPPFEKSLLAAIEELYYLSAIDSKGGLSLIGRKMVEIPCDPMISNMILKSEKYGCSEEIITIAAMLSLDNTIFYSPKNKKLYASQAHRAFMQEEGDHLTLLKVYNEYANNDYSSDWCKDNYIQSRSMKMARNIRDQLVNLADRLELKLISNSEDTVGICKAITAGFFLNTARFNGDSYRRIKSKDSVYMQMNSVFRILDEHPRYVVFNNIVNTTKEYMRTCTRIEPRWLTDIAPHIYKDIDFEGDSKYKRMPKLAKK 2693
            +RENNKKTSEDEEHLTEKQRIKEYSQRISEKEKSKNKNYVSGQTNEKKFRSQAMKYRDNETVTENIRIKSRQEYLLKRKADKIEDLHYDLIEDELYFKKEELTNRELKEKEAKKMIYKVAKMQEKSVKKVNEKYYTIPSNDSTI+MNVTEERKKSRKGGLNEWETLQLKNAIDQGKVSRRQDDEYELLVDEFVDYEQEETLIPQNPEELTEKVIEKIDEKDLAISQVQKLLPIYRLKNELIKMIAENQIVVIEGETGSGKTTQIPQYLYEAGYCVEDKIIGCTQPRRVAAMSVASRVAQEMNVKLGDKVGYSVRFEAKVSEQTQIKYMTDGMLLREFLNDPTVGMYSVLIIDEAHERTLQTDILFGLLSAVTEVRKDLKIIISSATCDVEKFCQFFEAPFFKIPGRRYPVETFYTKDQEADFVEAAVVTILQIHITQSDGDILVFLTGQEDIEEAMDSLQERIKALGTKIRELIVLPIYSALPSEKQAKIFLPTPPGARKVVLATNIAETSLTIDGIRFVIDCGYCKVKCYDPRSRMDSLKVVPITKANAIQRSGRAGRIAPGKCFRLYKKYTFDEEFEDQAIPEIQRTNLGNVVLLLKSLGIEDILDFDYMDPPFEKSLLAAIEELYYLSAIDSKGGLSLIGRKMVEIPCDPMISNMILKSEKYGCSEEIITIAAMLSLDNTIFYSPKNKKLYASQAHRAFMQEEGDHLTLLKVYNEYANNDYSSDWCKDNYIQSRSMKMARNIRDQLVNLADRLELKLISNSEDTVGICKAITAGFFLNTARFNGDSYRRIKSKDSVYMQMNSVFRILDEHPRYVVFNNIVNTTKEYMRTCTRIEPRWLTDIAPHIYKDIDFEGDSKYKRMPKLAKK
Sbjct:    4 SRENNKKTSEDEEHLTEKQRIKEYSQRISEKEKSKNKNYVSGQTNEKKFRSQAMKYRDNETVTENIRIKSRQEYLLKRKADKIEDLHYDLIEDELYFKKEELTNRELKEKEAKKMIYKVAKMQEKSVKKVNEKYYTIPSNDSTIMMNVTEERKKSRKGGLNEWETLQLKNAIDQGKVSRRQDDEYELLVDEFVDYEQEETLIPQNPEELTEKVIEKIDEKDLAISQVQKLLPIYRLKNELIKMIAENQIVVIEGETGSGKTTQIPQYLYEAGYCVEDKIIGCTQPRRVAAMSVASRVAQEMNVKLGDKVGYSVRFEAKVSEQTQIKYMTDGMLLREFLNDPTVGMYSVLIIDEAHERTLQTDILFGLLSAVTEVRKDLKIIISSATCDVEKFCQFFEAPFFKIPGRRYPVETFYTKDQEADFVEAAVVTILQIHITQSDGDILVFLTGQEDIEEAMDSLQERIKALGTKIRELIVLPIYSALPSEKQAKIFLPTPPGARKVVLATNIAETSLTIDGIRFVIDCGYCKVKCYDPRSRMDSLKVVPITKANAIQRSGRAGRIAPGKCFRLYKKYTFDEEFEDQAIPEIQRTNLGNVVLLLKSLGIEDILDFDYMDPPFEKSLLAAIEELYYLSAIDSKGGLSLIGRKMVEIPCDPMISNMILKSEKYGCSEEIITIAAMLSLDNTIFYSPKNKKLYASQAHRAFMQEEGDHLTLLKVYNEYANNDYSSDWCKDNYIQSRSMKMARNIRDQLVNLADRLELKLISNSEDTVGICKAITAGFFLNTARFNGDSYRRIKSKDSVYMQMNSVFRILDEHPRYVVFNNIVNTTKEYMRTCTRIEPRWLTDIAPHIYKDIDFEGDSKYKRMPKLAKK 872          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 vs. Planmine SMEST
Match: SMESG000030778.1 (SMESG000030778.1)

HSP 1 Score: 1649.8 bits (4271), Expect = 0.000e+0
Identity = 815/816 (99.88%), Postives = 816/816 (100.00%), Query Frame = 3
Query:  246 MKYRDNETVTENIRIKSRQEYLLKRKADKIEDLHYDLIEDELYFKKEELTNRELKEKEAKKMIYKVAKMQEKSVKKVNEKYYTIPSNDSTIVMNVTEERKKSRKGGLNEWETLQLKNAIDQGKVSRRQDDEYELLVDEFVDYEQEETLIPQNPEELTEKVIEKIDEKDLAISQVQKLLPIYRLKNELIKMIAENQIVVIEGETGSGKTTQIPQYLYEAGYCVEDKIIGCTQPXXXXXXXXXXXXXQEMNVKLGDKVGYSVRFEAKVSEQTQIKYMTDGMLLREFLNDPTVGMYSVLIIDEAHERTLQTDILFGLLSAVTEVRKDLKIIISSATCDVEKFCQFFEAPFFKIPGRRYPVETFYTKDQEADFVEAAVVTILQIHITQSDGDILVFLTGQEDIEEAMDSLQERIKALGTKIRELIVLPIYSALPSEKQAKIFLPTPPGARKVVLATNIAETSLTIDGIRFVIDCGYCKVKCYDPRSRMDSLKVVPITKANAIQRSGRAGRIAPGKCFRLYKKYTFDEEFEDQAIPEIQRTNLGNVVLLLKSLGIEDILDFDYMDPPFEKSLLAAIEELYYLSAIDSKGGLSLIGRKMVEIPCDPMISNMILKSEKYGCSEEIITIAAMLSLDNTIFYSPKNKKLYASQAHRAFMQEEGDHLTLLKVYNEYANNDYSSDWCKDNYIQSRSMKMARNIRDQLVNLADRLELKLISNSEDTVGICKAITAGFFLNTARFNGDSYRRIKSKDSVYMQMNSVFRILDEHPRYVVFNNIVNTTKEYMRTCTRIEPRWLTDIAPHIYKDIDFEGDSKYKRMPKLAKK 2693
            MKYRDNETVTENIRIKSRQEYLLKRKADKIEDLHYDLIEDELYFKKEELTNRELKEKEAKKMIYKVAKMQEKSVKKVNEKYYTIPSNDSTI+MNVTEERKKSRKGGLNEWETLQLKNAIDQGKVSRRQDDEYELLVDEFVDYEQEETLIPQNPEELTEKVIEKIDEKDLAISQVQKLLPIYRLKNELIKMIAENQIVVIEGETGSGKTTQIPQYLYEAGYCVEDKIIGCTQPRRVAAMSVASRVAQEMNVKLGDKVGYSVRFEAKVSEQTQIKYMTDGMLLREFLNDPTVGMYSVLIIDEAHERTLQTDILFGLLSAVTEVRKDLKIIISSATCDVEKFCQFFEAPFFKIPGRRYPVETFYTKDQEADFVEAAVVTILQIHITQSDGDILVFLTGQEDIEEAMDSLQERIKALGTKIRELIVLPIYSALPSEKQAKIFLPTPPGARKVVLATNIAETSLTIDGIRFVIDCGYCKVKCYDPRSRMDSLKVVPITKANAIQRSGRAGRIAPGKCFRLYKKYTFDEEFEDQAIPEIQRTNLGNVVLLLKSLGIEDILDFDYMDPPFEKSLLAAIEELYYLSAIDSKGGLSLIGRKMVEIPCDPMISNMILKSEKYGCSEEIITIAAMLSLDNTIFYSPKNKKLYASQAHRAFMQEEGDHLTLLKVYNEYANNDYSSDWCKDNYIQSRSMKMARNIRDQLVNLADRLELKLISNSEDTVGICKAITAGFFLNTARFNGDSYRRIKSKDSVYMQMNSVFRILDEHPRYVVFNNIVNTTKEYMRTCTRIEPRWLTDIAPHIYKDIDFEGDSKYKRMPKLAKK
Sbjct:    1 MKYRDNETVTENIRIKSRQEYLLKRKADKIEDLHYDLIEDELYFKKEELTNRELKEKEAKKMIYKVAKMQEKSVKKVNEKYYTIPSNDSTIMMNVTEERKKSRKGGLNEWETLQLKNAIDQGKVSRRQDDEYELLVDEFVDYEQEETLIPQNPEELTEKVIEKIDEKDLAISQVQKLLPIYRLKNELIKMIAENQIVVIEGETGSGKTTQIPQYLYEAGYCVEDKIIGCTQPRRVAAMSVASRVAQEMNVKLGDKVGYSVRFEAKVSEQTQIKYMTDGMLLREFLNDPTVGMYSVLIIDEAHERTLQTDILFGLLSAVTEVRKDLKIIISSATCDVEKFCQFFEAPFFKIPGRRYPVETFYTKDQEADFVEAAVVTILQIHITQSDGDILVFLTGQEDIEEAMDSLQERIKALGTKIRELIVLPIYSALPSEKQAKIFLPTPPGARKVVLATNIAETSLTIDGIRFVIDCGYCKVKCYDPRSRMDSLKVVPITKANAIQRSGRAGRIAPGKCFRLYKKYTFDEEFEDQAIPEIQRTNLGNVVLLLKSLGIEDILDFDYMDPPFEKSLLAAIEELYYLSAIDSKGGLSLIGRKMVEIPCDPMISNMILKSEKYGCSEEIITIAAMLSLDNTIFYSPKNKKLYASQAHRAFMQEEGDHLTLLKVYNEYANNDYSSDWCKDNYIQSRSMKMARNIRDQLVNLADRLELKLISNSEDTVGICKAITAGFFLNTARFNGDSYRRIKSKDSVYMQMNSVFRILDEHPRYVVFNNIVNTTKEYMRTCTRIEPRWLTDIAPHIYKDIDFEGDSKYKRMPKLAKK 816          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 vs. Planmine SMEST
Match: SMESG000006773.1 (SMESG000006773.1)

HSP 1 Score: 640.573 bits (1651), Expect = 0.000e+0
Identity = 320/633 (50.55%), Postives = 452/633 (71.41%), Query Frame = 3
Query:  753 AISQVQKLLPIYRLKNELIKMIAENQIVVIEGETGSGKTTQIPQYLYEAGYCVEDKIIGCTQPXXXXXXXXXXXXXQEMNVKLGDKVGYSVRFEAKVSEQTQIKYMTDGMLLREFLNDPTVGMYSVLIIDEAHERTLQTDILFGLLSAVTEVRKDLKIIISSATCDVEKFCQ-FFEAPFFKIPGRRYPVETFYTKDQEADFVEAAVVTILQIHITQSDGDILVFLTGQEDIEEAMDSLQERIKALGTKIRELIVLPIYSALPSEKQAKIFLPTPPGARKVVLATNIAETSLTIDGIRFVIDCGYCKVKCYDPRSRMDSLKVVPITKANAIQRSGRAGRIAPGKCFRLYKKYTFDEEFEDQAIPEIQRTNLGNVVLLLKSLGIEDILDFDYMDPPFEKSLLAAIEELYYLSAIDSKGGLSLIGRKMVEIPCDPMISNMILKSEKYGCSEEIITIAAMLSLDNTIFYSPKNKKLYASQAHRAFMQEEGDHLTLLKVYNEYANNDYSSDWCKDNYIQSRSMKMARNIRDQLVNLADRLELKLISNSEDTVGICKAITAGFFLNTARFNG-DSYRRIKSKDSVYMQMNSVFRILDEHPRYVVFNNIVNTTKEYMRTCTRIEPRWLTDIAPHIYKDID 2645
            +I + ++ LPI++LKNEL++ I +NQ++V+ GETGSGKTTQ+ QY+ EAG  +++K I CTQPRRVAA SVA RVAQE    LG +VGY++RFE   + +T+IKYMTDGMLLRE L DP +  YSV+++DEAHERT+ TD+LFGLL      R DLK+I++SAT +  KF + FF +P F+IPGR + VE  Y+ + + D++EA++ T++ IH+T+  GD+L+FLTGQE+I+   + +  RIKALG    EL++LP+YSA+PS+ Q++IF P PP ARK+V+ATNIAETSLTI+GI +VID G+ K K Y+ +S MD L V PI++A A QR GRAGR  PGKC+RLY +  F EE     +PEIQRTN+ + VL LK++GI D+L FD+MD P  ++L+ A+ EL+ LSA+D +G L+ +GRKM E P +PM++ M++ S   GCSEEI+TI +MLS++   FY PK+K   A Q    F Q EGDH+TLL V+N + N+ +S+ WC DN+IQ+RS+K A+++R QL+ + DR  LK+ S  ++T  I KAI +GFF N AR +  + YR +  +  V++  +S   +    P +V+F+ +V TTKEYMR  T I+ +WL + AP  +K  D
Sbjct:  459 SILEQRQSLPIFKLKNELLQAINDNQVLVVIGETGSGKTTQMTQYIAEAG-LIKNKKIACTQPRRVAAKSVAKRVAQEFGCLLGQEVGYTIRFEDMTTSETKIKYMTDGMLLRECLVDPELNQYSVIMLDEAHERTIHTDVLFGLLKKAATQRDDLKLIVTSATLNSVKFSEYFFGSPIFRIPGRTFEVEVLYSVEPQQDYLEASLNTVMHIHLTEPPGDMLLFLTGQEEIDTCCEIIYNRIKALGQDCPELLILPVYSAMPSDHQSRIFDPAPPNARKLVIATNIAETSLTINGIYYVIDPGFVKQKVYNSKSGMDQLIVTPISQAQADQRKGRAGRTGPGKCYRLYTERAFKEEMLPNNVPEIQRTNMASTVLALKAMGINDLLTFDFMDAPPSQTLVKAMSELHALSALDDEGLLTKLGRKMAEFPLEPMLAKMLIMSVHLGCSEEILTIVSMLSVE-PAFYRPKDKADAADQKKAKFNQPEGDHITLLAVFNAWKNSKFSTPWCYDNFIQARSLKHAQDVRKQLLGIMDRYSLKIRSCGKNTGLIQKAIVSGFFRNAARKDPQEGYRTLVDQQVVHIHPSSA--LFHRQPDWVIFHELVLTTKEYMREVTTIDSKWLVEFAPKFFKFSD 1087          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 vs. Planmine SMEST
Match: SMESG000065130.1 (SMESG000065130.1)

HSP 1 Score: 576.244 bits (1484), Expect = 0.000e+0
Identity = 308/641 (48.05%), Postives = 425/641 (66.30%), Query Frame = 3
Query:  777 LPIYRLKNELIKMIAENQIVVIEGETGSGKTTQIPQYLYEAGYCVED----KIIGCTQPXXXXXXXXXXXXXQEMNVKLGDKVGYSVRFEAKVSEQTQIKYMTDGMLLREFLNDPTVGMYSVLIIDEAHERTLQTDILFGLLSAVTEVRKDLKIIISSATCDVEKFCQFF-EAPFFKIPGRRYPVETFYTKDQEADFVEAAVVTILQIHITQ-SDGDILVFLTGQEDIEEAMDSLQERIKALGTKIRELIVLPIYSALPSEKQAKIFLPTPP----GA--RKVVLATNIAETSLTIDGIRFVIDCGYCKVKCYDPRSRMDSLKVVPITKANAIQRSGRAGRIAPGKCFRLYKKYTFDEEFEDQAIPEIQRTNLGNVVLLLKSLGIEDILDFDYMDPPFEKSLLAAIEELYYLSAIDSKGGLSLIGRKMVEIPCDPMISNMILKSEKYGCSEEIITIAAMLSLDNTIFYSPKNKKLYASQAHRAFMQEEGDHLTLLKVYNEYANNDYSSDWCKDNYIQSRSMKMARNIRDQLVNLADRLELKL----ISNSEDTVGICKAITAGFFLNTARF-NGDSYRRIKSKDSVYMQMNSVFRILDEHPRYVVFNNIVNTTKEYMRTCTRIEPRWLTDIAPHIYKDIDF 2648
            LP++  K+    ++ +NQ VV+ GETGSGKTTQIPQ+  E  +  E+    K +GCTQPRRVAAMSVA RVA+EM+V LG +VGYS+RFE   S +T +KY+TDGMLLRE ++D  +  Y V+++DEAHERTL TDIL GLL  V +VR DLKI+I SAT D  KF ++F  AP  K+PGR +PVE FYT + E D++EAA+ T++QIH+ + ++GDILVFLTGQE+I+EA   +Q  ++ LG  + EL  +P+YS LP   Q +IF P PP    GA  RKVV++TNIAETSLTIDG+ FVID G+ K K ++PR R++SL V PI+KA+A QR+GRAGR  PGKCFRLY +  ++ E  +   PEI R+NLG VVL LK LGI+D++ FD+MDPP  ++L+ A+E L YL+A+D  G L+ +G  M E P DP ++ M++ S  + CS EI++I AMLS+    F  P   +  A +A   F   +GDHLT+L VY+ +  N   S WC D+++  RS+K A N+R QL  + DR  L+      S+ +  V I KA+ +GFF+  A       Y  +K    V++  ++    LD  P +V++N  V TTK ++RT   ++P WL  +AP  Y   +F
Sbjct:   71 LPVWEYKDYFFDVLTKNQAVVLVGETGSGKTTQIPQWCLE--WVRENFSTRKEVGCTQPRRVAAMSVAQRVAEEMDVTLGQEVGYSIRFEDCTSNKTLMKYLTDGMLLREAMSDALLEKYGVILLDEAHERTLATDILMGLLKEVIKVRTDLKIVIMSATLDAGKFQEYFGNAPLMKVPGRTHPVEIFYTPEPEKDYLEAAIRTVIQIHMCEETEGDILVFLTGQEEIDEACKRIQREVENLGPDVGELKCIPLYSTLPPNLQQRIFEPPPPKKPNGAIGRKVVVSTNIAETSLTIDGVVFVIDPGFAKQKVFNPRIRVESLLVTPISKASAQQRAGRAGRTRPGKCFRLYTEKGYNNEMHENTYPEILRSNLGTVVLQLKKLGIDDLVHFDFMDPPAPETLMRALELLNYLAALDDDGNLTDLGGMMAEFPLDPQLAKMVIASCDFNCSNEILSITAMLSVPQC-FVRPTEARTAADEAKMGFAHIDGDHLTMLNVYHAFKQNREDSQWCYDHFVNYRSLKAADNVRIQLSRIMDRFNLRRSSTDFSSKDYYVNIRKALVSGFFMQVAHLERSGHYLTVKDNQIVHLHPSTC---LDHKPEWVLYNEFVLTTKNFIRTVCEVKPEWLVKVAPQYYDMSNF 705          
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 vs. Planmine SMEST
Match: SMESG000009126.1 (SMESG000009126.1)

HSP 1 Score: 574.318 bits (1479), Expect = 0.000e+0
Identity = 302/646 (46.75%), Postives = 425/646 (65.79%), Query Frame = 3
Query:  777 LPIYRLKNELIKMIAENQIVVIEGETGSGKTTQIPQYLYE--AGYCVEDKIIGCTQPXXXXXXXXXXXXXQEMNVKLGDKVGYSVRFEAKVSEQTQIKYMTDGMLLREFLNDPTVGMYSVLIIDEAHERTLQTDILFGLLSAVTEVRKDLKIIISSATCDVEKFCQFF-EAPFFKIPGRRYPVETFYTKDQEADFVEAAVVTILQIHITQSDGDILVFLTGQEDIEEAMDSLQERIKALGTKIRELIVLPIYSALPSEKQAKIFLPTPPG------ARKVVLATNIAETSLTIDGIRFVIDCGYCKVKCYDPRSRMDSLKVVPITKANAIQRSGRAGRIAPGKCFRLYKKYTFDEEFEDQAIPEIQRTNLGNVVLLLKSLGIEDILDFDYMDPPFEKSLLAAIEELYYLSAIDSKGGLSLIGRKMVEIPCDPMISNMILKSEKYGCSEEIITIAAMLSLDNTIFYSPKNKKLYASQAHRAFMQEEGDHLTLLKVYNEYANNDYSSDWCKDNYIQSRSMKMARNIRDQLVNLADRLELKLISN---SEDTVGICKAITAGFFLNTARFN-GDSYRRIKSKDSVYMQMNSVFRILDEHPRYVVFNNIVNTTKEYMRTCTRIEPRWLTDIAPHIYKDIDFEGDSKYKRM 2675
            LP++  K E ++++++NQI+V+ GETGSGKTTQIPQ+  E  +    E K +GCTQPRRVAAMSVA RVA E++V+LG++VGY +RFE   S  T +KY+TDGMLLRE ++DP +  Y V+++DEAHERTL TDIL GLL  ++E R DLK+I+ SAT D EKF  +F  AP  KIPGR +PVE F+T +   D+V+AAV  I  IH  + +GDIL+FLTGQE+I+EA   ++  I  LG ++ ++  +P+YS+LP   Q +IF   PP       +RK+V+ATNIAETS+TIDG+ FVID G+ K K ++PR+R++SL V  +++A+A QR+GRAGR  PGKCFRLY + ++  E  +   PEI R+NL NV+L LK LG+ DI+ FD++DPP   +++ A + LYYL AID  G L+ +GR M E P DP +S  ++ S  + CS++++ I +MLS+    F  P   +  A  A     + EGDHLTLL VYNE+ NN  S+ WC +N+I  RS+K A  +R QL  + D+ +LK ISN   S +   I K++ AGFF+ +A F+   SY  +K      +  ++    L   P +V++N  V TT  ++R  T I P WL + AP  Y   DF  D + KR+
Sbjct:   47 LPVWDYKEEFMQILSDNQIIVLVGETGSGKTTQIPQWCVEWVSDNSSEFKCVGCTQPRRVAAMSVAKRVADELDVELGEEVGYCIRFEDYTSPNTILKYLTDGMLLREAMSDPALKNYQVILLDEAHERTLGTDILMGLLKEISENRSDLKLIVMSATLDAEKFQNYFGNAPLMKIPGRTFPVEIFFTSEPVEDYVDAAVTVITLIHTLEDEGDILLFLTGQEEIDEACRRIEIEISNLGDQVGDVSCIPLYSSLPPNVQQRIFEEAPPNTADGKISRKIVVATNIAETSITIDGVAFVIDPGFAKEKVFNPRTRVESLTVTKVSRASAKQRAGRAGRTGPGKCFRLYSEASYHNELIENTYPEILRSNLSNVILSLKKLGVGDIIGFDFIDPPHPDNMMRAFDLLYYLGAIDCDGVLTDLGRMMAEFPLDPQLSKTLIASCDFNCSDDVLNIVSMLSVP-PCFVRPIESQGAADAAKMRLSKTEGDHLTLLNVYNEFINNKKSAKWCSNNFINYRSLKTANEVRLQLSRILDKFKLKQISNDATSSNYENIKKSLVAGFFMQSAHFDKKGSYLTVKDTQIARLHPSTA---LLRKPDWVIYNEFVMTTNNFLRIVTEINPSWLVNAAPEYYNPADFP-DGRAKRI 687          
The following BLAST results are available for this feature:
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DHX160.000e+048.03DEAH-box helicase 16 [Source:HGNC Symbol;Acc:HGNC:... [more]
DHX160.000e+048.03DEAH-box helicase 16 [Source:HGNC Symbol;Acc:HGNC:... [more]
DHX160.000e+048.03DEAH-box helicase 16 [Source:HGNC Symbol;Acc:HGNC:... [more]
DHX160.000e+048.03DEAH-box helicase 16 [Source:HGNC Symbol;Acc:HGNC:... [more]
DHX160.000e+048.03DEAH-box helicase 16 [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mog-40.000e+050.82Probable pre-mRNA-splicing factor ATP-dependent RN... [more]
mog-50.000e+051.70Probable pre-mRNA-splicing factor ATP-dependent RN... [more]
mog-10.000e+047.94Probable pre-mRNA-splicing factor ATP-dependent RN... [more]
mog-10.000e+047.94Probable pre-mRNA-splicing factor ATP-dependent RN... [more]
ddx-150.000e+046.82Pre-mRNA-splicing factor ATP-dependent RNA helicas... [more]
back to top
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
l(2)37Cb0.000e+049.20gene:FBgn0086444 transcript:FBtr0081163[more]
pea0.000e+050.77gene:FBgn0086895 transcript:FBtr0087518[more]
l(1)G00070.000e+044.04gene:FBgn0026713 transcript:FBtr0073900[more]
Dhx150.000e+049.13gene:FBgn0033160 transcript:FBtr0336909[more]
Dhx150.000e+049.13gene:FBgn0033160 transcript:FBtr0088966[more]
back to top
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dhx160.000e+049.54DEAH (Asp-Glu-Ala-His) box polypeptide 16 [Source:... [more]
dhx160.000e+049.54DEAH (Asp-Glu-Ala-His) box polypeptide 16 [Source:... [more]
dhx160.000e+049.54DEAH (Asp-Glu-Ala-His) box polypeptide 16 [Source:... [more]
AL833789.30.000e+052.40DEAH (Asp-Glu-Ala-His) box polypeptide 8 [Source:N... [more]
dhx80.000e+052.40DEAH (Asp-Glu-Ala-His) box polypeptide 8 [Source:Z... [more]
back to top
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dhx160.000e+048.78DEAH-box helicase 16 [Source:NCBI gene;Acc:1001271... [more]
dhx160.000e+048.78DEAH-box helicase 16 [Source:NCBI gene;Acc:1001271... [more]
dhx160.000e+056.45DEAH-box helicase 16 [Source:NCBI gene;Acc:1001271... [more]
dhx160.000e+054.17DEAH-box helicase 16 [Source:NCBI gene;Acc:1001271... [more]
rps15a0.000e+051.93ribosomal protein S15a [Source:Xenbase;Acc:XB-GENE... [more]
back to top
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dhx160.000e+048.36DEAH (Asp-Glu-Ala-His) box polypeptide 16 [Source:... [more]
Dhx80.000e+051.93DEAH (Asp-Glu-Ala-His) box polypeptide 8 [Source:M... [more]
Dhx80.000e+051.93DEAH (Asp-Glu-Ala-His) box polypeptide 8 [Source:M... [more]
Dhx380.000e+041.35DEAH (Asp-Glu-Ala-His) box polypeptide 38 [Source:... [more]
Dhx150.000e+047.91DEAH (Asp-Glu-Ala-His) box polypeptide 15 [Source:... [more]
back to top
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O45244|DHX16_CAEEL0.000e+050.82Probable pre-mRNA-splicing factor ATP-dependent RN... [more]
sp|Q767K6|DHX16_PIG0.000e+047.78Pre-mRNA-splicing factor ATP-dependent RNA helicas... [more]
sp|Q7YR39|DHX16_PANTR0.000e+048.03Pre-mRNA-splicing factor ATP-dependent RNA helicas... [more]
sp|O60231|DHX16_HUMAN0.000e+048.03Pre-mRNA-splicing factor ATP-dependent RNA helicas... [more]
sp|Q54MH3|DHX16_DICDI0.000e+048.05Putative pre-mRNA-splicing factor ATP-dependent RN... [more]
back to top
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2L8H60.000e+052.50Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A2H8TNP70.000e+052.00Putative pre-mRNA-splicing factor ATP-dependent RN... [more]
G7YS810.000e+052.38Pre-mRNA-splicing factor ATP-dependent RNA helicas... [more]
J9K2000.000e+052.00Uncharacterized protein OS=Acyrthosiphon pisum OX=... [more]
A0A0R3S8070.000e+051.99Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
back to top
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dhx160.000e+048.51DEAH-box helicase 16 [Source:NCBI gene;Acc:1030400... [more]
dhx160.000e+048.44DEAH-box helicase 16 [Source:NCBI gene;Acc:1030400... [more]
dhx160.000e+048.81DEAH-box helicase 16 [Source:NCBI gene;Acc:1030400... [more]
dhx80.000e+052.40DEAH-box helicase 8 [Source:NCBI gene;Acc:10303579... [more]
dhx80.000e+052.40DEAH-box helicase 8 [Source:NCBI gene;Acc:10303579... [more]
back to top
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dhx80.000e+051.00DEAH (Asp-Glu-Ala-His) box polypeptide 8 [Source:Z... [more]
zgc:1588281.375e-12736.29DEAH-box helicase 35 [Source:HGNC Symbol;Acc:HGNC:... [more]
dhx343.149e-9836.20DEAH (Asp-Glu-Ala-His) box polypeptide 34 [Source:... [more]
dhx331.672e-9341.77DEAH (Asp-Glu-Ala-His) box polypeptide 33 [Source:... [more]
dqx14.991e-8435.52DEAQ box RNA-dependent ATPase 1 [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
PRP220.000e+047.66DEAH-box RNA-dependent ATPase/ATP-dependent RNA he... [more]
PRP430.000e+047.35RNA helicase in the DEAH-box family; functions in ... [more]
PRP20.000e+042.94RNA-dependent DExD/H-box ATPase; required for acti... [more]
PRP165.284e-17647.82DEAH-box RNA helicase involved in second catalytic... [more]
DHR21.188e-12537.38Predominantly nucleolar DEAH-box ATP-dependent RNA... [more]
back to top
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO495601.309e-17850.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO325313.324e-17744.20Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO326291.089e-15450.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO458613.007e-14943.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO356222.842e-11857.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dhx160.000e+048.74DEAH-box helicase 16 [Source:NCBI gene;Acc:1011688... [more]
dhx80.000e+052.09DEAH-box helicase 8 [Source:NCBI gene;Acc:10116232... [more]
dhx160.000e+055.49DEAH-box helicase 16 [Source:NCBI gene;Acc:1011688... [more]
dhx380.000e+048.72DEAH-box helicase 38 [Source:NCBI gene;Acc:1011555... [more]
zgc:1588280.000e+045.20DEAH-box helicase 35 [Source:NCBI gene;Acc:1011612... [more]
back to top
BLAST of Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000030778.10.000e+099.77SMESG000030778.1[more]
SMESG000030778.10.000e+099.88SMESG000030778.1[more]
SMESG000006773.10.000e+050.55SMESG000006773.1[more]
SMESG000065130.10.000e+048.05SMESG000065130.1[more]
SMESG000009126.10.000e+046.75SMESG000009126.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011852 ID=SMED30011852|Name=Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16|organism=Schmidtea mediterranea sexual|type=transcript|length=2717bp
TATTAATTTTTAACGTCATTTTGTGAGAGTCGATGGGAGCCGTATAGATG
ATTCCACATGAGGCTCTAGATCTGCAGTTTGGCCATGCAAGAGAAAACAA
TAAAAAAACTTCAGAAGATGAAGAGCATTTGACTGAAAAGCAGCGAATAA
AAGAATACTCACAAAGGATTTCCGAGAAAGAGAAATCGAAAAACAAAAAC
TATGTTTCCGGTCAAACCAATGAAAAGAAATTCCGTTCCCAAGCGATGAA
ATATCGCGACAATGAAACTGTCACAGAAAACATTCGTATTAAATCTAGAC
AGGAATATTTATTAAAAAGAAAAGCTGATAAAATCGAGGATTTGCATTAC
GATCTAATTGAAGATGAATTATATTTCAAAAAAGAAGAGTTAACAAATCG
AGAATTAAAAGAGAAAGAAGCAAAGAAAATGATTTACAAAGTAGCCAAAA
TGCAAGAGAAGAGCGTCAAGAAAGTGAATGAAAAATATTACACGATTCCA
TCTAATGATTCGACAATAGTGATGAATGTCACGGAAGAGAGAAAAAAATC
GAGAAAAGGCGGATTAAATGAATGGGAAACTCTTCAGCTGAAAAATGCGA
TTGACCAGGGAAAAGTTTCCCGCAGACAAGATGATGAATATGAGCTGCTG
GTGGACGAGTTTGTCGATTACGAACAGGAAGAAACTCTAATTCCACAAAA
TCCAGAAGAGTTGACTGAAAAAGTAATCGAGAAAATCGATGAAAAAGATC
TGGCGATTTCCCAGGTGCAAAAACTGCTGCCGATTTACAGATTAAAGAAT
GAATTAATCAAAATGATCGCAGAAAATCAAATTGTCGTGATAGAAGGTGA
AACCGGTTCAGGGAAAACGACTCAAATCCCTCAGTATCTATACGAGGCGG
GCTATTGTGTGGAGGATAAAATCATCGGCTGTACCCAACCGAGACGAGTG
GCAGCGATGTCGGTAGCCAGTCGAGTTGCACAGGAAATGAATGTGAAACT
CGGTGACAAAGTCGGCTATTCAGTGAGATTTGAGGCGAAAGTATCCGAAC
AAACACAAATCAAGTACATGACCGATGGGATGCTACTGAGAGAGTTCCTC
AACGACCCAACTGTCGGCATGTATTCCGTGTTGATTATAGACGAAGCTCA
CGAGAGGACTTTGCAAACCGATATTCTTTTCGGGCTTCTTTCGGCCGTTA
CCGAAGTCAGGAAAGATCTGAAAATTATCATCAGTTCTGCCACATGTGAC
GTTGAGAAGTTCTGCCAGTTCTTCGAGGCGCCTTTCTTTAAAATCCCCGG
TAGAAGATATCCAGTTGAAACGTTCTACACAAAGGATCAAGAAGCTGACT
TTGTGGAGGCGGCCGTGGTGACAATCCTGCAGATACACATTACCCAATCC
GATGGAGATATCCTGGTGTTCCTCACCGGTCAGGAGGATATTGAGGAAGC
GATGGATAGTTTACAGGAGAGAATAAAGGCACTCGGAACGAAAATCCGAG
AACTGATAGTGCTACCGATTTATTCGGCATTACCCAGTGAAAAGCAAGCA
AAAATCTTCCTTCCGACTCCACCGGGCGCTAGGAAAGTCGTGTTAGCAAC
TAATATTGCTGAGACCTCGTTGACAATTGATGGAATACGATTTGTAATTG
ATTGTGGCTATTGCAAAGTGAAATGCTACGATCCAAGATCGAGAATGGAC
TCACTGAAAGTCGTTCCAATCACAAAAGCTAACGCTATTCAACGGTCGGG
AAGAGCCGGTAGAATCGCACCAGGGAAATGCTTTAGGCTCTATAAGAAAT
ACACTTTCGATGAGGAGTTTGAGGACCAAGCAATACCGGAAATCCAACGG
ACAAATCTGGGAAATGTCGTGTTGCTTTTGAAATCTCTGGGAATCGAAGA
CATTCTCGACTTTGACTATATGGATCCTCCGTTCGAGAAATCGCTTTTGG
CTGCAATCGAAGAGTTGTACTATTTAAGTGCAATCGATAGCAAAGGGGGA
CTTTCGTTAATCGGTAGGAAAATGGTGGAAATTCCCTGCGATCCGATGAT
ATCAAACATGATTCTGAAATCAGAAAAGTATGGCTGTTCCGAAGAGATTA
TCACAATTGCCGCAATGTTGAGTTTGGATAATACAATATTTTATTCGCCG
AAAAACAAGAAATTGTACGCGTCACAAGCACATCGGGCTTTCATGCAGGA
AGAAGGAGATCATTTGACTTTGCTTAAGGTCTACAATGAGTACGCCAATA
ATGATTACAGCAGTGATTGGTGCAAGGACAACTATATACAGTCGAGATCT
ATGAAGATGGCGAGAAATATCAGAGATCAACTTGTCAATTTGGCAGACAG
ATTGGAATTAAAACTCATTTCAAATTCAGAAGATACTGTCGGTATTTGTA
AAGCGATTACTGCGGGGTTCTTTCTGAACACTGCCAGATTCAATGGAGAC
AGTTATAGGAGAATAAAATCCAAGGATTCTGTGTACATGCAAATGAACTC
GGTATTTCGTATACTTGATGAGCATCCTCGCTACGTAGTGTTCAACAATA
TAGTCAATACAACAAAGGAATACATGCGAACTTGTACGAGAATCGAACCG
AGATGGCTAACTGATATCGCTCCTCATATTTATAAGGATATAGATTTTGA
AGGTGACAGTAAATACAAAAGAATGCCCAAATTGGCGAAAAAATAAATCT
TGTATATTTTTTGTTAA
back to top

protein sequence of SMED30011852-orf-1

>SMED30011852-orf-1 ID=SMED30011852-orf-1|Name=SMED30011852-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=883bp
MIPHEALDLQFGHARENNKKTSEDEEHLTEKQRIKEYSQRISEKEKSKNK
NYVSGQTNEKKFRSQAMKYRDNETVTENIRIKSRQEYLLKRKADKIEDLH
YDLIEDELYFKKEELTNRELKEKEAKKMIYKVAKMQEKSVKKVNEKYYTI
PSNDSTIVMNVTEERKKSRKGGLNEWETLQLKNAIDQGKVSRRQDDEYEL
LVDEFVDYEQEETLIPQNPEELTEKVIEKIDEKDLAISQVQKLLPIYRLK
NELIKMIAENQIVVIEGETGSGKTTQIPQYLYEAGYCVEDKIIGCTQPRR
VAAMSVASRVAQEMNVKLGDKVGYSVRFEAKVSEQTQIKYMTDGMLLREF
LNDPTVGMYSVLIIDEAHERTLQTDILFGLLSAVTEVRKDLKIIISSATC
DVEKFCQFFEAPFFKIPGRRYPVETFYTKDQEADFVEAAVVTILQIHITQ
SDGDILVFLTGQEDIEEAMDSLQERIKALGTKIRELIVLPIYSALPSEKQ
AKIFLPTPPGARKVVLATNIAETSLTIDGIRFVIDCGYCKVKCYDPRSRM
DSLKVVPITKANAIQRSGRAGRIAPGKCFRLYKKYTFDEEFEDQAIPEIQ
RTNLGNVVLLLKSLGIEDILDFDYMDPPFEKSLLAAIEELYYLSAIDSKG
GLSLIGRKMVEIPCDPMISNMILKSEKYGCSEEIITIAAMLSLDNTIFYS
PKNKKLYASQAHRAFMQEEGDHLTLLKVYNEYANNDYSSDWCKDNYIQSR
SMKMARNIRDQLVNLADRLELKLISNSEDTVGICKAITAGFFLNTARFNG
DSYRRIKSKDSVYMQMNSVFRILDEHPRYVVFNNIVNTTKEYMRTCTRIE
PRWLTDIAPHIYKDIDFEGDSKYKRMPKLAKK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR007502Helicase-assoc_dom
IPR001650Helicase_C
IPR014001Helicase_ATP-bd
IPR011709DUF1605
IPR027417P-loop_NTPase
IPR011545DEAD/DEAH_box_helicase_dom
IPR002464DNA/RNA_helicase_DEAH_CS
Vocabulary: molecular function
TermDefinition
GO:0004386helicase activity
GO:0005524ATP binding
GO:0003676nucleic acid binding
GO:0008026ATP-dependent helicase activity
GO:0000166nucleotide binding
GO:0016787hydrolase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 752..772
NoneNo IPR availableCOILSCoilCoilcoord: 462..489
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 199..419
e-value: 2.4E-82
score: 277.5
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 420..595
e-value: 4.5E-70
score: 236.8
NoneNo IPR availableGENE3DG3DSA:1.20.120.1080coord: 617..719
e-value: 5.5E-24
score: 86.0
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 9..50
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..58
NoneNo IPR availablePANTHERPTHR18934:SF208coord: 20..875
NoneNo IPR availablePANTHERPTHR18934ATP-DEPENDENT RNA HELICASEcoord: 20..875
NoneNo IPR availableCDDcd17974DEXHc_DHX16coord: 244..416
e-value: 8.13827E-89
score: 277.462
NoneNo IPR availableCDDcd18791SF2_C_RHAcoord: 421..582
e-value: 8.81573E-82
score: 258.617
IPR001650Helicase, C-terminalSMARTSM00490helicmild6coord: 474..574
e-value: 4.0E-18
score: 76.2
IPR001650Helicase, C-terminalPFAMPF00271Helicase_Ccoord: 444..573
e-value: 1.0E-13
score: 51.6
IPR001650Helicase, C-terminalPROSITEPS51194HELICASE_CTERcoord: 442..615
score: 16.783
IPR007502Helicase-associated domainSMARTSM00847ha2_5coord: 635..726
e-value: 1.3E-29
score: 114.4
IPR007502Helicase-associated domainPFAMPF04408HA2coord: 636..725
e-value: 5.8E-18
score: 65.2
IPR014001Helicase superfamily 1/2, ATP-binding domainSMARTSM00487ultradead3coord: 239..426
e-value: 3.3E-28
score: 109.7
IPR014001Helicase superfamily 1/2, ATP-binding domainPROSITEPS51192HELICASE_ATP_BIND_1coord: 254..418
score: 20.619
IPR011545DEAD/DEAH box helicase domainPFAMPF00270DEADcoord: 251..401
e-value: 3.6E-8
score: 33.4
IPR011709Domain of unknown function DUF1605PFAMPF07717OB_NTP_bindcoord: 783..861
e-value: 3.2E-13
score: 49.8
IPR002464DNA/RNA helicase, ATP-dependent, DEAH-box type, conserved sitePROSITEPS00690DEAH_ATP_HELICASEcoord: 360..369
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 246..765