3-hydroxy-3-methylglutaryl coenzyme A synthase

Overview
Name3-hydroxy-3-methylglutaryl coenzyme A synthase
Smed IDSMED30011849
Length (bp)1632
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of 3-hydroxy-3-methylglutaryl coenzyme A synthase (SMED30011849) t-SNE clustered cells

Violin plots show distribution of expression levels for 3-hydroxy-3-methylglutaryl coenzyme A synthase (SMED30011849) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of 3-hydroxy-3-methylglutaryl coenzyme A synthase (SMED30011849) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for 3-hydroxy-3-methylglutaryl coenzyme A synthase (SMED30011849) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011849

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermal cellSMED30011849SMESG000010026.1 dd_Smed_v4_2847_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30011849SMESG000010026.1 dd_Smed_v4_2847_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30011849SMESG000010026.1 dd_Smed_v4_2847_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30011849SMESG000010026.1 dd_Smed_v4_2847_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of 3-hydroxy-3-methylglutaryl coenzyme A synthase vs. Ensembl Human
Match: HMGCS2 (3-hydroxy-3-methylglutaryl-CoA synthase 2 [Source:HGNC Symbol;Acc:HGNC:5008])

HSP 1 Score: 391.734 bits (1005), Expect = 1.510e-130
Identity = 214/454 (47.14%), Postives = 297/454 (65.42%), Query Frame = 1
Query:   10 DIGIKAVEIYFPNTCIDQKDLEESDNC-LGKYTVGLGQIKMGVCSDLEDINSIALTVTKQLLENNFIDPNDIGFLSVGTETLIDKSKSTKTVLMELFEKHGNTDIQGVDEKNACFGGTASLFAALDWLESSNCDGRLXXXXXXXXXXXXXXXXRCTGGAGAVAMLLGPNAPLIFDKGIRSHHMSHQWDFYKPKLDSEYPVYDGQLSIISYQKSIDKCFQLYKKKCLNKGLINQSMILFREN--YYFCFHSPYTKLVEKSFARLVFND-IKDNPDIVEQFNEQLEDIKPFLHLNIENTYGNRDFDLSFLKFSDTLIKDKLRPGVLMAQNNGNMYTASLYGSLISVLIQTPIEELVGSRIVLFSYGSGLASCMFSLMITENKM---KLSEIKDSLNKIVDNLKNRIILSYKEFEDFLARRSSINCKCNVKPSTELSYLRSGTFYLSEIDEKYRRKY 1350
            D+GI A+E+YFP   +DQ DLE+ +N   GKYTVGLGQ +MG CS  EDINS+ LTV ++L+E   +  + +G L VGTET+IDKSK+ KTVLMELF+  GNTDI+G+D  NAC+GGTASLF A +W+ESS+ DGR A+VV  DIA+Y    AR TGGAGAVAML+GP APL  ++G+R  HM + +DFYKP L SEYP+ DG+LSI  Y +++D+C+  Y+KK  N+     S   F  +   Y  FH+P+ K+V+KS ARL+FND +  + D      + LE    F  L +E+TY N+D D + LK S  +   K +  + ++ +NGNMYT+SLYG L S+L     +EL GSRI  FSYGSGLA+  FS  ++++      L ++  S + +   L +R  +S +EF + + +R     K N  P  + + L  GT+YL  +DE++RRKY
Sbjct:   53 DVGILALEVYFPAQYVDQTDLEKYNNVEAGKYTVGLGQTRMGFCSVQEDINSLCLTVVQRLMERIQLPWDSVGRLEVGTETIIDKSKAVKTVLMELFQDSGNTDIEGIDTTNACYGGTASLFNAANWMESSSWDGRYAMVVCGDIAVYPSGNARPTGGAGAVAMLIGPKAPLALERGLRGTHMENVYDFYKPNLASEYPIVDGKLSIQCYLRALDRCYTSYRKKIQNQWKQAGSDRPFTLDDLQYMIFHTPFCKMVQKSLARLMFNDFLSASSDTQTSLYKGLE---AFGGLKLEDTYTNKDLDKALLKASQDMFDKKTKASLYLSTHNGNMYTSSLYGCLASLLSHHSAQELAGSRIGAFSYGSGLAASFFSFRVSQDAAPGSPLDKLVSSTSDLPKRLASRKCVSPEEFTEIMNQREQFYHKVNFSPPGDTNSLFPGTWYLERVDEQHRRKY 503          
BLAST of 3-hydroxy-3-methylglutaryl coenzyme A synthase vs. Ensembl Human
Match: HMGCS1 (3-hydroxy-3-methylglutaryl-CoA synthase 1 [Source:HGNC Symbol;Acc:HGNC:5007])

HSP 1 Score: 387.111 bits (993), Expect = 1.150e-128
Identity = 212/453 (46.80%), Postives = 299/453 (66.00%), Query Frame = 1
Query:   10 DIGIKAVEIYFPNTCIDQKDLEESDNC-LGKYTVGLGQIKMGVCSDLEDINSIALTVTKQLLENNFIDPNDIGFLSVGTETLIDKSKSTKTVLMELFEKHGNTDIQGVDEKNACFGGTASLFAALDWLESSNCDGRLXXXXXXXXXXXXXXXXRCTGGAGAVAMLLGPNAPLIFDKGIRSHHMSHQWDFYKPKLDSEYPVYDGQLSIISYQKSIDKCFQLYKKKCLNKGLI--NQSMILFRENYYFCFHSPYTKLVEKSFARLVFNDIKDNPDIVEQFNEQLEDIKPFLHLNIENTYGNRDFDLSFLKFSDTLIKDKLRPGVLMAQNNGNMYTASLYGSLISVLIQTPIEELVGSRIVLFSYGSGLASCMFSLMITENKM---KLSEIKDSLNKIVDNLKNRIILSYKEFEDFLARRSSINCKCNVKPSTELSYLRSGTFYLSEIDEKYRRKY 1350
            D+GI A+EIYFP+  +DQ +LE+ D    GKYT+GLGQ KMG C+D EDINS+ +TV + L+E N +  + IG L VGTET+IDKSKS KT LM+LFE+ GNTDI+G+D  NAC+GGTA++F A++W+ESS+ DGR A+VVA DIA+YA   AR TGG GAVA+L+GPNAPLIF++G+R  HM H +DFYKP + SEYP+ DG+LSI  Y  ++D+C+ +Y KK   +     N       +  +  FHSPY KLV+KS AR++ ND  ++ +     N     ++ F  + +E+TY +RD + +F+K S  L   K +  +L++  NGNMYT+S+YGSL SVL Q   ++L G RI +FSYGSGLA+ ++SL +T++      L +I  SL  +   L +R  ++   F + +  R   +   N  P   +  L  GT+YL  +DEK+RR Y
Sbjct:   16 DVGIVALEIYFPSQYVDQAELEKYDGVDAGKYTIGLGQAKMGFCTDREDINSLCMTVVQNLMERNNLSYDCIGRLEVGTETIIDKSKSVKTNLMQLFEESGNTDIEGIDTTNACYGGTAAVFNAVNWIESSSWDGRYALVVAGDIAVYATGNARPTGGVGAVALLIGPNAPLIFERGLRGTHMQHAYDFYKPDMLSEYPIVDGKLSIQCYLSALDRCYSVYCKKIHAQWQKEGNDKDFTLNDFGFMIFHSPYCKLVQKSLARMLLNDFLNDQN--RDKNSIYSGLEAFGDVKLEDTYFDRDVEKAFMKASSELFSQKTKASLLVSNQNGNMYTSSVYGSLASVLAQYSPQQLAGKRIGVFSYGSGLAATLYSLKVTQDATPGSALDKITASLCDLKSRLDSRTGVAPDVFAENMKLREDTHHLVNYIPQGSIDSLFEGTWYLVRVDEKHRRTY 466          
BLAST of 3-hydroxy-3-methylglutaryl coenzyme A synthase vs. Ensembl Human
Match: HMGCS1 (3-hydroxy-3-methylglutaryl-CoA synthase 1 [Source:HGNC Symbol;Acc:HGNC:5007])

HSP 1 Score: 387.111 bits (993), Expect = 1.150e-128
Identity = 212/453 (46.80%), Postives = 299/453 (66.00%), Query Frame = 1
Query:   10 DIGIKAVEIYFPNTCIDQKDLEESDNC-LGKYTVGLGQIKMGVCSDLEDINSIALTVTKQLLENNFIDPNDIGFLSVGTETLIDKSKSTKTVLMELFEKHGNTDIQGVDEKNACFGGTASLFAALDWLESSNCDGRLXXXXXXXXXXXXXXXXRCTGGAGAVAMLLGPNAPLIFDKGIRSHHMSHQWDFYKPKLDSEYPVYDGQLSIISYQKSIDKCFQLYKKKCLNKGLI--NQSMILFRENYYFCFHSPYTKLVEKSFARLVFNDIKDNPDIVEQFNEQLEDIKPFLHLNIENTYGNRDFDLSFLKFSDTLIKDKLRPGVLMAQNNGNMYTASLYGSLISVLIQTPIEELVGSRIVLFSYGSGLASCMFSLMITENKM---KLSEIKDSLNKIVDNLKNRIILSYKEFEDFLARRSSINCKCNVKPSTELSYLRSGTFYLSEIDEKYRRKY 1350
            D+GI A+EIYFP+  +DQ +LE+ D    GKYT+GLGQ KMG C+D EDINS+ +TV + L+E N +  + IG L VGTET+IDKSKS KT LM+LFE+ GNTDI+G+D  NAC+GGTA++F A++W+ESS+ DGR A+VVA DIA+YA   AR TGG GAVA+L+GPNAPLIF++G+R  HM H +DFYKP + SEYP+ DG+LSI  Y  ++D+C+ +Y KK   +     N       +  +  FHSPY KLV+KS AR++ ND  ++ +     N     ++ F  + +E+TY +RD + +F+K S  L   K +  +L++  NGNMYT+S+YGSL SVL Q   ++L G RI +FSYGSGLA+ ++SL +T++      L +I  SL  +   L +R  ++   F + +  R   +   N  P   +  L  GT+YL  +DEK+RR Y
Sbjct:   16 DVGIVALEIYFPSQYVDQAELEKYDGVDAGKYTIGLGQAKMGFCTDREDINSLCMTVVQNLMERNNLSYDCIGRLEVGTETIIDKSKSVKTNLMQLFEESGNTDIEGIDTTNACYGGTAAVFNAVNWIESSSWDGRYALVVAGDIAVYATGNARPTGGVGAVALLIGPNAPLIFERGLRGTHMQHAYDFYKPDMLSEYPIVDGKLSIQCYLSALDRCYSVYCKKIHAQWQKEGNDKDFTLNDFGFMIFHSPYCKLVQKSLARMLLNDFLNDQN--RDKNSIYSGLEAFGDVKLEDTYFDRDVEKAFMKASSELFSQKTKASLLVSNQNGNMYTSSVYGSLASVLAQYSPQQLAGKRIGVFSYGSGLAATLYSLKVTQDATPGSALDKITASLCDLKSRLDSRTGVAPDVFAENMKLREDTHHLVNYIPQGSIDSLFEGTWYLVRVDEKHRRTY 466          
BLAST of 3-hydroxy-3-methylglutaryl coenzyme A synthase vs. Ensembl Human
Match: HMGCS2 (3-hydroxy-3-methylglutaryl-CoA synthase 2 [Source:HGNC Symbol;Acc:HGNC:5008])

HSP 1 Score: 337.806 bits (865), Expect = 3.539e-110
Identity = 188/454 (41.41%), Postives = 266/454 (58.59%), Query Frame = 1
Query:   10 DIGIKAVEIYFPNTCIDQKDLEESDNC-LGKYTVGLGQIKMGVCSDLEDINSIALTVTKQLLENNFIDPNDIGFLSVGTETLIDKSKSTKTVLMELFEKHGNTDIQGVDEKNACFGGTASLFAALDWLESSNCDGRLXXXXXXXXXXXXXXXXRCTGGAGAVAMLLGPNAPLIFDKGIRSHHMSHQWDFYKPKLDSEYPVYDGQLSIISYQKSIDKCFQLYKKKCLNKGLINQSMILFREN--YYFCFHSPYTKLVEKSFARLVFND-IKDNPDIVEQFNEQLEDIKPFLHLNIENTYGNRDFDLSFLKFSDTLIKDKLRPGVLMAQNNGNMYTASLYGSLISVLIQTPIEELVGSRIVLFSYGSGLASCMFSLMITENKM---KLSEIKDSLNKIVDNLKNRIILSYKEFEDFLARRSSINCKCNVKPSTELSYLRSGTFYLSEIDEKYRRKY 1350
            D+GI A+E+YFP   +DQ DLE+ +N   GKYTVGLGQ +MG CS  EDINS+ LTV ++L+E   +  + +G L VGTET+IDKSK+ KTVLMELF+  GNTDI+G+D  NAC+GGTASLF A +W+ESS+ DG                                          +R  HM + +DFYKP L SEYP+ DG+LSI  Y +++D+C+  Y+KK  N+     S   F  +   Y  FH+P+ K+V+KS ARL+FND +  + D      + LE    F  L +E+TY N+D D + LK S  +   K +  + ++ +NGNMYT+SLYG L S+L     +EL GSRI  FSYGSGLA+  FS  ++++      L ++  S + +   L +R  +S +EF + + +R     K N  P  + + L  GT+YL  +DE++RRKY
Sbjct:   53 DVGILALEVYFPAQYVDQTDLEKYNNVEAGKYTVGLGQTRMGFCSVQEDINSLCLTVVQRLMERIQLPWDSVGRLEVGTETIIDKSKAVKTVLMELFQDSGNTDIEGIDTTNACYGGTASLFNAANWMESSSWDG------------------------------------------LRGTHMENVYDFYKPNLASEYPIVDGKLSIQCYLRALDRCYTSYRKKIQNQWKQAGSDRPFTLDDLQYMIFHTPFCKMVQKSLARLMFNDFLSASSDTQTSLYKGLE---AFGGLKLEDTYTNKDLDKALLKASQDMFDKKTKASLYLSTHNGNMYTSSLYGCLASLLSHHSAQELAGSRIGAFSYGSGLAASFFSFRVSQDAAPGSPLDKLVSSTSDLPKRLASRKCVSPEEFTEIMNQREQFYHKVNFSPPGDTNSLFPGTWYLERVDEQHRRKY 461          
BLAST of 3-hydroxy-3-methylglutaryl coenzyme A synthase vs. Ensembl Human
Match: HMGCS1 (3-hydroxy-3-methylglutaryl-CoA synthase 1 [Source:HGNC Symbol;Acc:HGNC:5007])

HSP 1 Score: 87.4261 bits (215), Expect = 2.437e-20
Identity = 44/80 (55.00%), Postives = 58/80 (72.50%), Query Frame = 1
Query:   10 DIGIKAVEIYFPNTCIDQKDLEESDNC-LGKYTVGLGQIKMGVCSDLEDINSIALTVTKQLLENNFIDPNDIGFLSVGTE 246
            D+GI A+EIYFP+  +DQ +LE+ D    GKYT+GLGQ KMG C+D EDINS+ +TV + L+E N +  + IG L VGTE
Sbjct:   16 DVGIVALEIYFPSQYVDQAELEKYDGVDAGKYTIGLGQAKMGFCTDREDINSLCMTVVQNLMERNNLSYDCIGRLEVGTE 95          
BLAST of 3-hydroxy-3-methylglutaryl coenzyme A synthase vs. Ensembl Celegans
Match: hmgs-1 (Hydroxymethylglutaryl-CoA synthase [Source:UniProtKB/Swiss-Prot;Acc:P54871])

HSP 1 Score: 267.314 bits (682), Expect = 2.073e-83
Identity = 179/455 (39.34%), Postives = 265/455 (58.24%), Query Frame = 1
Query:   10 DIGIKAVEIYFPNTCIDQKDLEESDNCL-GKYTVGLGQIKMGVCSDLEDINSIALTVTKQLLENNFIDPNDIGFLSVGTETLIDKSKSTKTVLMELFEKHGNTDIQGVDEKNACFGGTASLFAALDWLESSN-CDGRLXXXXXXXXXXXXXXXXRCTGGAGAVAMLLGPNAPLIFDKGIRSHHMSHQWDFYKP--KLDSEYPVYDGQLSIISYQKSIDKCFQLYKKKCLNKGLINQSMILFRENYYFCFHSPYTKLVEKSFARLVFNDIKDNPDIVEQFNEQLEDIKPFLHLNIENTYGNRDFDLSFLKFSDTLIKDKLRPGVLMAQNNGNMYTASLYGSLISVLIQTPIEELVGSR-IVLFSYGSGLASCMFSLMITENKMKLSEIKDSLNKIVDNLKNRIILSYKEFEDFLARRSSINCKCNVKPSTELSYLRSGTFYLSEIDEKYRRKYQIY 1359
            D+GI A+E+YFP   +DQ DLE+ +N   GKYT+GLGQ +MG CSD EDI SI+LTVT++L+E   I  + IG L VGTET+IDKSKS KT LM+LF   GN+DI+GVD KNACFGG  +L  A+DW+  ++  D + AIVV ADIAIY E  ARCTGGAGA+A L+ P+A +  D+   + HM + WDF+KP   + SEYPV DG LS+ SY +++   +  +  K +N+       +   +  +   HSP+TK+V+K  A + + D         Q   +  +     H   EN   +R      ++ S  + K+K  P ++  +  GNMYT SL+  L++ L     + + G + I+ F+YGSGLAS +F   + +    L +I+    + +  L +RI  + +EF + L +R        +  S   + L   T++L  +D+ YRR Y ++
Sbjct:   13 DVGIGAIELYFPQNFVDQNDLEKFNNVSSGKYTIGLGQQQMGFCSDNEDIVSISLTVTRKLIETYKISTDSIGCLVVGTETMIDKSKSVKTALMDLFP--GNSDIEGVDIKNACFGGAQALLHAIDWVTVNHPLDKKNAIVVVADIAIYEEGPARCTGGAGAIAFLICPDASIPIDRQFSACHMKNTWDFFKPITPIPSEYPVVDGSLSLSSYLEAVRMTYTYFISK-VNRHTTGIDGLNSFDGVF--LHSPFTKMVQKGLAVMNYTD--------SQLRHKQLNGNGVDHKLDEN---DRAGLAKMIELSAQVWKEKTDPYLVFNRRIGNMYTPSLFAQLLAYLAAD--DCVTGEKSILFFAYGSGLASAIFPGRVRQTS-NLDKIRQVAIRAIKRLDDRIQFTPEEFTETLQKREVFLRSKEIPKSPSETSLFPNTYFLDNMDKLYRRSYTLH 448          
BLAST of 3-hydroxy-3-methylglutaryl coenzyme A synthase vs. Ensembl Fly
Match: Hmgs (gene:FBgn0010611 transcript:FBtr0340059)

HSP 1 Score: 400.979 bits (1029), Expect = 3.551e-135
Identity = 216/460 (46.96%), Postives = 304/460 (66.09%), Query Frame = 1
Query:   10 DIGIKAVEIYFPNTCIDQKDLEESDNC-LGKYTVGLGQIKMGVCSDLEDINSIALTVTKQLLENNFIDPNDIGFLSVGTETLIDKSKSTKTVLMELFEKHGNTDIQGVDEKNACFGGTASLFAALDWLESSNCDGRLXXXXXXXXXXXXXXXXRCTGGAGAVAMLLGPNAPLIFDKGIRSHHMSHQWDFYKPKLDSEYPVYDGQLSIISYQKSIDKCFQLYKKKC--LNKGLINQSMILFRENYYFCFHSPYTKLVEKSFARLVFNDIKDNPDIVEQFNEQLEDIKPFLHLNIENTYGNRDFDLSFLKFSDTLIKDKLRPGVLMAQNNGNMYTASLYGSLISVLIQTPIEELVGSRIVLFSYGSGLASCMFSLMITENKMKLSEIKDSLNKIVDNLKNRIILSYKEFEDFLARRSSINCKCNVKPSTELSYLRSGTFYLSEIDEKYRRKYQIYNSEITNG 1380
            ++GI+A+EI FP+  +DQ +LE  D    GKYT+GLGQ KMG CSD ED+NS+ LTV  +LLE   +  ++IG L VGTET++DKSKS K+VLM+LF + GNTDI+G+D  NAC+GGTA+LF A++W+ESS+ DGRLA+ V ADIA+YA+ AAR TGGAGAVAML+GPNAPLI D+G+R+ HM H +DFYKP L SEYP  DG+LSI  Y  ++D C++LY+KK     K    Q   L   +    FH+P+ KLV+KS  RL FND   + +  E+  +Q  D++ F    +E+TY +RD + +F+  S  +   K +  +L+A   GNMYT S+Y  L+S+LI  P +ELVG RI LFSYGSGLA+ M+S+ +T++     +    L+ +   L +R  ++ ++F   +  R   N      P+  +S L  GT+YL ++D  +RR Y+     I+NG
Sbjct:    8 NVGIRAIEILFPSQYVDQTELETFDGASAGKYTIGLGQAKMGFCSDREDVNSLCLTVVSRLLERQHVKHSEIGRLEVGTETIVDKSKSVKSVLMQLFAESGNTDIEGIDTTNACYGGTAALFNAVNWVESSSWDGRLALAVCADIAVYAKGAARPTGGAGAVAMLVGPNAPLILDRGLRATHMEHAYDFYKPDLSSEYPTVDGKLSIQCYLSALDTCYRLYRKKFDQQQKDTSKQPASLSTFD-AILFHTPFCKLVQKSVGRLSFNDFLLSSE--EERTKQFPDLERFNTATLESTYFDRDVEKAFMTQSANIFASKTKKSLLLANQVGNMYTPSVYSGLVSLLISGPAQELVGKRIGLFSYGSGLAASMYSISVTQDAAAFEKFVSQLDYVQPLLNSREKVAPEQFSALMEVREKNNHAAPYTPTGSISALFPGTYYLKDVDALHRRTYE-RTPTISNG 463          
BLAST of 3-hydroxy-3-methylglutaryl coenzyme A synthase vs. Ensembl Fly
Match: Hmgs (gene:FBgn0010611 transcript:FBtr0087146)

HSP 1 Score: 400.979 bits (1029), Expect = 3.551e-135
Identity = 216/460 (46.96%), Postives = 304/460 (66.09%), Query Frame = 1
Query:   10 DIGIKAVEIYFPNTCIDQKDLEESDNC-LGKYTVGLGQIKMGVCSDLEDINSIALTVTKQLLENNFIDPNDIGFLSVGTETLIDKSKSTKTVLMELFEKHGNTDIQGVDEKNACFGGTASLFAALDWLESSNCDGRLXXXXXXXXXXXXXXXXRCTGGAGAVAMLLGPNAPLIFDKGIRSHHMSHQWDFYKPKLDSEYPVYDGQLSIISYQKSIDKCFQLYKKKC--LNKGLINQSMILFRENYYFCFHSPYTKLVEKSFARLVFNDIKDNPDIVEQFNEQLEDIKPFLHLNIENTYGNRDFDLSFLKFSDTLIKDKLRPGVLMAQNNGNMYTASLYGSLISVLIQTPIEELVGSRIVLFSYGSGLASCMFSLMITENKMKLSEIKDSLNKIVDNLKNRIILSYKEFEDFLARRSSINCKCNVKPSTELSYLRSGTFYLSEIDEKYRRKYQIYNSEITNG 1380
            ++GI+A+EI FP+  +DQ +LE  D    GKYT+GLGQ KMG CSD ED+NS+ LTV  +LLE   +  ++IG L VGTET++DKSKS K+VLM+LF + GNTDI+G+D  NAC+GGTA+LF A++W+ESS+ DGRLA+ V ADIA+YA+ AAR TGGAGAVAML+GPNAPLI D+G+R+ HM H +DFYKP L SEYP  DG+LSI  Y  ++D C++LY+KK     K    Q   L   +    FH+P+ KLV+KS  RL FND   + +  E+  +Q  D++ F    +E+TY +RD + +F+  S  +   K +  +L+A   GNMYT S+Y  L+S+LI  P +ELVG RI LFSYGSGLA+ M+S+ +T++     +    L+ +   L +R  ++ ++F   +  R   N      P+  +S L  GT+YL ++D  +RR Y+     I+NG
Sbjct:    8 NVGIRAIEILFPSQYVDQTELETFDGASAGKYTIGLGQAKMGFCSDREDVNSLCLTVVSRLLERQHVKHSEIGRLEVGTETIVDKSKSVKSVLMQLFAESGNTDIEGIDTTNACYGGTAALFNAVNWVESSSWDGRLALAVCADIAVYAKGAARPTGGAGAVAMLVGPNAPLILDRGLRATHMEHAYDFYKPDLSSEYPTVDGKLSIQCYLSALDTCYRLYRKKFDQQQKDTSKQPASLSTFD-AILFHTPFCKLVQKSVGRLSFNDFLLSSE--EERTKQFPDLERFNTATLESTYFDRDVEKAFMTQSANIFASKTKKSLLLANQVGNMYTPSVYSGLVSLLISGPAQELVGKRIGLFSYGSGLAASMYSISVTQDAAAFEKFVSQLDYVQPLLNSREKVAPEQFSALMEVREKNNHAAPYTPTGSISALFPGTYYLKDVDALHRRTYE-RTPTISNG 463          
BLAST of 3-hydroxy-3-methylglutaryl coenzyme A synthase vs. Ensembl Fly
Match: Hmgs (gene:FBgn0010611 transcript:FBtr0087147)

HSP 1 Score: 400.979 bits (1029), Expect = 3.551e-135
Identity = 216/460 (46.96%), Postives = 304/460 (66.09%), Query Frame = 1
Query:   10 DIGIKAVEIYFPNTCIDQKDLEESDNC-LGKYTVGLGQIKMGVCSDLEDINSIALTVTKQLLENNFIDPNDIGFLSVGTETLIDKSKSTKTVLMELFEKHGNTDIQGVDEKNACFGGTASLFAALDWLESSNCDGRLXXXXXXXXXXXXXXXXRCTGGAGAVAMLLGPNAPLIFDKGIRSHHMSHQWDFYKPKLDSEYPVYDGQLSIISYQKSIDKCFQLYKKKC--LNKGLINQSMILFRENYYFCFHSPYTKLVEKSFARLVFNDIKDNPDIVEQFNEQLEDIKPFLHLNIENTYGNRDFDLSFLKFSDTLIKDKLRPGVLMAQNNGNMYTASLYGSLISVLIQTPIEELVGSRIVLFSYGSGLASCMFSLMITENKMKLSEIKDSLNKIVDNLKNRIILSYKEFEDFLARRSSINCKCNVKPSTELSYLRSGTFYLSEIDEKYRRKYQIYNSEITNG 1380
            ++GI+A+EI FP+  +DQ +LE  D    GKYT+GLGQ KMG CSD ED+NS+ LTV  +LLE   +  ++IG L VGTET++DKSKS K+VLM+LF + GNTDI+G+D  NAC+GGTA+LF A++W+ESS+ DGRLA+ V ADIA+YA+ AAR TGGAGAVAML+GPNAPLI D+G+R+ HM H +DFYKP L SEYP  DG+LSI  Y  ++D C++LY+KK     K    Q   L   +    FH+P+ KLV+KS  RL FND   + +  E+  +Q  D++ F    +E+TY +RD + +F+  S  +   K +  +L+A   GNMYT S+Y  L+S+LI  P +ELVG RI LFSYGSGLA+ M+S+ +T++     +    L+ +   L +R  ++ ++F   +  R   N      P+  +S L  GT+YL ++D  +RR Y+     I+NG
Sbjct:    8 NVGIRAIEILFPSQYVDQTELETFDGASAGKYTIGLGQAKMGFCSDREDVNSLCLTVVSRLLERQHVKHSEIGRLEVGTETIVDKSKSVKSVLMQLFAESGNTDIEGIDTTNACYGGTAALFNAVNWVESSSWDGRLALAVCADIAVYAKGAARPTGGAGAVAMLVGPNAPLILDRGLRATHMEHAYDFYKPDLSSEYPTVDGKLSIQCYLSALDTCYRLYRKKFDQQQKDTSKQPASLSTFD-AILFHTPFCKLVQKSVGRLSFNDFLLSSE--EERTKQFPDLERFNTATLESTYFDRDVEKAFMTQSANIFASKTKKSLLLANQVGNMYTPSVYSGLVSLLISGPAQELVGKRIGLFSYGSGLAASMYSISVTQDAAAFEKFVSQLDYVQPLLNSREKVAPEQFSALMEVREKNNHAAPYTPTGSISALFPGTYYLKDVDALHRRTYE-RTPTISNG 463          
BLAST of 3-hydroxy-3-methylglutaryl coenzyme A synthase vs. Ensembl Fly
Match: Hmgs (gene:FBgn0010611 transcript:FBtr0087148)

HSP 1 Score: 400.979 bits (1029), Expect = 3.551e-135
Identity = 216/460 (46.96%), Postives = 304/460 (66.09%), Query Frame = 1
Query:   10 DIGIKAVEIYFPNTCIDQKDLEESDNC-LGKYTVGLGQIKMGVCSDLEDINSIALTVTKQLLENNFIDPNDIGFLSVGTETLIDKSKSTKTVLMELFEKHGNTDIQGVDEKNACFGGTASLFAALDWLESSNCDGRLXXXXXXXXXXXXXXXXRCTGGAGAVAMLLGPNAPLIFDKGIRSHHMSHQWDFYKPKLDSEYPVYDGQLSIISYQKSIDKCFQLYKKKC--LNKGLINQSMILFRENYYFCFHSPYTKLVEKSFARLVFNDIKDNPDIVEQFNEQLEDIKPFLHLNIENTYGNRDFDLSFLKFSDTLIKDKLRPGVLMAQNNGNMYTASLYGSLISVLIQTPIEELVGSRIVLFSYGSGLASCMFSLMITENKMKLSEIKDSLNKIVDNLKNRIILSYKEFEDFLARRSSINCKCNVKPSTELSYLRSGTFYLSEIDEKYRRKYQIYNSEITNG 1380
            ++GI+A+EI FP+  +DQ +LE  D    GKYT+GLGQ KMG CSD ED+NS+ LTV  +LLE   +  ++IG L VGTET++DKSKS K+VLM+LF + GNTDI+G+D  NAC+GGTA+LF A++W+ESS+ DGRLA+ V ADIA+YA+ AAR TGGAGAVAML+GPNAPLI D+G+R+ HM H +DFYKP L SEYP  DG+LSI  Y  ++D C++LY+KK     K    Q   L   +    FH+P+ KLV+KS  RL FND   + +  E+  +Q  D++ F    +E+TY +RD + +F+  S  +   K +  +L+A   GNMYT S+Y  L+S+LI  P +ELVG RI LFSYGSGLA+ M+S+ +T++     +    L+ +   L +R  ++ ++F   +  R   N      P+  +S L  GT+YL ++D  +RR Y+     I+NG
Sbjct:    8 NVGIRAIEILFPSQYVDQTELETFDGASAGKYTIGLGQAKMGFCSDREDVNSLCLTVVSRLLERQHVKHSEIGRLEVGTETIVDKSKSVKSVLMQLFAESGNTDIEGIDTTNACYGGTAALFNAVNWVESSSWDGRLALAVCADIAVYAKGAARPTGGAGAVAMLVGPNAPLILDRGLRATHMEHAYDFYKPDLSSEYPTVDGKLSIQCYLSALDTCYRLYRKKFDQQQKDTSKQPASLSTFD-AILFHTPFCKLVQKSVGRLSFNDFLLSSE--EERTKQFPDLERFNTATLESTYFDRDVEKAFMTQSANIFASKTKKSLLLANQVGNMYTPSVYSGLVSLLISGPAQELVGKRIGLFSYGSGLAASMYSISVTQDAAAFEKFVSQLDYVQPLLNSREKVAPEQFSALMEVREKNNHAAPYTPTGSISALFPGTYYLKDVDALHRRTYE-RTPTISNG 463          
BLAST of 3-hydroxy-3-methylglutaryl coenzyme A synthase vs. Ensembl Fly
Match: Hmgs (gene:FBgn0010611 transcript:FBtr0087145)

HSP 1 Score: 400.979 bits (1029), Expect = 3.551e-135
Identity = 216/460 (46.96%), Postives = 304/460 (66.09%), Query Frame = 1
Query:   10 DIGIKAVEIYFPNTCIDQKDLEESDNC-LGKYTVGLGQIKMGVCSDLEDINSIALTVTKQLLENNFIDPNDIGFLSVGTETLIDKSKSTKTVLMELFEKHGNTDIQGVDEKNACFGGTASLFAALDWLESSNCDGRLXXXXXXXXXXXXXXXXRCTGGAGAVAMLLGPNAPLIFDKGIRSHHMSHQWDFYKPKLDSEYPVYDGQLSIISYQKSIDKCFQLYKKKC--LNKGLINQSMILFRENYYFCFHSPYTKLVEKSFARLVFNDIKDNPDIVEQFNEQLEDIKPFLHLNIENTYGNRDFDLSFLKFSDTLIKDKLRPGVLMAQNNGNMYTASLYGSLISVLIQTPIEELVGSRIVLFSYGSGLASCMFSLMITENKMKLSEIKDSLNKIVDNLKNRIILSYKEFEDFLARRSSINCKCNVKPSTELSYLRSGTFYLSEIDEKYRRKYQIYNSEITNG 1380
            ++GI+A+EI FP+  +DQ +LE  D    GKYT+GLGQ KMG CSD ED+NS+ LTV  +LLE   +  ++IG L VGTET++DKSKS K+VLM+LF + GNTDI+G+D  NAC+GGTA+LF A++W+ESS+ DGRLA+ V ADIA+YA+ AAR TGGAGAVAML+GPNAPLI D+G+R+ HM H +DFYKP L SEYP  DG+LSI  Y  ++D C++LY+KK     K    Q   L   +    FH+P+ KLV+KS  RL FND   + +  E+  +Q  D++ F    +E+TY +RD + +F+  S  +   K +  +L+A   GNMYT S+Y  L+S+LI  P +ELVG RI LFSYGSGLA+ M+S+ +T++     +    L+ +   L +R  ++ ++F   +  R   N      P+  +S L  GT+YL ++D  +RR Y+     I+NG
Sbjct:    8 NVGIRAIEILFPSQYVDQTELETFDGASAGKYTIGLGQAKMGFCSDREDVNSLCLTVVSRLLERQHVKHSEIGRLEVGTETIVDKSKSVKSVLMQLFAESGNTDIEGIDTTNACYGGTAALFNAVNWVESSSWDGRLALAVCADIAVYAKGAARPTGGAGAVAMLVGPNAPLILDRGLRATHMEHAYDFYKPDLSSEYPTVDGKLSIQCYLSALDTCYRLYRKKFDQQQKDTSKQPASLSTFD-AILFHTPFCKLVQKSVGRLSFNDFLLSSE--EERTKQFPDLERFNTATLESTYFDRDVEKAFMTQSANIFASKTKKSLLLANQVGNMYTPSVYSGLVSLLISGPAQELVGKRIGLFSYGSGLAASMYSISVTQDAAAFEKFVSQLDYVQPLLNSREKVAPEQFSALMEVREKNNHAAPYTPTGSISALFPGTYYLKDVDALHRRTYE-RTPTISNG 463          
BLAST of 3-hydroxy-3-methylglutaryl coenzyme A synthase vs. Ensembl Zebrafish
Match: hmgcs1 (3-hydroxy-3-methylglutaryl-CoA synthase 1 (soluble) [Source:ZFIN;Acc:ZDB-GENE-040426-1042])

HSP 1 Score: 399.438 bits (1025), Expect = 1.339e-133
Identity = 216/453 (47.68%), Postives = 301/453 (66.45%), Query Frame = 1
Query:   10 DIGIKAVEIYFPNTCIDQKDLEESDNC-LGKYTVGLGQIKMGVCSDLEDINSIALTVTKQLLENNFIDPNDIGFLSVGTETLIDKSKSTKTVLMELFEKHGNTDIQGVDEKNACFGGTASLFAALDWLESSNCDGRLXXXXXXXXXXXXXXXXRCTGGAGAVAMLLGPNAPLIFDKGIRSHHMSHQWDFYKPKLDSEYPVYDGQLSIISYQKSIDKCFQLYKKKCLNKGLI--NQSMILFRENYYFCFHSPYTKLVEKSFARLVFNDIKDNPDIVEQFNEQLEDIKPFLHLNIENTYGNRDFDLSFLKFSDTLIKDKLRPGVLMAQNNGNMYTASLYGSLISVLIQTPIEELVGSRIVLFSYGSGLASCMFSLMITENKMK---LSEIKDSLNKIVDNLKNRIILSYKEFEDFLARRSSINCKCNVKPSTELSYLRSGTFYLSEIDEKYRRKY 1350
            D+GI A+E+Y P+  +DQ +LEE D    GKYTVGLGQ +MG CSD EDINS+ LTV ++L+E N +    +G L VGTET+IDKSKSTKTVLM+LFE+ GNTD++GVD  NAC+GGTA+LF A++W+ESS+ DGR A+VVA DIA+YA  +AR TGGAGAVAML+GPNAPL F++G+R  HM H +DFYKP + SEYPV DG+LSI  Y  ++D+C+ +YK K   +      +      +  +  FHSPY KLV+KS ARL+ ND   +P    + +     ++ F  + IE+TY +RD + +F+K S  L  DK +  +L++  NGNMYT S+YG L SVL Q   ++L G RI +FSYGSG A+ ++S+ +T++      L ++  SL  +   L +R  +S   F + +  R   +   N  P   +  L  GT+YL+ +DEK+RR+Y
Sbjct:   16 DVGIIAMEVYVPSQYVDQAELEEYDGVGAGKYTVGLGQARMGFCSDREDINSLCLTVVQRLMERNGLSYESVGRLEVGTETIIDKSKSTKTVLMQLFEESGNTDVEGVDTTNACYGGTAALFNAVNWVESSSWDGRYALVVAGDIAVYATGSARPTGGAGAVAMLVGPNAPLAFERGLRGTHMQHAYDFYKPDMVSEYPVVDGKLSIQCYLSALDQCYSVYKNKIHARWQREGTEGRCSLEDFGFMVFHSPYCKLVQKSLARLMLNDFLCHPSPNME-SGPFSGLEAFRDVKIEDTYFDRDVEKAFMKASSELFDDKTKASLLISNQNGNMYTPSVYGCLASVLAQHTPQQLAGQRIGVFSYGSGFAATLYSIKVTQDGTPGSALDKLVSSLCDLPARLDSRQKVSPGVFAETMKLREETHHLANYIPQGSVDELFPGTWYLTRVDEKHRRQY 467          
BLAST of 3-hydroxy-3-methylglutaryl coenzyme A synthase vs. Ensembl Zebrafish
Match: hmgcs1 (3-hydroxy-3-methylglutaryl-CoA synthase 1 (soluble) [Source:ZFIN;Acc:ZDB-GENE-040426-1042])

HSP 1 Score: 399.438 bits (1025), Expect = 1.339e-133
Identity = 216/453 (47.68%), Postives = 301/453 (66.45%), Query Frame = 1
Query:   10 DIGIKAVEIYFPNTCIDQKDLEESDNC-LGKYTVGLGQIKMGVCSDLEDINSIALTVTKQLLENNFIDPNDIGFLSVGTETLIDKSKSTKTVLMELFEKHGNTDIQGVDEKNACFGGTASLFAALDWLESSNCDGRLXXXXXXXXXXXXXXXXRCTGGAGAVAMLLGPNAPLIFDKGIRSHHMSHQWDFYKPKLDSEYPVYDGQLSIISYQKSIDKCFQLYKKKCLNKGLI--NQSMILFRENYYFCFHSPYTKLVEKSFARLVFNDIKDNPDIVEQFNEQLEDIKPFLHLNIENTYGNRDFDLSFLKFSDTLIKDKLRPGVLMAQNNGNMYTASLYGSLISVLIQTPIEELVGSRIVLFSYGSGLASCMFSLMITENKMK---LSEIKDSLNKIVDNLKNRIILSYKEFEDFLARRSSINCKCNVKPSTELSYLRSGTFYLSEIDEKYRRKY 1350
            D+GI A+E+Y P+  +DQ +LEE D    GKYTVGLGQ +MG CSD EDINS+ LTV ++L+E N +    +G L VGTET+IDKSKSTKTVLM+LFE+ GNTD++GVD  NAC+GGTA+LF A++W+ESS+ DGR A+VVA DIA+YA  +AR TGGAGAVAML+GPNAPL F++G+R  HM H +DFYKP + SEYPV DG+LSI  Y  ++D+C+ +YK K   +      +      +  +  FHSPY KLV+KS ARL+ ND   +P    + +     ++ F  + IE+TY +RD + +F+K S  L  DK +  +L++  NGNMYT S+YG L SVL Q   ++L G RI +FSYGSG A+ ++S+ +T++      L ++  SL  +   L +R  +S   F + +  R   +   N  P   +  L  GT+YL+ +DEK+RR+Y
Sbjct:   16 DVGIIAMEVYVPSQYVDQAELEEYDGVGAGKYTVGLGQARMGFCSDREDINSLCLTVVQRLMERNGLSYESVGRLEVGTETIIDKSKSTKTVLMQLFEESGNTDVEGVDTTNACYGGTAALFNAVNWVESSSWDGRYALVVAGDIAVYATGSARPTGGAGAVAMLVGPNAPLAFERGLRGTHMQHAYDFYKPDMVSEYPVVDGKLSIQCYLSALDQCYSVYKNKIHARWQREGTEGRCSLEDFGFMVFHSPYCKLVQKSLARLMLNDFLCHPSPNME-SGPFSGLEAFRDVKIEDTYFDRDVEKAFMKASSELFDDKTKASLLISNQNGNMYTPSVYGCLASVLAQHTPQQLAGQRIGVFSYGSGFAATLYSIKVTQDGTPGSALDKLVSSLCDLPARLDSRQKVSPGVFAETMKLREETHHLANYIPQGSVDELFPGTWYLTRVDEKHRRQY 467          
BLAST of 3-hydroxy-3-methylglutaryl coenzyme A synthase vs. Ensembl Zebrafish
Match: hmgcs1 (3-hydroxy-3-methylglutaryl-CoA synthase 1 (soluble) [Source:ZFIN;Acc:ZDB-GENE-040426-1042])

HSP 1 Score: 294.278 bits (752), Expect = 5.153e-96
Identity = 153/267 (57.30%), Postives = 198/267 (74.16%), Query Frame = 1
Query:   10 DIGIKAVEIYFPNTCIDQKDLEESDNC-LGKYTVGLGQIKMGVCSDLEDINSIALTVTKQLLENNFIDPNDIGFLSVGTETLIDKSKSTKTVLMELFEKHGNTDIQGVDEKNACFGGTASLFAALDWLESSNCDGRLXXXXXXXXXXXXXXXXRCTGGAGAVAMLLGPNAPLIFDKGIRSHHMSHQWDFYKPKLDSEYPVYDGQLSIISYQKSIDKCFQLYKKKCLNKGLI--NQSMILFRENYYFCFHSPYTKLVEKSFARLVFND 801
            D+GI A+E+Y P+  +DQ +LEE D    GKYTVGLGQ +MG CSD EDINS+ LTV ++L+E N +    +G L VGTET+IDKSKSTKTVLM+LFE+ GNTD++GVD  NAC+GGTA+LF A++W+ESS+ DGR A+VVA DIA+YA  +AR TGGAGAVAML+GPNAPL F++G+R  HM H +DFYKP + SEYPV DG+LSI  Y  ++D+C+ +YK K   +      +      +  +  FHSPY KLV+KS ARL+ ND
Sbjct:   16 DVGIIAMEVYVPSQYVDQAELEEYDGVGAGKYTVGLGQARMGFCSDREDINSLCLTVVQRLMERNGLSYESVGRLEVGTETIIDKSKSTKTVLMQLFEESGNTDVEGVDTTNACYGGTAALFNAVNWVESSSWDGRYALVVAGDIAVYATGSARPTGGAGAVAMLVGPNAPLAFERGLRGTHMQHAYDFYKPDMVSEYPVVDGKLSIQCYLSALDQCYSVYKNKIHARWQREGTEGRCSLEDFGFMVFHSPYCKLVQKSLARLMLND 282          
BLAST of 3-hydroxy-3-methylglutaryl coenzyme A synthase vs. Ensembl Zebrafish
Match: hmgcs1 (3-hydroxy-3-methylglutaryl-CoA synthase 1 (soluble) [Source:ZFIN;Acc:ZDB-GENE-040426-1042])

HSP 1 Score: 198.749 bits (504), Expect = 2.765e-60
Identity = 107/168 (63.69%), Postives = 135/168 (80.36%), Query Frame = 1
Query:   10 DIGIKAVEIYFPNTCIDQKDLEESDNC-LGKYTVGLGQIKMGVCSDLEDINSIALTVTKQLLENNFIDPNDIGFLSVGTETLIDKSKSTKTVLMELFEKHGNTDIQGVDEKNACFGGTASLFAALDWLESSNCDGRLXXXXXXXXXXXXXXXXRCTGGAGAVAMLLGP 510
            D+GI A+E+Y P+  +DQ +LEE D    GKYTVGLGQ +MG CSD EDINS+ LTV ++L+E N +    +G L VGTET+IDKSKSTKTVLM+LFE+ GNTD++GVD  NAC+GGTA+LF A++W+ESS+ DGR A+VVA DIA+YA  +AR TGGAGAVAML+GP
Sbjct:   34 DVGIIAMEVYVPSQYVDQAELEEYDGVGAGKYTVGLGQARMGFCSDREDINSLCLTVVQRLMERNGLSYESVGRLEVGTETIIDKSKSTKTVLMQLFEESGNTDVEGVDTTNACYGGTAALFNAVNWVESSSWDGRYALVVAGDIAVYATGSARPTGGAGAVAMLVGP 201          
BLAST of 3-hydroxy-3-methylglutaryl coenzyme A synthase vs. Ensembl Xenopus
Match: hmgcs1 (3-hydroxy-3-methylglutaryl-CoA synthase 1 [Source:NCBI gene;Acc:100145212])

HSP 1 Score: 399.438 bits (1025), Expect = 1.449e-133
Identity = 225/455 (49.45%), Postives = 304/455 (66.81%), Query Frame = 1
Query:   10 DIGIKAVEIYFPNTCIDQKDLEESDNC-LGKYTVGLGQIKMGVCSDLEDINSIALTVTKQLLENNFIDPNDIGFLSVGTETLIDKSKSTKTVLMELFEKHGNTDIQGVDEKNACFGGTASLFAALDWLESSNCDGRLXXXXXXXXXXXXXXXXRCTGGAGAVAMLLGPNAPLIFDKGIRSHHMSHQWDFYKPKLDSEYPVYDGQLSIISYQKSIDKCFQLYKKKCLNKGLINQSMILFREN--YYFCFHSPYTKLVEKSFARLVFND-IKD-NPDIVEQFNEQLEDIKPFLHLNIENTYGNRDFDLSFLKFSDTLIKDKLRPGVLMAQNNGNMYTASLYGSLISVLIQTPIEELVGSRIVLFSYGSGLASCMFSLMITENKM---KLSEIKDSLNKIVDNLKNRIILSYKEFEDFLARRSSINCKCNVKPSTELSYLRSGTFYLSEIDEKYRRKY 1350
            D+GI A+EIYFP+  +DQ +LE+ D    GKYT+GLGQ KMG CSD EDINS+ LTV ++L+E N +  + IG L VGTET+IDKSKS KTVLM+LFE  GNTD++G+D  NAC+GGTA+LF A++W+ESS+ DGR A+VVA DIA+YA  +AR TGGAGAVAML+GPNA L+F++G+R  HM H +DFYKP ++SEYPV DG+LSI  Y  ++D C+  Y+KK   +     +   F  N   +  FHSPY KLV+KS ARL+ ND I D +PD+       L+    F  L +E TY +RD + +FLK S  L  DK +  +L+++ NGNMYT S+YG L SVL Q   ++L G RI +FSYGSG A+ M+SL ++++ M    L ++  SL+ +   L +R  +S   F D +  R   +   N  P   +  L  GT+YL  +DEK+RR Y
Sbjct:    7 DVGIVALEIYFPSQYVDQVELEKFDGVSAGKYTIGLGQCKMGFCSDREDINSLCLTVVQRLMERNNLSYDCIGRLEVGTETIIDKSKSVKTVLMQLFEDSGNTDVEGIDTTNACYGGTAALFNAVNWVESSSWDGRYALVVAGDIAVYATGSARPTGGAGAVAMLVGPNATLVFERGLRGTHMQHAYDFYKPDMESEYPVVDGKLSIQCYLSALDHCYTTYRKKIHAQWQKEGTDKPFTLNDFGFMIFHSPYCKLVQKSLARLLVNDFISDSDPDMESGMYVGLDS---FRDLKLEETYFDRDVEKAFLKASTELFNDKTKASLLVSRENGNMYTPSVYGCLASVLAQYSPQQLAGQRIGVFSYGSGFAATMYSLRVSQDAMPGSSLDKLTSSLSDLKARLDSRKNVSPSNFADTMKLRQDTHHLANYIPQGSVDDLFPGTWYLVRVDEKHRRFY 458          
BLAST of 3-hydroxy-3-methylglutaryl coenzyme A synthase vs. Ensembl Xenopus
Match: hmgcs1 (3-hydroxy-3-methylglutaryl-CoA synthase 1 [Source:NCBI gene;Acc:100145212])

HSP 1 Score: 399.053 bits (1024), Expect = 2.217e-133
Identity = 225/455 (49.45%), Postives = 304/455 (66.81%), Query Frame = 1
Query:   10 DIGIKAVEIYFPNTCIDQKDLEESDNC-LGKYTVGLGQIKMGVCSDLEDINSIALTVTKQLLENNFIDPNDIGFLSVGTETLIDKSKSTKTVLMELFEKHGNTDIQGVDEKNACFGGTASLFAALDWLESSNCDGRLXXXXXXXXXXXXXXXXRCTGGAGAVAMLLGPNAPLIFDKGIRSHHMSHQWDFYKPKLDSEYPVYDGQLSIISYQKSIDKCFQLYKKKCLNKGLINQSMILFREN--YYFCFHSPYTKLVEKSFARLVFND-IKD-NPDIVEQFNEQLEDIKPFLHLNIENTYGNRDFDLSFLKFSDTLIKDKLRPGVLMAQNNGNMYTASLYGSLISVLIQTPIEELVGSRIVLFSYGSGLASCMFSLMITENKM---KLSEIKDSLNKIVDNLKNRIILSYKEFEDFLARRSSINCKCNVKPSTELSYLRSGTFYLSEIDEKYRRKY 1350
            D+GI A+EIYFP+  +DQ +LE+ D    GKYT+GLGQ KMG CSD EDINS+ LTV ++L+E N +  + IG L VGTET+IDKSKS KTVLM+LFE  GNTD++G+D  NAC+GGTA+LF A++W+ESS+ DGR A+VVA DIA+YA  +AR TGGAGAVAML+GPNA L+F++G+R  HM H +DFYKP ++SEYPV DG+LSI  Y  ++D C+  Y+KK   +     +   F  N   +  FHSPY KLV+KS ARL+ ND I D +PD+       L+    F  L +E TY +RD + +FLK S  L  DK +  +L+++ NGNMYT S+YG L SVL Q   ++L G RI +FSYGSG A+ M+SL ++++ M    L ++  SL+ +   L +R  +S   F D +  R   +   N  P   +  L  GT+YL  +DEK+RR Y
Sbjct:   16 DVGIVALEIYFPSQYVDQVELEKFDGVSAGKYTIGLGQCKMGFCSDREDINSLCLTVVQRLMERNNLSYDCIGRLEVGTETIIDKSKSVKTVLMQLFEDSGNTDVEGIDTTNACYGGTAALFNAVNWVESSSWDGRYALVVAGDIAVYATGSARPTGGAGAVAMLVGPNATLVFERGLRGTHMQHAYDFYKPDMESEYPVVDGKLSIQCYLSALDHCYTTYRKKIHAQWQKEGTDKPFTLNDFGFMIFHSPYCKLVQKSLARLLVNDFISDSDPDMESGMYVGLDS---FRDLKLEETYFDRDVEKAFLKASTELFNDKTKASLLVSRENGNMYTPSVYGCLASVLAQYSPQQLAGQRIGVFSYGSGFAATMYSLRVSQDAMPGSSLDKLTSSLSDLKARLDSRKNVSPSNFADTMKLRQDTHHLANYIPQGSVDDLFPGTWYLVRVDEKHRRFY 467          
BLAST of 3-hydroxy-3-methylglutaryl coenzyme A synthase vs. Ensembl Xenopus
Match: hmgcs1 (3-hydroxy-3-methylglutaryl-CoA synthase 1 [Source:NCBI gene;Acc:100145212])

HSP 1 Score: 399.438 bits (1025), Expect = 3.430e-133
Identity = 225/455 (49.45%), Postives = 304/455 (66.81%), Query Frame = 1
Query:   10 DIGIKAVEIYFPNTCIDQKDLEESDNC-LGKYTVGLGQIKMGVCSDLEDINSIALTVTKQLLENNFIDPNDIGFLSVGTETLIDKSKSTKTVLMELFEKHGNTDIQGVDEKNACFGGTASLFAALDWLESSNCDGRLXXXXXXXXXXXXXXXXRCTGGAGAVAMLLGPNAPLIFDKGIRSHHMSHQWDFYKPKLDSEYPVYDGQLSIISYQKSIDKCFQLYKKKCLNKGLINQSMILFREN--YYFCFHSPYTKLVEKSFARLVFND-IKD-NPDIVEQFNEQLEDIKPFLHLNIENTYGNRDFDLSFLKFSDTLIKDKLRPGVLMAQNNGNMYTASLYGSLISVLIQTPIEELVGSRIVLFSYGSGLASCMFSLMITENKM---KLSEIKDSLNKIVDNLKNRIILSYKEFEDFLARRSSINCKCNVKPSTELSYLRSGTFYLSEIDEKYRRKY 1350
            D+GI A+EIYFP+  +DQ +LE+ D    GKYT+GLGQ KMG CSD EDINS+ LTV ++L+E N +  + IG L VGTET+IDKSKS KTVLM+LFE  GNTD++G+D  NAC+GGTA+LF A++W+ESS+ DGR A+VVA DIA+YA  +AR TGGAGAVAML+GPNA L+F++G+R  HM H +DFYKP ++SEYPV DG+LSI  Y  ++D C+  Y+KK   +     +   F  N   +  FHSPY KLV+KS ARL+ ND I D +PD+       L+    F  L +E TY +RD + +FLK S  L  DK +  +L+++ NGNMYT S+YG L SVL Q   ++L G RI +FSYGSG A+ M+SL ++++ M    L ++  SL+ +   L +R  +S   F D +  R   +   N  P   +  L  GT+YL  +DEK+RR Y
Sbjct:   41 DVGIVALEIYFPSQYVDQVELEKFDGVSAGKYTIGLGQCKMGFCSDREDINSLCLTVVQRLMERNNLSYDCIGRLEVGTETIIDKSKSVKTVLMQLFEDSGNTDVEGIDTTNACYGGTAALFNAVNWVESSSWDGRYALVVAGDIAVYATGSARPTGGAGAVAMLVGPNATLVFERGLRGTHMQHAYDFYKPDMESEYPVVDGKLSIQCYLSALDHCYTTYRKKIHAQWQKEGTDKPFTLNDFGFMIFHSPYCKLVQKSLARLLVNDFISDSDPDMESGMYVGLDS---FRDLKLEETYFDRDVEKAFLKASTELFNDKTKASLLVSRENGNMYTPSVYGCLASVLAQYSPQQLAGQRIGVFSYGSGFAATMYSLRVSQDAMPGSSLDKLTSSLSDLKARLDSRKNVSPSNFADTMKLRQDTHHLANYIPQGSVDDLFPGTWYLVRVDEKHRRFY 492          
BLAST of 3-hydroxy-3-methylglutaryl coenzyme A synthase vs. Ensembl Mouse
Match: Hmgcs2 (3-hydroxy-3-methylglutaryl-Coenzyme A synthase 2 [Source:MGI Symbol;Acc:MGI:101939])

HSP 1 Score: 396.356 bits (1017), Expect = 1.445e-132
Identity = 214/453 (47.24%), Postives = 296/453 (65.34%), Query Frame = 1
Query:   10 DIGIKAVEIYFPNTCIDQKDLEESDNC-LGKYTVGLGQIKMGVCSDLEDINSIALTVTKQLLENNFIDPNDIGFLSVGTETLIDKSKSTKTVLMELFEKHGNTDIQGVDEKNACFGGTASLFAALDWLESSNCDGRLXXXXXXXXXXXXXXXXRCTGGAGAVAMLLGPNAPLIFDKGIRSHHMSHQWDFYKPKLDSEYPVYDGQLSIISYQKSIDKCFQLYKKKCLN--KGLINQSMILFRENYYFCFHSPYTKLVEKSFARLVFNDIKDNPDIVEQFNEQLEDIKPFLHLNIENTYGNRDFDLSFLKFSDTLIKDKLRPGVLMAQNNGNMYTASLYGSLISVLIQTPIEELVGSRIVLFSYGSGLASCMFSLMITENKMKLSEIKDSLNKIVD---NLKNRIILSYKEFEDFLARRSSINCKCNVKPSTELSYLRSGTFYLSEIDEKYRRKY 1350
            D+GI A+E+YFP   +DQ DLE+ +N   GKYTVGLGQ +MG CS  EDINS+ LTV ++L+E   +  + +G L VGTET+IDKSK+ KTVLMELF+  GNTDI+G+D  NAC+GGTASLF A +W+ESS  DGR A+VV  DIA+Y    AR TGGAGAVAML+GP APL+ ++G+R  HM + +DFYKP L SEYP+ DG+LSI  Y +++D+C+  Y+KK  N  K   N       +  Y  FH+P+ K+V+KS ARL+FND   +    ++ N   + ++ F  L +E TY N+D D + LK S  +   K +  + ++ NNGNMYT+SLYG L S+L     +EL GSRI  FSYGSGLA+  FS  ++++    S ++  ++ + D    L +R  +S +EF + + +R     K N  P  + S L  GT+YL  +DE +RRKY
Sbjct:   53 DVGILALEVYFPAQYVDQTDLEKFNNVEAGKYTVGLGQTRMGFCSVQEDINSLCLTVVQRLMERTKLPWDAVGRLEVGTETIIDKSKAVKTVLMELFQDSGNTDIEGIDTTNACYGGTASLFNAANWMESSYWDGRYALVVCGDIAVYPSGNARPTGGAGAVAMLIGPKAPLVLEQGLRGTHMENAYDFYKPNLASEYPLVDGKLSIQCYLRALDRCYAAYRKKIQNQWKQAGNNQPFTLDDVQYMIFHTPFCKMVQKSLARLMFNDFLSSSS--DKQNNLYKGLEAFRGLKLEETYTNKDVDKALLKASLDMFNQKTKASLYLSTNNGNMYTSSLYGCLASLLSHHSAQELAGSRIGAFSYGSGLAASFFSFRVSKDASPGSPLEKLVSSVSDLPKRLDSRRRMSPEEFTEIMNQREQFYHKVNFSPPGDTSNLFPGTWYLERVDEMHRRKY 503          
BLAST of 3-hydroxy-3-methylglutaryl coenzyme A synthase vs. Ensembl Mouse
Match: Hmgcs2 (3-hydroxy-3-methylglutaryl-Coenzyme A synthase 2 [Source:MGI Symbol;Acc:MGI:101939])

HSP 1 Score: 396.356 bits (1017), Expect = 1.445e-132
Identity = 214/453 (47.24%), Postives = 296/453 (65.34%), Query Frame = 1
Query:   10 DIGIKAVEIYFPNTCIDQKDLEESDNC-LGKYTVGLGQIKMGVCSDLEDINSIALTVTKQLLENNFIDPNDIGFLSVGTETLIDKSKSTKTVLMELFEKHGNTDIQGVDEKNACFGGTASLFAALDWLESSNCDGRLXXXXXXXXXXXXXXXXRCTGGAGAVAMLLGPNAPLIFDKGIRSHHMSHQWDFYKPKLDSEYPVYDGQLSIISYQKSIDKCFQLYKKKCLN--KGLINQSMILFRENYYFCFHSPYTKLVEKSFARLVFNDIKDNPDIVEQFNEQLEDIKPFLHLNIENTYGNRDFDLSFLKFSDTLIKDKLRPGVLMAQNNGNMYTASLYGSLISVLIQTPIEELVGSRIVLFSYGSGLASCMFSLMITENKMKLSEIKDSLNKIVD---NLKNRIILSYKEFEDFLARRSSINCKCNVKPSTELSYLRSGTFYLSEIDEKYRRKY 1350
            D+GI A+E+YFP   +DQ DLE+ +N   GKYTVGLGQ +MG CS  EDINS+ LTV ++L+E   +  + +G L VGTET+IDKSK+ KTVLMELF+  GNTDI+G+D  NAC+GGTASLF A +W+ESS  DGR A+VV  DIA+Y    AR TGGAGAVAML+GP APL+ ++G+R  HM + +DFYKP L SEYP+ DG+LSI  Y +++D+C+  Y+KK  N  K   N       +  Y  FH+P+ K+V+KS ARL+FND   +    ++ N   + ++ F  L +E TY N+D D + LK S  +   K +  + ++ NNGNMYT+SLYG L S+L     +EL GSRI  FSYGSGLA+  FS  ++++    S ++  ++ + D    L +R  +S +EF + + +R     K N  P  + S L  GT+YL  +DE +RRKY
Sbjct:   53 DVGILALEVYFPAQYVDQTDLEKFNNVEAGKYTVGLGQTRMGFCSVQEDINSLCLTVVQRLMERTKLPWDAVGRLEVGTETIIDKSKAVKTVLMELFQDSGNTDIEGIDTTNACYGGTASLFNAANWMESSYWDGRYALVVCGDIAVYPSGNARPTGGAGAVAMLIGPKAPLVLEQGLRGTHMENAYDFYKPNLASEYPLVDGKLSIQCYLRALDRCYAAYRKKIQNQWKQAGNNQPFTLDDVQYMIFHTPFCKMVQKSLARLMFNDFLSSSS--DKQNNLYKGLEAFRGLKLEETYTNKDVDKALLKASLDMFNQKTKASLYLSTNNGNMYTSSLYGCLASLLSHHSAQELAGSRIGAFSYGSGLAASFFSFRVSKDASPGSPLEKLVSSVSDLPKRLDSRRRMSPEEFTEIMNQREQFYHKVNFSPPGDTSNLFPGTWYLERVDEMHRRKY 503          
BLAST of 3-hydroxy-3-methylglutaryl coenzyme A synthase vs. Ensembl Mouse
Match: Hmgcs1 (3-hydroxy-3-methylglutaryl-Coenzyme A synthase 1 [Source:MGI Symbol;Acc:MGI:107592])

HSP 1 Score: 388.267 bits (996), Expect = 3.255e-129
Identity = 213/453 (47.02%), Postives = 300/453 (66.23%), Query Frame = 1
Query:   10 DIGIKAVEIYFPNTCIDQKDLEESDNC-LGKYTVGLGQIKMGVCSDLEDINSIALTVTKQLLENNFIDPNDIGFLSVGTETLIDKSKSTKTVLMELFEKHGNTDIQGVDEKNACFGGTASLFAALDWLESSNCDGRLXXXXXXXXXXXXXXXXRCTGGAGAVAMLLGPNAPLIFDKGIRSHHMSHQWDFYKPKLDSEYPVYDGQLSIISYQKSIDKCFQLYKKKCLNKGLINQSMILFREN--YYFCFHSPYTKLVEKSFARLVFNDIKDNPDIVEQFNEQLEDIKPFLHLNIENTYGNRDFDLSFLKFSDTLIKDKLRPGVLMAQNNGNMYTASLYGSLISVLIQTPIEELVGSRIVLFSYGSGLASCMFSLMITENKM---KLSEIKDSLNKIVDNLKNRIILSYKEFEDFLARRSSINCKCNVKPSTELSYLRSGTFYLSEIDEKYRRKY 1350
            D+GI A+EIYFP+  +DQ +LE+ D    GKYT+GLGQ +MG C+D EDINS+ LTV ++L+E + +  + IG L VGTET+IDKSKS K+ LM+LFE+ GNTDI+G+D  NAC+GGTA++F A++W+ESS+ DGR A+VVA DIAIYA   AR TGG GAVA+L+GPNAPLIFD+G+R  HM H +DFYKP + SEYPV DG+LSI  Y  ++D+C+ +Y+KK   +         F  N   +  FHSPY KLV+KS AR+  ND  ++ +     N     ++ F  + +E+TY +RD + +F+K S  L   K +  +L++  NGNMYT+S+YGSL SVL Q   ++L G R+ +FSYGSGLA+ ++SL +T++      L +I  SL  +   L +R  ++   F + +  R   +   N  P   +  L  GT+YL  +DEK+RR Y
Sbjct:   16 DVGIVALEIYFPSQYVDQAELEKYDGVDAGKYTIGLGQARMGFCTDREDINSLCLTVVQKLMERHSLSYDCIGRLEVGTETIIDKSKSVKSNLMQLFEESGNTDIEGIDTTNACYGGTAAVFNAVNWVESSSWDGRYALVVAGDIAIYATGNARPTGGVGAVALLIGPNAPLIFDRGLRGTHMQHAYDFYKPDMLSEYPVVDGKLSIQCYLSALDRCYSVYRKKIRAQWQKEGKDKDFTLNDFGFMIFHSPYCKLVQKSLARMFLNDFLNDQN--RDKNSIYSGLEAFGDVKLEDTYFDRDVEKAFMKASSELFNQKTKASLLVSNQNGNMYTSSVYGSLASVLAQYSPQQLAGKRVGVFSYGSGLAATLYSLKVTQDATPGSALDKITASLCDLKSRLDSRTCVAPDVFAENMKLREDTHHLANYIPQCSIDSLFEGTWYLVRVDEKHRRTY 466          
BLAST of 3-hydroxy-3-methylglutaryl coenzyme A synthase vs. Ensembl Mouse
Match: Hmgcs1 (3-hydroxy-3-methylglutaryl-Coenzyme A synthase 1 [Source:MGI Symbol;Acc:MGI:107592])

HSP 1 Score: 388.267 bits (996), Expect = 3.255e-129
Identity = 213/453 (47.02%), Postives = 300/453 (66.23%), Query Frame = 1
Query:   10 DIGIKAVEIYFPNTCIDQKDLEESDNC-LGKYTVGLGQIKMGVCSDLEDINSIALTVTKQLLENNFIDPNDIGFLSVGTETLIDKSKSTKTVLMELFEKHGNTDIQGVDEKNACFGGTASLFAALDWLESSNCDGRLXXXXXXXXXXXXXXXXRCTGGAGAVAMLLGPNAPLIFDKGIRSHHMSHQWDFYKPKLDSEYPVYDGQLSIISYQKSIDKCFQLYKKKCLNKGLINQSMILFREN--YYFCFHSPYTKLVEKSFARLVFNDIKDNPDIVEQFNEQLEDIKPFLHLNIENTYGNRDFDLSFLKFSDTLIKDKLRPGVLMAQNNGNMYTASLYGSLISVLIQTPIEELVGSRIVLFSYGSGLASCMFSLMITENKM---KLSEIKDSLNKIVDNLKNRIILSYKEFEDFLARRSSINCKCNVKPSTELSYLRSGTFYLSEIDEKYRRKY 1350
            D+GI A+EIYFP+  +DQ +LE+ D    GKYT+GLGQ +MG C+D EDINS+ LTV ++L+E + +  + IG L VGTET+IDKSKS K+ LM+LFE+ GNTDI+G+D  NAC+GGTA++F A++W+ESS+ DGR A+VVA DIAIYA   AR TGG GAVA+L+GPNAPLIFD+G+R  HM H +DFYKP + SEYPV DG+LSI  Y  ++D+C+ +Y+KK   +         F  N   +  FHSPY KLV+KS AR+  ND  ++ +     N     ++ F  + +E+TY +RD + +F+K S  L   K +  +L++  NGNMYT+S+YGSL SVL Q   ++L G R+ +FSYGSGLA+ ++SL +T++      L +I  SL  +   L +R  ++   F + +  R   +   N  P   +  L  GT+YL  +DEK+RR Y
Sbjct:   16 DVGIVALEIYFPSQYVDQAELEKYDGVDAGKYTIGLGQARMGFCTDREDINSLCLTVVQKLMERHSLSYDCIGRLEVGTETIIDKSKSVKSNLMQLFEESGNTDIEGIDTTNACYGGTAAVFNAVNWVESSSWDGRYALVVAGDIAIYATGNARPTGGVGAVALLIGPNAPLIFDRGLRGTHMQHAYDFYKPDMLSEYPVVDGKLSIQCYLSALDRCYSVYRKKIRAQWQKEGKDKDFTLNDFGFMIFHSPYCKLVQKSLARMFLNDFLNDQN--RDKNSIYSGLEAFGDVKLEDTYFDRDVEKAFMKASSELFNQKTKASLLVSNQNGNMYTSSVYGSLASVLAQYSPQQLAGKRVGVFSYGSGLAATLYSLKVTQDATPGSALDKITASLCDLKSRLDSRTCVAPDVFAENMKLREDTHHLANYIPQCSIDSLFEGTWYLVRVDEKHRRTY 466          
BLAST of 3-hydroxy-3-methylglutaryl coenzyme A synthase vs. UniProt/SwissProt
Match: sp|P54869|HMCS2_MOUSE (Hydroxymethylglutaryl-CoA synthase, mitochondrial OS=Mus musculus OX=10090 GN=Hmgcs2 PE=1 SV=2)

HSP 1 Score: 396.356 bits (1017), Expect = 1.011e-131
Identity = 214/453 (47.24%), Postives = 296/453 (65.34%), Query Frame = 1
Query:   10 DIGIKAVEIYFPNTCIDQKDLEESDNC-LGKYTVGLGQIKMGVCSDLEDINSIALTVTKQLLENNFIDPNDIGFLSVGTETLIDKSKSTKTVLMELFEKHGNTDIQGVDEKNACFGGTASLFAALDWLESSNCDGRLXXXXXXXXXXXXXXXXRCTGGAGAVAMLLGPNAPLIFDKGIRSHHMSHQWDFYKPKLDSEYPVYDGQLSIISYQKSIDKCFQLYKKKCLN--KGLINQSMILFRENYYFCFHSPYTKLVEKSFARLVFNDIKDNPDIVEQFNEQLEDIKPFLHLNIENTYGNRDFDLSFLKFSDTLIKDKLRPGVLMAQNNGNMYTASLYGSLISVLIQTPIEELVGSRIVLFSYGSGLASCMFSLMITENKMKLSEIKDSLNKIVD---NLKNRIILSYKEFEDFLARRSSINCKCNVKPSTELSYLRSGTFYLSEIDEKYRRKY 1350
            D+GI A+E+YFP   +DQ DLE+ +N   GKYTVGLGQ +MG CS  EDINS+ LTV ++L+E   +  + +G L VGTET+IDKSK+ KTVLMELF+  GNTDI+G+D  NAC+GGTASLF A +W+ESS  DGR A+VV  DIA+Y    AR TGGAGAVAML+GP APL+ ++G+R  HM + +DFYKP L SEYP+ DG+LSI  Y +++D+C+  Y+KK  N  K   N       +  Y  FH+P+ K+V+KS ARL+FND   +    ++ N   + ++ F  L +E TY N+D D + LK S  +   K +  + ++ NNGNMYT+SLYG L S+L     +EL GSRI  FSYGSGLA+  FS  ++++    S ++  ++ + D    L +R  +S +EF + + +R     K N  P  + S L  GT+YL  +DE +RRKY
Sbjct:   53 DVGILALEVYFPAQYVDQTDLEKFNNVEAGKYTVGLGQTRMGFCSVQEDINSLCLTVVQRLMERTKLPWDAVGRLEVGTETIIDKSKAVKTVLMELFQDSGNTDIEGIDTTNACYGGTASLFNAANWMESSYWDGRYALVVCGDIAVYPSGNARPTGGAGAVAMLIGPKAPLVLEQGLRGTHMENAYDFYKPNLASEYPLVDGKLSIQCYLRALDRCYAAYRKKIQNQWKQAGNNQPFTLDDVQYMIFHTPFCKMVQKSLARLMFNDFLSSSS--DKQNNLYKGLEAFRGLKLEETYTNKDVDKALLKASLDMFNQKTKASLYLSTNNGNMYTSSLYGCLASLLSHHSAQELAGSRIGAFSYGSGLAASFFSFRVSKDASPGSPLEKLVSSVSDLPKRLDSRRRMSPEEFTEIMNQREQFYHKVNFSPPGDTSNLFPGTWYLERVDEMHRRKY 503          
BLAST of 3-hydroxy-3-methylglutaryl coenzyme A synthase vs. UniProt/SwissProt
Match: sp|P22791|HMCS2_RAT (Hydroxymethylglutaryl-CoA synthase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Hmgcs2 PE=1 SV=1)

HSP 1 Score: 394.43 bits (1012), Expect = 5.407e-131
Identity = 212/453 (46.80%), Postives = 295/453 (65.12%), Query Frame = 1
Query:   10 DIGIKAVEIYFPNTCIDQKDLEESDNC-LGKYTVGLGQIKMGVCSDLEDINSIALTVTKQLLENNFIDPNDIGFLSVGTETLIDKSKSTKTVLMELFEKHGNTDIQGVDEKNACFGGTASLFAALDWLESSNCDGRLXXXXXXXXXXXXXXXXRCTGGAGAVAMLLGPNAPLIFDKGIRSHHMSHQWDFYKPKLDSEYPVYDGQLSIISYQKSIDKCFQLYKKKCLN--KGLINQSMILFRENYYFCFHSPYTKLVEKSFARLVFNDIKDNPDIVEQFNEQLEDIKPFLHLNIENTYGNRDFDLSFLKFSDTLIKDKLRPGVLMAQNNGNMYTASLYGSLISVLIQTPIEELVGSRIVLFSYGSGLASCMFSLMITENKMKLSEIKDSLNKIVD---NLKNRIILSYKEFEDFLARRSSINCKCNVKPSTELSYLRSGTFYLSEIDEKYRRKY 1350
            D+GI A+E+YFP   +DQ DLE+ +N   GKYTVGLGQ +MG CS  EDINS+ LTV ++L+E   +  + +G L VGTET+IDKSK+ KTVLMELF+  GNTDI+G+D  NAC+GGTASLF A +W+ESS  DGR A+VV  DIA+Y     R TGGAGAVAML+GP APL+ ++G+R  HM + +DFYKP L SEYP+ DG+LSI  Y +++D+C+  Y++K  N  K   N       +  Y  FH+P+ K+V+KS ARL+FND   +    ++ N   + ++ F  L +E TY N+D D + LK S  +   K +  + ++ NNGNMYT+SLYG L S+L     +EL GSRI  FSYGSGLA+  FS  ++++    S ++  ++ + D    L +R  +S +EF + + +R     K N  P  + S L  GT+YL  +DE +RRKY
Sbjct:   53 DVGILALEVYFPAQYVDQTDLEKFNNVEAGKYTVGLGQTRMGFCSVQEDINSLCLTVVQRLMERTKLPWDAVGRLEVGTETIIDKSKAVKTVLMELFQDSGNTDIEGIDTTNACYGGTASLFNAANWMESSYWDGRYALVVCGDIAVYPSGNPRPTGGAGAVAMLIGPKAPLVLEQGLRGTHMENAYDFYKPNLASEYPLVDGKLSIQCYLRALDRCYAAYRRKIQNQWKQAGNNQPFTLDDVQYMIFHTPFCKMVQKSLARLMFNDFLSSSS--DKQNNLYKGLEAFKGLKLEETYTNKDVDKALLKASLDMFNKKTKASLYLSTNNGNMYTSSLYGCLASLLSHHSAQELAGSRIGAFSYGSGLAASFFSFRVSKDASPGSPLEKLVSSVSDLPKRLDSRRRMSPEEFTEIMNQREQFYHKVNFSPPGDTSNLFPGTWYLERVDEMHRRKY 503          
BLAST of 3-hydroxy-3-methylglutaryl coenzyme A synthase vs. UniProt/SwissProt
Match: sp|P54868|HMCS2_HUMAN (Hydroxymethylglutaryl-CoA synthase, mitochondrial OS=Homo sapiens OX=9606 GN=HMGCS2 PE=1 SV=1)

HSP 1 Score: 391.734 bits (1005), Expect = 7.250e-130
Identity = 214/454 (47.14%), Postives = 297/454 (65.42%), Query Frame = 1
Query:   10 DIGIKAVEIYFPNTCIDQKDLEESDNC-LGKYTVGLGQIKMGVCSDLEDINSIALTVTKQLLENNFIDPNDIGFLSVGTETLIDKSKSTKTVLMELFEKHGNTDIQGVDEKNACFGGTASLFAALDWLESSNCDGRLXXXXXXXXXXXXXXXXRCTGGAGAVAMLLGPNAPLIFDKGIRSHHMSHQWDFYKPKLDSEYPVYDGQLSIISYQKSIDKCFQLYKKKCLNKGLINQSMILFREN--YYFCFHSPYTKLVEKSFARLVFND-IKDNPDIVEQFNEQLEDIKPFLHLNIENTYGNRDFDLSFLKFSDTLIKDKLRPGVLMAQNNGNMYTASLYGSLISVLIQTPIEELVGSRIVLFSYGSGLASCMFSLMITENKM---KLSEIKDSLNKIVDNLKNRIILSYKEFEDFLARRSSINCKCNVKPSTELSYLRSGTFYLSEIDEKYRRKY 1350
            D+GI A+E+YFP   +DQ DLE+ +N   GKYTVGLGQ +MG CS  EDINS+ LTV ++L+E   +  + +G L VGTET+IDKSK+ KTVLMELF+  GNTDI+G+D  NAC+GGTASLF A +W+ESS+ DGR A+VV  DIA+Y    AR TGGAGAVAML+GP APL  ++G+R  HM + +DFYKP L SEYP+ DG+LSI  Y +++D+C+  Y+KK  N+     S   F  +   Y  FH+P+ K+V+KS ARL+FND +  + D      + LE    F  L +E+TY N+D D + LK S  +   K +  + ++ +NGNMYT+SLYG L S+L     +EL GSRI  FSYGSGLA+  FS  ++++      L ++  S + +   L +R  +S +EF + + +R     K N  P  + + L  GT+YL  +DE++RRKY
Sbjct:   53 DVGILALEVYFPAQYVDQTDLEKYNNVEAGKYTVGLGQTRMGFCSVQEDINSLCLTVVQRLMERIQLPWDSVGRLEVGTETIIDKSKAVKTVLMELFQDSGNTDIEGIDTTNACYGGTASLFNAANWMESSSWDGRYAMVVCGDIAVYPSGNARPTGGAGAVAMLIGPKAPLALERGLRGTHMENVYDFYKPNLASEYPIVDGKLSIQCYLRALDRCYTSYRKKIQNQWKQAGSDRPFTLDDLQYMIFHTPFCKMVQKSLARLMFNDFLSASSDTQTSLYKGLE---AFGGLKLEDTYTNKDLDKALLKASQDMFDKKTKASLYLSTHNGNMYTSSLYGCLASLLSHHSAQELAGSRIGAFSYGSGLAASFFSFRVSQDAAPGSPLDKLVSSTSDLPKRLASRKCVSPEEFTEIMNQREQFYHKVNFSPPGDTNSLFPGTWYLERVDEQHRRKY 503          
BLAST of 3-hydroxy-3-methylglutaryl coenzyme A synthase vs. UniProt/SwissProt
Match: sp|P23228|HMCS1_CHICK (Hydroxymethylglutaryl-CoA synthase, cytoplasmic OS=Gallus gallus OX=9031 GN=HMGCS1 PE=1 SV=1)

HSP 1 Score: 391.349 bits (1004), Expect = 1.507e-129
Identity = 216/453 (47.68%), Postives = 298/453 (65.78%), Query Frame = 1
Query:   10 DIGIKAVEIYFPNTCIDQKDLEESDNC-LGKYTVGLGQIKMGVCSDLEDINSIALTVTKQLLENNFIDPNDIGFLSVGTETLIDKSKSTKTVLMELFEKHGNTDIQGVDEKNACFGGTASLFAALDWLESSNCDGRLXXXXXXXXXXXXXXXXRCTGGAGAVAMLLGPNAPLIFDKGIRSHHMSHQWDFYKPKLDSEYPVYDGQLSIISYQKSIDKCFQLYKKKCLNKGLINQSMILFREN--YYFCFHSPYTKLVEKSFARLVFNDIKDNPDIVEQFNEQLEDIKPFLHLNIENTYGNRDFDLSFLKFSDTLIKDKLRPGVLMAQNNGNMYTASLYGSLISVLIQTPIEELVGSRIVLFSYGSGLASCMFSLMITENKM---KLSEIKDSLNKIVDNLKNRIILSYKEFEDFLARRSSINCKCNVKPSTELSYLRSGTFYLSEIDEKYRRKY 1350
            D+GI A+EIYFP+  +DQ +LE+ D    GKYT+GLGQ KMG CSD EDINS+ LTV ++L+E N +  + IG L VGTET+IDKSKS KTVLM+LFE+ GNTD++G+D  NAC+GGTA+LF A++W+ESS+ DGR A+VVA DIA+YA   AR TGGAGAVAML+G NAPLIF++G+R  HM H +DFYKP + SEYPV DG+LSI  Y  ++D+C+ +Y+ K   +     +   F  N   +  FHSPY KLV+KS ARL+ ND   + +  E  N     ++ F  + +E+TY +RD + +F+K S  L   K +  +L++  NGNMYT S+YG L S+L Q   E L G RI  FSYGSG A+ ++S+ +T++      L +I  SL+ +   L +R  ++   F + +  R   +   N  P   +  L  GT+YL  +DEK+RR Y
Sbjct:   16 DVGIVALEIYFPSQYVDQTELEKYDGVDAGKYTIGLGQSKMGFCSDREDINSLCLTVVQKLMERNSLSYDCIGRLEVGTETIIDKSKSVKTVLMQLFEESGNTDVEGIDTTNACYGGTAALFNAINWIESSSWDGRYALVVAGDIAVYATGNARPTGGAGAVAMLVGSNAPLIFERGLRGTHMQHAYDFYKPDMVSEYPVVDGKLSIQCYLSALDRCYSVYRNKIHAQWQKEGTDRGFTLNDFGFMIFHSPYCKLVQKSVARLLLNDFLSDQN-AETANGVFSGLEAFRDVKLEDTYFDRDVEKAFMKASAELFNQKTKASLLVSNQNGNMYTPSVYGCLASLLAQYSPEHLAGQRISEFSYGSGFAATLYSIRVTQDATPGSALDKITASLSDLKARLDSRKCIAPDVFAENMKIRQETHHLANYIPQCSVEDLFEGTWYLVRVDEKHRRTY 467          
BLAST of 3-hydroxy-3-methylglutaryl coenzyme A synthase vs. UniProt/SwissProt
Match: sp|P54961|HMCS1_BLAGE (Hydroxymethylglutaryl-CoA synthase 1 OS=Blattella germanica OX=6973 GN=HMGCS-1 PE=2 SV=1)

HSP 1 Score: 386.726 bits (992), Expect = 1.089e-128
Identity = 217/456 (47.59%), Postives = 297/456 (65.13%), Query Frame = 1
Query:   10 DIGIKAVEIYFPNTCIDQKDLEESDNC-LGKYTVGLGQIKMGVCSDLEDINSIALTVTKQLLENNFIDPNDIGFLSVGTETLIDKSKSTKTVLMELFEKHGNTDIQGVDEKNACFGGTASLFAALDWLESSNCDGRLXXXXXXXXXXXXXXXXRCTGGAGAVAMLLGPNAPLIFDKGIRSHHMSHQWDFYKPKLDSEYPVYDGQLSIISYQKSIDKCFQLYKKKCLNKGLINQSMILFRENYYFCFHSPYTKLVEKSFARLVFNDIKDNPDIVEQFNEQLEDIKPFLHLNIENTYGNRDFDLSFLKFSDTLIKDKLRPGVLMAQNNGNMYTASLYGSLISVLIQTPIEELVGSRIVLFSYGSGLASCMFSLMITENKMKLSEIKDSLNKIVDNLKN-------RIILSYKEFEDFLARRSSINCKCNVKPSTELSYLRSGTFYLSEIDEKYRRKYQ 1353
            D+GI A+E+ FP+  +DQ DLE  DN   GKYTVGLGQ +MG C+D EDINS+ LTV  +L+E   I  + IG L VGTETL+DKSKS KTVLM+LF+   NTDI+GVD  NAC+GGT++LF A+ W+ESS+ DGR A+VVA DIA+YA+ +AR TGGAGAVAML+G NAPL+FD+G+RS HM H +DFYKP L S YP  DG+LSI  Y  ++D C+QLY  K   +  + +   + R +    FH+PY KLV+KS ARLV ND     +  E+   +   ++    + +E+TY +R+ + + + +S  + ++K +P +L+A   GNMYT SLYG L+S+L+    +EL G R+ LFSYGSGLAS MFSL I+ +    +  K SL ++V NL +       R  +S +EF   +  R   + K    P   +  L  GT+YL  +D  YRR Y+
Sbjct:    5 DVGIVALELIFPSQYVDQVDLEVYDNVSAGKYTVGLGQARMGFCTDREDINSLCLTVVSRLMERWSIPYSQIGRLEVGTETLLDKSKSVKTVLMQLFKD--NTDIEGVDTVNACYGGTSALFNAISWVESSSWDGRYALVVAGDIAVYAKGSARPTGGAGAVAMLVGANAPLVFDRGVRSSHMQHAYDFYKPDLSSLYPTVDGKLSIQCYLSALDHCYQLYCSKIQKQ--LGEKFDIERLDAVL-FHAPYCKLVQKSLARLVLNDFVRASE--EERTTKYSSLEALKGVKLEDTYFDREVEKAVMTYSKNMFEEKTKPSLLLANQVGNMYTPSLYGGLVSLLVSKSAQELAGKRVALFSYGSGLASSMFSLRISSD----ASAKSSLQRLVSNLSHIKPQLDLRHKVSPEEFAQTMETREHNHHKAPYTPEGSIDVLFPGTWYLESVDSLYRRSYK 449          
BLAST of 3-hydroxy-3-methylglutaryl coenzyme A synthase vs. TrEMBL
Match: K1PE75 (3-hydroxy-3-methylglutaryl coenzyme A synthase OS=Crassostrea gigas OX=29159 GN=CGI_10002659 PE=3 SV=1)

HSP 1 Score: 429.098 bits (1102), Expect = 2.040e-142
Identity = 229/460 (49.78%), Postives = 315/460 (68.48%), Query Frame = 1
Query:   10 DIGIKAVEIYFPNTCIDQKDLEESDNC-LGKYTVGLGQIKMGVCSDLEDINSIALTVTKQLLENNFIDPNDIGFLSVGTETLIDKSKSTKTVLMELFEKHGNTDIQGVDEKNACFGGTASLFAALDWLESSNCDGRLXXXXXXXXXXXXXXXXRCTGGAGAVAMLLGPNAPLIFDKGIRSHHMSHQWDFYKPKLDSEYPVYDGQLSIISYQKSIDKCFQLYKKKCLNKGLINQSMILFRENYYFCFHSPYTKLVEKSFARLVFNDIKDNPDIVEQFNEQLEDIKPFLHLNIENTYGNRDFDLSFLKFSDTLIKDKLRPGVLMAQNNGNMYTASLYGSLISVLIQTPIEELVGSRIVLFSYGSGLASCMFSLMITEN-KMKLSEIKDSLNKIVDNLKNRIILSYKEFEDFLARRSSINCKCNVKPSTELSYLRSGTFYLSEIDEKYRRKY-QIYNSEITNG 1380
            D+GI A+E+YFP+  +DQ +LE  D    GKYT+GLGQ KMG CSD EDINS+ LTV ++L+E N +  NDIG L VGTET+IDKSKSTKTVLM+LFE  GN  ++G+D  NACFGGT++LF A++W+ESS+ DGR A+VVA DIA+YA   ARCTGGAGAVAML+G  APL+FD+G+RS +M H +DFYKP +DSEYPV DG+LS+  Y  ++DKC+Q Y +K    G+  +   L   +  F FHSPY KLV+KSFAR+  ND    P     F+ +   ++   +L +E +Y +RD + + +  S++L   K +P +L+A   GNMYT S+YG L S L+     ELVG RIVLFSYGSGLAS MFS+ IT++   KL+++ ++L+ I  NL+NR+ +S +EF+  +  R   + +    P      L  GT++L+E+D  +RRKY ++   +I NG
Sbjct:   13 DVGIVAMEVYFPSQYVDQAELEIFDKVSTGKYTIGLGQAKMGFCSDREDINSLCLTVVQKLIEKNDLSYNDIGRLEVGTETIIDKSKSTKTVLMQLFESSGNYSVEGIDTTNACFGGTSALFNAVNWIESSSWDGRYALVVAGDIAVYATGNARCTGGAGAVAMLIGSEAPLVFDRGVRSIYMQHAYDFYKPNMDSEYPVVDGKLSVKCYLHALDKCYQAYTEKATQTGIKGKEDNLINSSDAFVFHSPYCKLVQKSFARIFLNDFLQEPS--PDFSGRYAGLESLRNLKLEESYFDRDAEKALMAASNSLFTLKTKPSLLLANQVGNMYTPSVYGGLASYLLSASPSELVGHRIVLFSYGSGLASAMFSIKITKDLGPKLNKLLENLSNITKNLQNRVKVSPEEFDKTMKLREETHNRAPYTPVGSTEGLFPGTWFLTEVDTMHRRKYDRVPLVQIPNG 470          
BLAST of 3-hydroxy-3-methylglutaryl coenzyme A synthase vs. TrEMBL
Match: A0A0B7AGV3 (3-hydroxy-3-methylglutaryl coenzyme A synthase OS=Arion vulgaris OX=1028688 GN=ORF113877 PE=3 SV=1)

HSP 1 Score: 415.231 bits (1066), Expect = 8.795e-137
Identity = 227/463 (49.03%), Postives = 306/463 (66.09%), Query Frame = 1
Query:   10 DIGIKAVEIYFPNTCIDQKDLEESDNC-LGKYTVGLGQIKMGVCSDLEDINSIALTVTKQLLENNFIDPNDIGFLSVGTETLIDKSKSTKTVLMELFEKHGNTDIQGVDEKNACFGGTASLFAALDWLESSNCDGRLXXXXXXXXXXXXXXXXRCTGGAGAVAMLLGPNAPLIFDKGIRSHHMSHQWDFYKPKLDSEYPVYDGQLSIISYQKSIDKCFQLYKKKCLNKGLINQSMILFRENYYFCFHSPYTKLVEKSFARLVFNDI--KDNPDIVEQFNEQLEDIKPFLHLNIENTYGNRDFDLSFLKFSDTLIKDKLRPGVLMAQNNGNMYTASLYGSLISVLIQTPIEELVGSRIVLFSYGSGLASCMFSLMITENKM---KLSEIKDSLNKIVDNLKNRIILSYKEFEDFLARRSSINCKCNVKPSTELSYLRSGTFYLSEIDEKYRRKYQIYNSEITNG 1380
            D+GI A+EIYFP+  +DQ  LE  D    GKYT+GLGQ KMG CSD EDINS+ LTV ++L+E N I+  DIG L VGTET+IDKSKSTK+VLM+LFE  GNTD++GVD  NAC+GGT++LF A++W+ESS+ DGR A+VVA DIA+YA   ARCTGGAGAVAML+GP APLIFD+G+RS HM H +DFYKP + SEYPV DG+LSI  Y  S+D C++ Y  K +  GL   S +   +   F FHSPY KLV+KSFARL+ ND     NPD+  ++      ++ F  + +E TY +R  +++ L  S  L   K +P +L+A   GNMYT SLYG L S +       + G R+V FSYGSGLAS MFS+  T++     +L  + +SL+ +   L++R  +  +EF+  +  R   +     KP   +S L   T++L+E+D  +RRKY   +  +T+G
Sbjct:   16 DVGILALEIYFPSQYVDQTQLESFDEVSAGKYTIGLGQSKMGFCSDREDINSLCLTVVQKLMERNAINYMDIGRLEVGTETIIDKSKSTKSVLMQLFEDSGNTDVEGVDTTNACYGGTSALFNAVNWVESSSWDGRYALVVAGDIAVYATGNARCTGGAGAVAMLIGPEAPLIFDRGVRSSHMQHVYDFYKPDMASEYPVVDGKLSIQCYLHSLDVCYERYTTKSIAAGLRGDSTLDVGDA--FIFHSPYCKLVQKSFARLLLNDFLRNKNPDLAGRY----AGLETFRDVKLEETYFDRSVEVAALSTSQALFDAKTKPTLLVANQVGNMYTPSLYGGLCSYICGLTTASIAGKRVVFFSYGSGLASSMFSMKFTDSNAPGSQLDRLVNSLSDLKHRLESRQCVPPEEFDKIMKLREQTHHLAPYKPVGSVSALFPDTWHLTEVDSMHRRKYTCSHLNLTDG 472          
BLAST of 3-hydroxy-3-methylglutaryl coenzyme A synthase vs. TrEMBL
Match: A0A0J7N5E3 (3-hydroxy-3-methylglutaryl coenzyme A synthase OS=Lasius niger OX=67767 GN=RF55_12678 PE=3 SV=1)

HSP 1 Score: 412.149 bits (1058), Expect = 4.033e-136
Identity = 221/453 (48.79%), Postives = 301/453 (66.45%), Query Frame = 1
Query:   10 DIGIKAVEIYFPNTCIDQKDLEESDNC-LGKYTVGLGQIKMGVCSDLEDINSIALTVTKQLLENNFIDPNDIGFLSVGTETLIDKSKSTKTVLMELFEKHGNTDIQGVDEKNACFGGTASLFAALDWLESSNCDGRLXXXXXXXXXXXXXXXXRCTGGAGAVAMLLGPNAPLIFDKGIRSHHMSHQWDFYKPKLDSEYPVYDGQLSIISYQKSIDKCFQLYKKKCLNKGLINQSMILFRENYYFCFHSPYTKLVEKSFARLVFNDIKDNPDIVEQFNEQLEDIKPFLHLNIENTYGNRDFDLSFLKFSDTLIKDKLRPGVLMAQNNGNMYTASLYGSLISVLIQTPIEELVGSRIVLFSYGSGLASCMFSLMITENKMK---LSEIKDSLNKIVDNLKNRIILSYKEFEDFLARRSSINCK-CNVKPSTELSYLRSGTFYLSEIDEKYRRKYQ 1353
            D+GI+A+E+YFP   +DQ +LE  +    GKYT+GLGQ +MG C+D EDINS+ LTVT +LLE   I+P DIG L VGTET++DKSKS K+VLM+LFE HG TDI+G D  NAC+GGTA+LF A  W+ESS  +G+LA+VVAAD A+Y+  +AR TGGAGA+A+L+GP+APL+FD+G+R+  M H +DFYKP L SEYPV DG+LSI  Y  ++D C+QLY  K   KGL     +       F FHSPY KLV+KSFARL F D  + P      +E+ +D        +E+TY +RD +  F + S T  + K +P +L+A   GNMYT S+Y  L+S+L+  PI EL G++I LFSYGSG  S M+SL +T +      LS+I  +L+ +   L+ R  +S  ++   LA R   NC      P + +  +  GT+YL+++DEKYRR Y+
Sbjct:    5 DVGIRALEVYFPAQYVDQTELEAYNGVSAGKYTIGLGQSRMGFCNDREDINSLCLTVTHRLLERYGIEPRDIGRLEVGTETILDKSKSVKSVLMQLFEPHGCTDIEGADATNACYGGTAALFNAAAWIESSAWNGKLALVVAADNAVYSAGSARPTGGAGAIAILVGPDAPLVFDRGLRASCMRHAYDFYKPDLRSEYPVVDGKLSIQCYLSALDSCYQLYCDKVREKGLAGDDPVTLANFDAFLFHSPYCKLVQKSFARLAFVDFLNTPKERICNDERYKDAVSLHAAKLEDTYFDRDIEKVFTRLSKTDFERKTKPSLLIANQVGNMYTPSVYSGLVSLLLSKPISELAGNKIALFSYGSGFCSSMYSLTVTRDTRDGSGLSKIIAALSYVKPQLEGRHCVSPADYTRVLALREQ-NCHVVPFTPESNIDDMFPGTYYLTQVDEKYRRTYE 456          
BLAST of 3-hydroxy-3-methylglutaryl coenzyme A synthase vs. TrEMBL
Match: A0A3S3NZT7 (3-hydroxy-3-methylglutaryl coenzyme A synthase (Fragment) OS=Dinothrombium tinctorium OX=1965070 GN=B4U79_01775 PE=3 SV=1)

HSP 1 Score: 412.92 bits (1060), Expect = 4.285e-136
Identity = 224/462 (48.48%), Postives = 315/462 (68.18%), Query Frame = 1
Query:   10 DIGIKAVEIYFPNTCIDQKDLEESDNCL-GKYTVGLGQIKMGVCSDLEDINSIALTVTKQLLENNFIDPNDIGFLSVGTETLIDKSKSTKTVLMELFEKHGNTDIQGVDEKNACFGGTASLFAALDWLESSNCDGRLXXXXXXXXXXXXXXXXRCTGGAGAVAMLLGPNAPLIFDKGIRSHHMSHQWDFYKPKLDSEYPVYDGQLSIISYQKSIDKCFQLYKKKCLNKGLINQSMILFRENYYFCFHSPYTKLVEKSFARLVFNDI--KDNPDIVEQFNEQLEDIKPFLHLNIENTYGNRDFDLSFLKFSDTLIKDKLRPGVLMAQNNGNMYTASLYGSLISVLIQTPIEELVGSRIVLFSYGSGLASCMFSLMITENK---MKLSEIKDSLNKIVDNLKNRIILSYKEFEDFLARRSSINCKCNVKPSTELSYLRSGTFYLSEIDEKYRRKYQIYNSEITN 1377
            DIGI AVE+YFP+T +DQ +LE+ D    GKYT+GLGQ +MG CSD EDINS+ LTVTK LLE + + P DIGFL VGTET++DKSKS K+VLM+LF + GN+DI G+D  NAC+GGTA+LF A+DW+ESSN DGR AIVVA DIAIY+E  AR TGGAGAVAML+GPNAPL+ ++G+R+ HM+H +DFYKP LDSEYPV DG+LS++ Y + +DKC+Q+++ K   + +IN+++ L  +      HSPY KLV+KS ARL+FN+   +  PD  + F   LE +K    L +E+TY ++  + +F+K S  L  +K +P + ++   GNMYTASLY  L+S L+  P+ +L G R +LFSYGSG+A+ M+++ IT +      L  +   +  +  ++  R+ +  KEF D L  R          P   +  +  GT+YL+ +D+ YRR+Y+    ++ N
Sbjct:   30 DIGILAVEMYFPSTFVDQSELEQFDGVSSGKYTIGLGQTRMGFCSDREDINSLCLTVTKALLEKSAVSPKDIGFLMVGTETVVDKSKSVKSVLMQLFVESGNSDILGLDTTNACYGGTAALFHAVDWIESSNWDGRYAIVVAGDIAIYSEGNARPTGGAGAVAMLVGPNAPLVLERGMRATHMAHVYDFYKPILDSEYPVVDGKLSVVCYTECVDKCYQVFRNKY--EKVINKTLSL-NDFDGILLHSPYCKLVQKSIARLLFNEFLREPKPDF-QGFYSGLESMK---TLKLEDTYFDKGVESTFVKLSTNLFNEKTKPSLFLSTEVGNMYTASLYSCLVSYLLSKPLNKLEGKRALLFSYGSGMAASMYTIKITNDSSPGSPLDRLYQGIKDVHTHISQRVKVPPKEFVDILKLREGSLHAAPYTPKGTVDNMFPGTYYLTSVDKMYRREYERVPKKVAN 484          
BLAST of 3-hydroxy-3-methylglutaryl coenzyme A synthase vs. TrEMBL
Match: A0A195EGG4 (3-hydroxy-3-methylglutaryl coenzyme A synthase OS=Trachymyrmex cornetzi OX=471704 GN=ALC57_03585 PE=3 SV=1)

HSP 1 Score: 411.764 bits (1057), Expect = 4.637e-136
Identity = 225/455 (49.45%), Postives = 304/455 (66.81%), Query Frame = 1
Query:   10 DIGIKAVEIYFPNTCIDQKDLEESDN-CLGKYTVGLGQIKMGVCSDLEDINSIALTVTKQLLENNFIDPNDIGFLSVGTETLIDKSKSTKTVLMELFEKHGNTDIQGVDEKNACFGGTASLFAALDWLESSNCDGRLXXXXXXXXXXXXXXXXRCTGGAGAVAMLLGPNAPLIFDKGIRSHHMSHQWDFYKPKLDSEYPVYDGQLSIISYQKSIDKCFQLYKKKCLNKGLINQSMILFRENYYFCFHSPYTKLVEKSFARLVFNDIKDNPDIVEQFNEQLEDIKPFLHLNIENTYGNRDFDLSFLKFSDTLIKDKLRPGVLMAQNNGNMYTASLYGSLISVLIQTPIEELVGSRIVLFSYGSGLASCMFSLMI---TENKMKLSEIKDSLNKIVDNLKNRIILSYKEFEDFLARRSSINCKCNVKPSTELSYLR---SGTFYLSEIDEKYRRKYQ 1353
            D+GI+A+E+YFP   ++QK+LE  D    GKYT+GLGQ +MG C+D EDINS+ LTVT +LLE   I P DIG L VGTET+IDKSKS KTVLM+LFE HG TDI+G D  NAC+GGTA+LF A+ W+ESS  DGR A+VVAAD A+Y+  +AR TGGAGA+AML+GP+APL+FD+G+R+  M H +DFYKP + SEYP  DG+LSI  Y  S+D C+QLY++K   K      + L   +    FHSPY KLV+KSFARL F D  + P+   Q  +  +D   F    +E+TY  +D +  F++ S    + K +P +L+A   GNMYT S+Y  L+S+LI  PI EL G+++ +FSYGSGL S ++SL I   T     LS+I  +L+ +   L+ R  +S K++ + LA R      C+V P T  S +     GTFYL+++DE+YRR Y+
Sbjct:    5 DVGIRALEVYFPAQYVEQKELEVYDGMSAGKYTIGLGQSRMGFCNDREDINSLCLTVTSRLLERYEIKPQDIGRLEVGTETIIDKSKSVKTVLMQLFEPHGCTDIEGADTTNACYGGTAALFNAIAWVESSAWDGRFALVVAADNAVYSTGSARPTGGAGAIAMLVGPDAPLVFDRGLRASCMRHAYDFYKPNMRSEYPTVDGKLSIQCYLSSLDNCYQLYREKVKRKSPGENPVTLTNFDAML-FHSPYCKLVQKSFARLAFIDFLNTPE--NQIPDNYKDAVKFHAAKLEDTYFKQDIEKMFIQLSKADFEQKTQPSLLIANQVGNMYTPSVYSGLVSLLISKPISELAGNKVGIFSYGSGLCSSLYSLTIARDTHEGSGLSKIISALSYVKSQLEGRHCVSPKDYTEVLASRER---NCHVVPFTPQSSIVDMFPGTFYLTQVDEQYRRTYK 453          
BLAST of 3-hydroxy-3-methylglutaryl coenzyme A synthase vs. Ensembl Cavefish
Match: hmgcs1 (hydroxymethylglutaryl-CoA synthase, cytoplasmic-like [Source:NCBI gene;Acc:103042817])

HSP 1 Score: 398.282 bits (1022), Expect = 3.004e-133
Identity = 215/455 (47.25%), Postives = 303/455 (66.59%), Query Frame = 1
Query:   10 DIGIKAVEIYFPNTCIDQKDLEESDNC-LGKYTVGLGQIKMGVCSDLEDINSIALTVTKQLLENNFIDPNDIGFLSVGTETLIDKSKSTKTVLMELFEKHGNTDIQGVDEKNACFGGTASLFAALDWLESSNCDGRLXXXXXXXXXXXXXXXXRCTGGAGAVAMLLGPNAPLIFDKGIRSHHMSHQWDFYKPKLDSEYPVYDGQLSIISYQKSIDKCFQLYKKK----CLNKGLINQSMILFRENYYFCFHSPYTKLVEKSFARLVFNDIKDNPDIVEQFNEQLEDIKPFLHLNIENTYGNRDFDLSFLKFSDTLIKDKLRPGVLMAQNNGNMYTASLYGSLISVLIQTPIEELVGSRIVLFSYGSGLASCMFSLMITENKM---KLSEIKDSLNKIVDNLKNRIILSYKEFEDFLARRSSINCKCNVKPSTELSYLRSGTFYLSEIDEKYRRKY 1350
            D+GI A+E+Y P+  +DQ +LEE D    GKYT+GLGQ +MG CSD EDINS+ LTV +QL+E N +  + +G L VGTET+IDKSKS KTVLM+LFE+ GNTD++G+D  NAC+GGTA+LF A++W+ESS+ DGR A+VVA DIA+YA  +AR TGGAGAVAML+GPNAPL FD+G+R  HM H +DFYKP + SEYPV DG+LSI  Y  ++D+C+ +Y+ K       +GL  +      E  Y  FHSPY KLV+KS ARL+ ND   +P    + +     ++ F  + IE+TY +RD + +F+K S  + + K +  +L++  NGNMYT S+YG L SVL Q   +++ G RI +FSYGSG A+ ++S+ +T++      L ++  SL+ +   L +R  ++   F D +  R   +   N  P   +  L  GT+YL+ +DEK+RR Y
Sbjct:   16 DVGIIAMEVYIPSQYVDQTELEEFDGVGAGKYTIGLGQAQMGFCSDREDINSLCLTVVQQLMERNCLSYDSVGRLEVGTETIIDKSKSVKTVLMQLFEESGNTDVEGIDTTNACYGGTAALFNAVNWVESSSWDGRYALVVAGDIAVYATGSARPTGGAGAVAMLVGPNAPLAFDRGLRGTHMQHAYDFYKPDMVSEYPVVDGKLSIQCYLSALDRCYSVYRNKIQAQWQREGL--ERNFNLDEFGYMVFHSPYCKLVQKSLARLLLNDFLYHPSPNTE-SGPFSGLEAFRDVKIEDTYFDRDVEKAFMKASAEMFEQKTKASLLISNQNGNMYTPSVYGCLASVLAQHTPQQVAGQRIGVFSYGSGFAATLYSIKVTQDATPGSALDKLVSSLSDLKARLDSRRKVAPGVFADNMKLREDTHHLANYIPQGPVDELFPGTWYLTRVDEKHRRYY 467          
BLAST of 3-hydroxy-3-methylglutaryl coenzyme A synthase vs. Ensembl Cavefish
Match: hmgcs1 (hydroxymethylglutaryl-CoA synthase, cytoplasmic-like [Source:NCBI gene;Acc:103042817])

HSP 1 Score: 397.897 bits (1021), Expect = 4.597e-133
Identity = 215/455 (47.25%), Postives = 303/455 (66.59%), Query Frame = 1
Query:   10 DIGIKAVEIYFPNTCIDQKDLEESDNC-LGKYTVGLGQIKMGVCSDLEDINSIALTVTKQLLENNFIDPNDIGFLSVGTETLIDKSKSTKTVLMELFEKHGNTDIQGVDEKNACFGGTASLFAALDWLESSNCDGRLXXXXXXXXXXXXXXXXRCTGGAGAVAMLLGPNAPLIFDKGIRSHHMSHQWDFYKPKLDSEYPVYDGQLSIISYQKSIDKCFQLYKKK----CLNKGLINQSMILFRENYYFCFHSPYTKLVEKSFARLVFNDIKDNPDIVEQFNEQLEDIKPFLHLNIENTYGNRDFDLSFLKFSDTLIKDKLRPGVLMAQNNGNMYTASLYGSLISVLIQTPIEELVGSRIVLFSYGSGLASCMFSLMITENKMK---LSEIKDSLNKIVDNLKNRIILSYKEFEDFLARRSSINCKCNVKPSTELSYLRSGTFYLSEIDEKYRRKY 1350
            D+GI A+E+Y P+  +DQ +LEE D    GKYT+GLGQ +MG CSD EDINS+ LTV +QL+E N +  + +G L VGTET+IDKSKS KTVLM+LFE+ GNTD++G+D  NAC+GGTA+LF A++W+ESS+ DGR A+VVA DIA+YA  +AR TGGAGAVAML+GPNAPL FD+G+R  HM H +DFYKP + SEYPV DG+LSI  Y  ++D+C+ +Y+ K       +GL  +      E  Y  FHSPY KLV+KS ARL+ ND   +P    + +     ++ F  + IE+TY +RD + +F+K S  + + K +  +L++  NGNMYT S+YG L SVL Q   +++ G RI +FSYGSG A+ ++S+ +T++      L ++  SL+ +   L +R  ++   F D +  R   +   N  P   +  L  GT+YL+ +DEK+RR Y
Sbjct:   23 DVGIIAMEVYIPSQYVDQTELEEFDGVGAGKYTIGLGQAQMGFCSDREDINSLCLTVVQQLMERNCLSYDSVGRLEVGTETIIDKSKSVKTVLMQLFEESGNTDVEGIDTTNACYGGTAALFNAVNWVESSSWDGRYALVVAGDIAVYATGSARPTGGAGAVAMLVGPNAPLAFDRGLRGTHMQHAYDFYKPDMVSEYPVVDGKLSIQCYLSALDRCYSVYRNKIQAQWQREGL--ERNFNLDEFGYMVFHSPYCKLVQKSLARLLLNDFLYHPSPNTE-SGPFSGLEAFRDVKIEDTYFDRDVEKAFMKASAEMFEQKTKASLLISNQNGNMYTPSVYGCLASVLAQHTPQQVAGQRIGVFSYGSGFAATLYSIKVTQDATPGSALDKLVSSLSDLKARLDSRRKVAPGVFADNMKLREDTHHLANYIPQGPVDELFPGTWYLTRVDEKHRRYY 474          
BLAST of 3-hydroxy-3-methylglutaryl coenzyme A synthase vs. Ensembl Yeast
Match: ERG13 (3-hydroxy-3-methylglutaryl-CoA (HMG-CoA) synthase; catalyzes the formation of HMG-CoA from acetyl-CoA and acetoacetyl-CoA; involved in the second step in mevalonate biosynthesis [Source:SGD;Acc:S000004595])

HSP 1 Score: 341.658 bits (875), Expect = 1.862e-112
Identity = 190/455 (41.76%), Postives = 291/455 (63.96%), Query Frame = 1
Query:   10 DIGIKAVEIYFPNTCIDQKDLEESDNC-LGKYTVGLGQIKMGVCSDLEDINSIALTVTKQLLENNFIDPNDIGFLSVGTETLIDKSKSTKTVLMELFEKHGNTDIQGVDEKNACFGGTASLFAALDWLESSNCDGRLXXXXXXXXXXXXXXXXRCTGGAGAVAMLLGPNAPLIFDKGIRSHHMSHQWDFYKPKLDSEYPVYDGQLSIISYQKSIDKCFQLYKKKCLNKGLI-----NQSMILFRENYYFCFHSPYTKLVEKSFARLVFNDIKDNPDIVEQFNEQLEDIKPFLHLNIENTYGNRDFDLSFLKFSDTLIKDKLRPGVLMAQNNGNMYTASLYGSLISVLIQTPIEELVGSRIVLFSYGSGLASCMFSLMITENKMKLSEIKDSLNKIVDNLKNRIILSYKEFEDFLARRSSINCKCNVKPSTELSYLRSGTFYLSEIDEKYRRKYQI 1356
            ++GIK ++IY P  C++Q +LE+ D    GKYT+GLGQ  M   +D EDI S++LTV  +L+++  ID N IG L VGTETLIDKSKS K+VLM+LF +  NTD++G+D  NAC+GGT +LF +L+W+ES+  DGR AIVV  DIAIY + AAR TGGAG VAM +GP+AP++FD  +R+ +M H +DFYKP   SEYP  DG  S+  Y K++D+ ++ Y KK ++KGL+     + ++ + +   Y  FH P  KLV KS+ RL++ND + NP +  + + +L         + + +  +++ + +F+  +    K+++   +++  N GNMYTAS+Y +  S+L     ++L G R+ LFSYGSGLA+ ++S  I  +   + +  D  NK    L  RI  + K++E  +  R + + K N KP   + +L+SG +YL+ ID+K+RR Y +
Sbjct:   48 NVGIKGIQIYIPTQCVNQSELEKFDGVSQGKYTIGLGQTNMSFVNDREDIYSMSLTVLSKLIKSYNIDTNKIGRLEVGTETLIDKSKSVKSVLMQLFGE--NTDVEGIDTLNACYGGTNALFNSLNWIESNAWDGRDAIVVCGDIAIYDKGAARPTGGAGTVAMWIGPDAPIVFD-SVRASYMEHAYDFYKPDFTSEYPYVDGHFSLTCYVKALDQVYKSYSKKAISKGLVSDPAGSDALNVLKYFDYNVFHVPTCKLVTKSYGRLLYNDFRANPQLFPEVDAELAT------RDYDESLTDKNIEKTFVNVAKPFHKERVAQSLIVPTNTGNMYTASVYAAFASLLNYVGSDDLQGKRVGLFSYGSGLAASLYSCKIVGDVQHIIKELDITNK----LAKRITETPKDYEAAIELRENAHLKKNFKPQGSIEHLQSGVYYLTNIDDKFRRSYDV 489          
BLAST of 3-hydroxy-3-methylglutaryl coenzyme A synthase vs. Ensembl Nematostella
Match: EDO36099 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJQ1])

HSP 1 Score: 372.474 bits (955), Expect = 2.587e-124
Identity = 209/455 (45.93%), Postives = 291/455 (63.96%), Query Frame = 1
Query:   10 DIGIKAVEIYFPNTCIDQKDLEESDNCL-GKYTVGLGQIKMGVCSDLEDINSIALTVTKQLLENNFIDPNDIGFLSVGTETLIDKSKSTKTVLMELFEKHGNTDIQGVDEKNACFGGTASLFAALDWLESSNCDGRLXXXXXXXXXXXXXXXXRCTGGAGAVAMLLGPNAPLIFDKGIRSHHMSHQWDFYKPKLDSEYPVYDGQLSIISYQKSIDKCFQLYKKKCLNKGLINQSMILFRENYYFCFHSPYTKLVEKSFARLVFNDIKDNPDIVEQFNEQLEDIKPFLHLNIENTYGN----RDFDLSFLKFSDTLIKDKLRPGVLMAQNNGNMYTASLYGSLISVLIQTPIEELVGSRIVLFSYGSGLASCMFSLMI---TENKMKLSEIKDSLNKIVDNLKNRIILSYKEFEDFLARRSSINCKCNVKPSTELSYLRSGTFYLSEIDEKYRRKY 1350
            ++GI A+E+Y P T + Q+ LEE D    GKYT+GLGQ  MG CSD EDINS+ALTV + LLE   +DPN IG L VGTET+IDKSKS K+VLM+LFE  GNT+I+G+D  NAC+GGT +LF AL W+ESS  DGRLAIVVAADIA+YA   AR +GGAGAVAML+GP+APL+ ++G+R   M H +DFYKP + SEYPV DG+LSI  Y  ++D+C++ + +K     + N+  +   +  Y  FH+P+ K+V+KS AR+   D         + +EQ   + P+  + +  T+ +    ++ + + +K S  +   K RP   +AQ+ GNMYT SLYGSL+S+L   P  +L G RI +FSYGSGLAS MFS+ +   +     L+ +  SL+ +   L  R  +S  +F   L  R   +   +  P   +  L  GT+YL  +D+K+RRKY
Sbjct:   15 NVGILAMELYVPKTYVSQERLEEFDGVSKGKYTIGLGQRGMGFCSDREDINSLALTVVQNLLEKKHLDPNKIGRLEVGTETIIDKSKSVKSVLMQLFEDSGNTEIEGIDTTNACYGGTQALFNALSWIESSAWDGRLAIVVAADIAVYAAGNARSSGGAGAVAMLVGPHAPLVVERGLRGVFMQHAYDFYKPDMTSEYPVVDGRLSIKCYFNAVDQCYKAFTEKTAK--VENKDSVGLEDIDYVAFHTPFCKIVQKSLARMYLADFLKGYRQGTRKDEQ-SLLHPYRDIKLSETFQDENLAKEIEKASVKASQGVFDAKARPCTHVAQDVGNMYTPSLYGSLVSLLNSVPASQLAGKRIGMFSYGSGLASAMFSIRVSPKSSPSSPLTNLVGSLSDVPSRLACRSEVSPSDFVATLELREKTHHASSYVPKGSIHMLFPGTYYLESVDDKFRRKY 466          
BLAST of 3-hydroxy-3-methylglutaryl coenzyme A synthase vs. Ensembl Medaka
Match: hmgcs1 (3-hydroxy-3-methylglutaryl-CoA synthase 1 [Source:NCBI gene;Acc:101172510])

HSP 1 Score: 392.889 bits (1008), Expect = 3.142e-131
Identity = 216/458 (47.16%), Postives = 304/458 (66.38%), Query Frame = 1
Query:   10 DIGIKAVEIYFPNTCIDQKDLEESDN-CLGKYTVGLGQIKMGVCSDLEDINSIALTVTKQLLENNFIDPNDIGFLSVGTETLIDKSKSTKTVLMELFEKHGNTDIQGVDEKNACFGGTASLFAALDWLESSNCDGRLXXXXXXXXXXXXXXXXRCTGGAGAVAMLLGPNAPLIFDKGIRSHHMSHQWDFYKPKLDSEYPVYDGQLSIISYQKSIDKCFQLYKKKCLNKGLINQSMILFR-ENYYF-CFHSPYTKLVEKSFARLVFNDIKDNPDIVEQFN-----EQLEDIKPFLHLNIENTYGNRDFDLSFLKFSDTLIKDKLRPGVLMAQNNGNMYTASLYGSLISVLIQTPIEELVGSRIVLFSYGSGLASCMFSLMITENKMK---LSEIKDSLNKIVDNLKNRIILSYKEFEDFLARRSSINCKCNVKPSTELSYLRSGTFYLSEIDEKYRRKY 1350
            D+GI A+E+YFP+  +DQ +LE+ D    GKYTVGLGQ +MG CSD EDINS+ LTV ++L+E N +  + IG L VGTET+IDKSKS KTV+M+LFE  GNTD++G+D  NAC+GGTA+LF A++W+ESS+ DGR A+VVA DIA+YA  +AR TGGAGAVAML+GPNAPL F++G+R  HM H +DFYKP L SEYPV DG+LSI  Y  ++D+C+ +Y+ K   +     S   F  E++ F  FHSPY KLV+KS ARL+ ND  ++P+   +       +   D+KP      E TY +RD + +F+K S  L + K +  +L++  NGNMYT S+YG L SV+ +    +L G RI +FSYGSG A+ ++SL +T++      L ++  SL+ +   L +R  ++   F D +  R   +   +  P   +  L  GT+YL+ +DEK+RR+Y
Sbjct:   16 DVGIIALELYFPSHFVDQAELEQYDGVAAGKYTVGLGQARMGFCSDREDINSLCLTVVQRLMERNGLSYDSIGRLEVGTETIIDKSKSVKTVIMQLFEDSGNTDVEGIDTTNACYGGTAALFNAVNWVESSSWDGRFALVVAGDIAVYATGSARPTGGAGAVAMLVGPNAPLAFERGLRGTHMQHAYDFYKPDLMSEYPVVDGKLSIECYLSALDRCYSVYRNKIHTQWQREGSDQRFSLEDFGFLVFHSPYCKLVQKSVARLMLNDFLNHPNPNTETGPFTGLDAFRDVKP------EETYFDRDVEKAFMKASADLFERKTKTSLLISNQNGNMYTPSVYGCLASVIAEHSPSQLAGQRIGVFSYGSGFAASLYSLKVTQDHTPGSALDKLVSSLSDLGVRLDSRKKVAPAVFSDSMKLREDTHHLASYVPRGSVDDLFPGTWYLTRVDEKHRREY 467          
BLAST of 3-hydroxy-3-methylglutaryl coenzyme A synthase vs. Ensembl Medaka
Match: hmgcs1 (3-hydroxy-3-methylglutaryl-CoA synthase 1 [Source:NCBI gene;Acc:101172510])

HSP 1 Score: 332.413 bits (851), Expect = 2.902e-108
Identity = 186/458 (40.61%), Postives = 268/458 (58.52%), Query Frame = 1
Query:   10 DIGIKAVEIYFPNTCIDQKDLEESDN-CLGKYTVGLGQIKMGVCSDLEDINSIALTVTKQLLENNFIDPNDIGFLSVGTETLIDKSKSTKTVLMELFEKHGNTDIQGVDEKNACFGGTASLFAALDWLESSNCDGRLXXXXXXXXXXXXXXXXRCTGGAGAVAMLLGPNAPLIFDKGIRSHHMSHQWDFYKPKLDSEYPVYDGQLSIISYQKSIDKCFQLYKKKCLNKGLINQSMILFR-ENYYF-CFHSPYTKLVEKSFARLVFNDIKDNPDIVEQFN-----EQLEDIKPFLHLNIENTYGNRDFDLSFLKFSDTLIKDKLRPGVLMAQNNGNMYTASLYGSLISVLIQTPIEELVGSRIVLFSYGSGLASCMFSLMITENKMK---LSEIKDSLNKIVDNLKNRIILSYKEFEDFLARRSSINCKCNVKPSTELSYLRSGTFYLSEIDEKYRRKY 1350
            D+GI A+E+YFP+  +DQ +LE+ D    GKYTVGLGQ +MG CSD EDINS+ LTV ++L+E N +  + IG L VGTET+IDKSKS KTV+M+LFE  GNTD++G+D  NAC+GGTA+LF A++W+ESS+ DG                                          +R  HM H +DFYKP L SEYPV DG+LSI  Y  ++D+C+ +Y+ K   +     S   F  E++ F  FHSPY KLV+KS ARL+ ND  ++P+   +       +   D+KP      E TY +RD + +F+K S  L + K +  +L++  NGNMYT S+YG L SV+ +    +L G RI +FSYGSG A+ ++SL +T++      L ++  SL+ +   L +R  ++   F D +  R   +   +  P   +  L  GT+YL+ +DEK+RR+Y
Sbjct:   16 DVGIIALELYFPSHFVDQAELEQYDGVAAGKYTVGLGQARMGFCSDREDINSLCLTVVQRLMERNGLSYDSIGRLEVGTETIIDKSKSVKTVIMQLFEDSGNTDVEGIDTTNACYGGTAALFNAVNWVESSSWDG------------------------------------------LRGTHMQHAYDFYKPDLMSEYPVVDGKLSIECYLSALDRCYSVYRNKIHTQWQREGSDQRFSLEDFGFLVFHSPYCKLVQKSVARLMLNDFLNHPNPNTETGPFTGLDAFRDVKP------EETYFDRDVEKAFMKASADLFERKTKTSLLISNQNGNMYTPSVYGCLASVIAEHSPSQLAGQRIGVFSYGSGFAASLYSLKVTQDHTPGSALDKLVSSLSDLGVRLDSRKKVAPAVFSDSMKLREDTHHLASYVPRGSVDDLFPGTWYLTRVDEKHRREY 425          
BLAST of 3-hydroxy-3-methylglutaryl coenzyme A synthase vs. Planmine SMEST
Match: SMESG000010026.1 (SMESG000010026.1)

HSP 1 Score: 812.372 bits (2097), Expect = 0.000e+0
Identity = 412/414 (99.52%), Postives = 412/414 (99.52%), Query Frame = 1
Query:    1 MTIDIGIKAVEIYFPNTCIDQKDLEESDNCLGKYTVGLGQIKMGVCSDLEDINSIALTVTKQLLENNFIDPNDIGFLSVGTETLIDKSKSTKTVLMELFEKHGNTDIQGVDEKNACFGGTASLFAALDWLESSNCDGRLXXXXXXXXXXXXXXXXRCTGGAGAVAMLLGPNAPLIFDKGIRSHHMSHQWDFYKPKLDSEYPVYDGQLSIISYQKSIDKCFQLYKKKCLNKGLINQSMILFRENYYFCFHSPYTKLVEKSFARLVFNDIKDNPDIVEQFNEQLEDIKPFLHLNIENTYGNRDFDLSFLKFSDTLIKDKLRPGVLMAQNNGNMYTASLYGSLISVLIQTPIEELVGSRIVLFSYGSGLASCMFSLMITENKMKLSEIKDSLNKIVDNLKNRIILSYKEFEDFLARR 1242
            MTIDIGIKAVEIYFPNTCIDQKDLEESDNCLGKYTVGLGQIKMGVCSDLEDINSIALTVTKQLLENNFIDPNDIGFLSVGTETLIDKSKSTKTVLMELFEKHGNTDIQGVDEKNACFGGTASLFAALDWLESSNCDGRLAIVVAADIAIYAEKAARCTGGAGAVAMLLGPNAPLIFDKGIRSHHMSHQWDFYKPKLDSEYPVYDGQLSIISYQKSIDKCFQLYKKKCLNKGLINQSMILFRENYYFCFHSPYTKLVEKSFARLVFNDIKDNPDIVEQFNEQLEDIKPFLHLNIENTYGNRDFDLSFLKFSDTLIKDKLRPGVLMAQNNGNMYTASLYGSLISVLIQTPIEELVGSRIVLFSYGSGLASCMFSLMITENKMKLSEIKDSLNKIVDNLKNRIILSYKEFEDFLA  
Sbjct:    1 MTIDIGIKAVEIYFPNTCIDQKDLEESDNCLGKYTVGLGQIKMGVCSDLEDINSIALTVTKQLLENNFIDPNDIGFLSVGTETLIDKSKSTKTVLMELFEKHGNTDIQGVDEKNACFGGTASLFAALDWLESSNCDGRLAIVVAADIAIYAEKAARCTGGAGAVAMLLGPNAPLIFDKGIRSHHMSHQWDFYKPKLDSEYPVYDGQLSIISYQKSIDKCFQLYKKKCLNKGLINQSMILFRENYYFCFHSPYTKLVEKSFARLVFNDIKDNPDIVEQFNEQLEDIKPFLHLNIENTYGNRDFDLSFLKFSDTLIKDKLRPGVLMAQNNGNMYTASLYGSLISVLIQTPIEELVGSRIVLFSYGSGLASCMFSLMITENKMKLSEIKDSLNKIVDNLKNRIILSYKEFEDFLAEE 414          
The following BLAST results are available for this feature:
BLAST of 3-hydroxy-3-methylglutaryl coenzyme A synthase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HMGCS21.510e-13047.143-hydroxy-3-methylglutaryl-CoA synthase 2 [Source:... [more]
HMGCS11.150e-12846.803-hydroxy-3-methylglutaryl-CoA synthase 1 [Source:... [more]
HMGCS11.150e-12846.803-hydroxy-3-methylglutaryl-CoA synthase 1 [Source:... [more]
HMGCS23.539e-11041.413-hydroxy-3-methylglutaryl-CoA synthase 2 [Source:... [more]
HMGCS12.437e-2055.003-hydroxy-3-methylglutaryl-CoA synthase 1 [Source:... [more]
back to top
BLAST of 3-hydroxy-3-methylglutaryl coenzyme A synthase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
hmgs-12.073e-8339.34Hydroxymethylglutaryl-CoA synthase [Source:UniPro... [more]
back to top
BLAST of 3-hydroxy-3-methylglutaryl coenzyme A synthase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hmgs3.551e-13546.96gene:FBgn0010611 transcript:FBtr0340059[more]
Hmgs3.551e-13546.96gene:FBgn0010611 transcript:FBtr0087146[more]
Hmgs3.551e-13546.96gene:FBgn0010611 transcript:FBtr0087147[more]
Hmgs3.551e-13546.96gene:FBgn0010611 transcript:FBtr0087148[more]
Hmgs3.551e-13546.96gene:FBgn0010611 transcript:FBtr0087145[more]
back to top
BLAST of 3-hydroxy-3-methylglutaryl coenzyme A synthase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
hmgcs11.339e-13347.683-hydroxy-3-methylglutaryl-CoA synthase 1 (soluble... [more]
hmgcs11.339e-13347.683-hydroxy-3-methylglutaryl-CoA synthase 1 (soluble... [more]
hmgcs15.153e-9657.303-hydroxy-3-methylglutaryl-CoA synthase 1 (soluble... [more]
hmgcs12.765e-6063.693-hydroxy-3-methylglutaryl-CoA synthase 1 (soluble... [more]
back to top
BLAST of 3-hydroxy-3-methylglutaryl coenzyme A synthase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
hmgcs11.449e-13349.453-hydroxy-3-methylglutaryl-CoA synthase 1 [Source:... [more]
hmgcs12.217e-13349.453-hydroxy-3-methylglutaryl-CoA synthase 1 [Source:... [more]
hmgcs13.430e-13349.453-hydroxy-3-methylglutaryl-CoA synthase 1 [Source:... [more]
back to top
BLAST of 3-hydroxy-3-methylglutaryl coenzyme A synthase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Hmgcs21.445e-13247.243-hydroxy-3-methylglutaryl-Coenzyme A synthase 2 [... [more]
Hmgcs21.445e-13247.243-hydroxy-3-methylglutaryl-Coenzyme A synthase 2 [... [more]
Hmgcs13.255e-12947.023-hydroxy-3-methylglutaryl-Coenzyme A synthase 1 [... [more]
Hmgcs13.255e-12947.023-hydroxy-3-methylglutaryl-Coenzyme A synthase 1 [... [more]
back to top
BLAST of 3-hydroxy-3-methylglutaryl coenzyme A synthase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P54869|HMCS2_MOUSE1.011e-13147.24Hydroxymethylglutaryl-CoA synthase, mitochondrial ... [more]
sp|P22791|HMCS2_RAT5.407e-13146.80Hydroxymethylglutaryl-CoA synthase, mitochondrial ... [more]
sp|P54868|HMCS2_HUMAN7.250e-13047.14Hydroxymethylglutaryl-CoA synthase, mitochondrial ... [more]
sp|P23228|HMCS1_CHICK1.507e-12947.68Hydroxymethylglutaryl-CoA synthase, cytoplasmic OS... [more]
sp|P54961|HMCS1_BLAGE1.089e-12847.59Hydroxymethylglutaryl-CoA synthase 1 OS=Blattella ... [more]
back to top
BLAST of 3-hydroxy-3-methylglutaryl coenzyme A synthase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
K1PE752.040e-14249.783-hydroxy-3-methylglutaryl coenzyme A synthase OS=... [more]
A0A0B7AGV38.795e-13749.033-hydroxy-3-methylglutaryl coenzyme A synthase OS=... [more]
A0A0J7N5E34.033e-13648.793-hydroxy-3-methylglutaryl coenzyme A synthase OS=... [more]
A0A3S3NZT74.285e-13648.483-hydroxy-3-methylglutaryl coenzyme A synthase (Fr... [more]
A0A195EGG44.637e-13649.453-hydroxy-3-methylglutaryl coenzyme A synthase OS=... [more]
back to top
BLAST of 3-hydroxy-3-methylglutaryl coenzyme A synthase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
hmgcs13.004e-13347.25hydroxymethylglutaryl-CoA synthase, cytoplasmic-li... [more]
hmgcs14.597e-13347.25hydroxymethylglutaryl-CoA synthase, cytoplasmic-li... [more]
back to top
BLAST of 3-hydroxy-3-methylglutaryl coenzyme A synthase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 3-hydroxy-3-methylglutaryl coenzyme A synthase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
ERG131.862e-11241.763-hydroxy-3-methylglutaryl-CoA (HMG-CoA) synthase;... [more]
back to top
BLAST of 3-hydroxy-3-methylglutaryl coenzyme A synthase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO360992.587e-12445.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of 3-hydroxy-3-methylglutaryl coenzyme A synthase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
hmgcs13.142e-13147.163-hydroxy-3-methylglutaryl-CoA synthase 1 [Source:... [more]
hmgcs12.902e-10840.613-hydroxy-3-methylglutaryl-CoA synthase 1 [Source:... [more]
back to top
BLAST of 3-hydroxy-3-methylglutaryl coenzyme A synthase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000010026.10.000e+099.52SMESG000010026.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011849 ID=SMED30011849|Name=3-hydroxy-3-methylglutaryl coenzyme A synthase|organism=Schmidtea mediterranea sexual|type=transcript|length=1632bp
ATGACTATCGACATTGGAATAAAAGCTGTTGAGATTTATTTTCCAAATAC
ATGTATAGATCAAAAAGACTTAGAAGAATCTGACAACTGTTTAGGAAAAT
ACACTGTTGGACTGGGTCAAATAAAAATGGGTGTATGTAGTGATTTAGAA
GATATTAATTCTATTGCTTTAACTGTTACTAAGCAGTTATTAGAAAACAA
TTTTATTGATCCTAATGACATTGGTTTCTTATCAGTAGGTACTGAAACTT
TAATAGATAAATCCAAATCTACTAAAACTGTTCTTATGGAACTTTTTGAA
AAACATGGAAATACAGATATTCAAGGAGTGGATGAAAAAAATGCTTGTTT
CGGTGGAACGGCTTCTTTATTTGCAGCACTCGATTGGTTGGAGAGTAGTA
ATTGTGATGGAAGACTGGCTATAGTTGTAGCGGCAGATATTGCTATTTAT
GCTGAAAAAGCAGCTCGTTGTACTGGTGGAGCTGGTGCAGTCGCAATGCT
TCTTGGTCCTAATGCCCCACTGATCTTTGATAAAGGAATAAGATCTCATC
ATATGTCCCATCAATGGGATTTTTACAAACCAAAACTTGATTCAGAATAT
CCTGTTTATGATGGTCAATTGAGCATAATTTCTTATCAAAAGTCCATTGA
TAAATGTTTTCAACTCTATAAGAAGAAATGTCTTAATAAAGGACTTATCA
ATCAGTCAATGATTTTATTCCGAGAAAATTATTATTTTTGTTTTCATTCA
CCTTACACAAAATTAGTTGAGAAGTCATTTGCTCGTCTTGTGTTCAATGA
TATTAAAGATAATCCAGATATCGTTGAACAATTTAATGAGCAATTGGAAG
ACATTAAACCATTTTTACATCTAAATATTGAAAACACCTATGGAAATAGA
GATTTTGATCTTAGTTTTCTCAAATTCAGTGACACTTTGATAAAAGATAA
ACTTCGTCCCGGAGTTTTAATGGCCCAGAATAATGGAAATATGTATACTG
CATCACTGTATGGGAGTCTTATTTCCGTTTTGATTCAAACTCCAATTGAG
GAACTTGTAGGCTCAAGGATAGTTTTATTTTCATATGGTTCTGGACTTGC
ATCTTGCATGTTCTCATTAATGATAACTGAAAACAAGATGAAATTATCCG
AAATAAAAGATAGTTTAAATAAAATTGTCGACAACCTTAAGAATCGGATT
ATTTTAAGCTATAAAGAATTTGAGGATTTCCTGGCAAGAAGAAGTTCTAT
CAATTGCAAATGTAATGTCAAACCTTCAACAGAACTTTCCTACTTAAGGT
CCGGTACATTTTATCTTAGTGAGATTGATGAAAAATATCGACGAAAATAT
CAAATTTACAATAGTGAGATTACAAATGGATATTCACATTATTAAACTAT
TTATTCGTTTGTTATTAATTTATTTTTACTTATTTGATCAAATAAAAATA
TGAATATTGTGCTTTCTTGATTTATTGTGATAATTAAAAATTGTGGTTAA
AAATTCATTATGGCAAAGTTTAGCTTATGATAGGGTGGGTATGAGGAAAA
TCTATAATTTTAATGACCCTGTAATATTATTTCTAATTAGAACCGACATG
CTTGAGTGCATTTATTTTAAATTGAACCAGAC
back to top

protein sequence of SMED30011849-orf-1

>SMED30011849-orf-1 ID=SMED30011849-orf-1|Name=SMED30011849-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=465bp
MTIDIGIKAVEIYFPNTCIDQKDLEESDNCLGKYTVGLGQIKMGVCSDLE
DINSIALTVTKQLLENNFIDPNDIGFLSVGTETLIDKSKSTKTVLMELFE
KHGNTDIQGVDEKNACFGGTASLFAALDWLESSNCDGRLAIVVAADIAIY
AEKAARCTGGAGAVAMLLGPNAPLIFDKGIRSHHMSHQWDFYKPKLDSEY
PVYDGQLSIISYQKSIDKCFQLYKKKCLNKGLINQSMILFRENYYFCFHS
PYTKLVEKSFARLVFNDIKDNPDIVEQFNEQLEDIKPFLHLNIENTYGNR
DFDLSFLKFSDTLIKDKLRPGVLMAQNNGNMYTASLYGSLISVLIQTPIE
ELVGSRIVLFSYGSGLASCMFSLMITENKMKLSEIKDSLNKIVDNLKNRI
ILSYKEFEDFLARRSSINCKCNVKPSTELSYLRSGTFYLSEIDEKYRRKY
QIYNSEITNGYSHY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0006629lipid metabolic process
GO:0006694steroid biosynthetic process
GO:0008202steroid metabolic process
GO:0016126sterol biosynthetic process
GO:0008152metabolic process
GO:0008299isoprenoid biosynthetic process
Vocabulary: molecular function
TermDefinition
GO:0016740transferase activity
GO:0003824catalytic activity
GO:0004421hydroxymethylglutaryl-CoA synthase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000106ciliated epithelial cell
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR016039Thiolase-like
IPR013746HMG_CoA_synt_C_dom
IPR013528HMG_CoA_synth_N