beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3

Overview
Namebeta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3
Smed IDSMED30011842
Length (bp)1109
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 (SMED30011842) t-SNE clustered cells

Violin plots show distribution of expression levels for beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 (SMED30011842) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 (SMED30011842) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 (SMED30011842) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011842

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30011842SMESG000009072.1 SMESG000009005.1 SmedASXL_001294SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
epidermal cellSMED30011842SMESG000009072.1 SMESG000009005.1 dd_Smed_v4_14356_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30011842SMESG000009072.1 SMESG000009005.1 Contig42881newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30011842SMESG000009072.1 SMESG000009005.1 Contig42881uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
whole organismSMED30011842SMESG000009072.1 Contig43172newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
whole organismSMED30011842SMESG000009072.1 Contig43172uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30011842SMESG000009072.1 SMESG000009005.1 dd_Smed_v4_14356_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Human
Match: GCNT2 (glucosaminyl (N-acetyl) transferase 2 (I blood group) [Source:HGNC Symbol;Acc:HGNC:4204])

HSP 1 Score: 143.665 bits (361), Expect = 1.575e-38
Identity = 96/283 (33.92%), Postives = 136/283 (48.06%), Query Frame = 2
Query:    2 YRPWNYYCIHIDKKSSNDFISAIEELVKCINLKSNNTINTKNRVEVEWGTMSVLTAELNCMKELYENFKDWKYFINLSGQEFPLKTNAELVKILKAFKGANNVEGYYKDRRN-------------------DRIPNAKIPFP--IIWYTGSVHITVNHDFVSFVLKSPQSKILLDSLKNQFIPEETYFSTLNYNSILRIPGSFVGGPDENQYHDGKSGGFITRFKNSGQYSCESKYIIRQICIWGVGDLPKLTSVPNLFAHKFREDFQPATLRCLEKWYYEKV 787
            Y P N YC+H+D+K++ +F  A+E+L+ C      N         V +G +S L A+LNC+++L      WKY IN  GQ+FPLKTN E+V+ LK FKG N   G                           R    K P P  +  Y GS ++ ++ +F +FVL  P++  LL   K+ F P+E ++ TLN     RIPG  V G   N    G                C   Y +  ICI+G GDL  L + P+LFA+KF  +  P T+ CLE  + E+ 
Sbjct:  116 YMPQNIYCVHVDEKATTEFKDAVEQLLSCFP----NAFLASKMEPVVYGGISRLQADLNCIRDLSAFEVSWKYVINTCGQDFPLKTNKEIVQYLKGFKGKNITPGVLPPAHAIGRTKYVHQEHLGKELSYVIRTTALKPPPPHNLTIYFGSAYVALSREFANFVLHDPRAVDLLQWSKDTFSPDEHFWVTLN-----RIPG--VPGSMPNASWTGNLRAIKWSDMEDRHGGCHGHY-VHGICIYGNGDLKWLVNSPSLFANKFELNTYPLTVECLELRHRERT 386          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Human
Match: GCNT2 (glucosaminyl (N-acetyl) transferase 2 (I blood group) [Source:HGNC Symbol;Acc:HGNC:4204])

HSP 1 Score: 143.665 bits (361), Expect = 1.575e-38
Identity = 96/283 (33.92%), Postives = 136/283 (48.06%), Query Frame = 2
Query:    2 YRPWNYYCIHIDKKSSNDFISAIEELVKCINLKSNNTINTKNRVEVEWGTMSVLTAELNCMKELYENFKDWKYFINLSGQEFPLKTNAELVKILKAFKGANNVEGYYKDRRN-------------------DRIPNAKIPFP--IIWYTGSVHITVNHDFVSFVLKSPQSKILLDSLKNQFIPEETYFSTLNYNSILRIPGSFVGGPDENQYHDGKSGGFITRFKNSGQYSCESKYIIRQICIWGVGDLPKLTSVPNLFAHKFREDFQPATLRCLEKWYYEKV 787
            Y P N YC+H+D+K++ +F  A+E+L+ C      N         V +G +S L A+LNC+++L      WKY IN  GQ+FPLKTN E+V+ LK FKG N   G                           R    K P P  +  Y GS ++ ++ +F +FVL  P++  LL   K+ F P+E ++ TLN     RIPG  V G   N    G                C   Y +  ICI+G GDL  L + P+LFA+KF  +  P T+ CLE  + E+ 
Sbjct:  116 YMPQNIYCVHVDEKATTEFKDAVEQLLSCFP----NAFLASKMEPVVYGGISRLQADLNCIRDLSAFEVSWKYVINTCGQDFPLKTNKEIVQYLKGFKGKNITPGVLPPAHAIGRTKYVHQEHLGKELSYVIRTTALKPPPPHNLTIYFGSAYVALSREFANFVLHDPRAVDLLQWSKDTFSPDEHFWVTLN-----RIPG--VPGSMPNASWTGNLRAIKWSDMEDRHGGCHGHY-VHGICIYGNGDLKWLVNSPSLFANKFELNTYPLTVECLELRHRERT 386          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Human
Match: GCNT2 (glucosaminyl (N-acetyl) transferase 2 (I blood group) [Source:HGNC Symbol;Acc:HGNC:4204])

HSP 1 Score: 137.117 bits (344), Expect = 3.497e-36
Identity = 92/283 (32.51%), Postives = 144/283 (50.88%), Query Frame = 2
Query:    2 YRPWNYYCIHIDKKSSNDFISAIEELVKCINLKSNNTINTKNRVEVEWGTMSVLTAELNCMKELYENFKDWKYFINLSGQEFPLKTNAELVKILKAFKGANNVEG------------YYKDRRNDR----IPNAKI-----PFPIIWYTGSVHITVNHDFVSFVLKSPQSKILLDSLKNQFIPEETYFSTLNYNSILRIPGSFVGGPDENQYHDGKSGGFITRFKNSGQYSCESKYIIRQICIWGVGDLPKLTSVPNLFAHKFREDFQPATLRCLEKWYYEKV 787
            Y P N YC+H+D+K+  ++  ++ +L+ C     N  I +K    V +  +S L A+LNC+K+L  +   WKY IN  GQ+FPLKTN E+V+ LK FKG N   G            Y      D+    + N  I     P  +  Y G+ ++ +  DFV FVL+  ++  LL   K+ + P+E ++ TL  N +  +PGS    P+ +   + ++  +       G   C   Y +  ICI+G GDL  L + P+LFA+KF  +  P T+ CLE  + E+ 
Sbjct:  118 YMPQNVYCVHVDEKAPAEYKESVRQLLSCFQ---NAFIASKTE-SVVYAGISRLQADLNCLKDLVASEVPWKYVINTCGQDFPLKTNREIVQHLKGFKGKNITPGVLPPDHAIKRTKYVHQEHTDKGGFFVKNTNILKTSPPHQLTIYFGTAYVALTRDFVDFVLRDQRAIDLLQWSKDTYSPDEHFWVTL--NRVSGVPGSM---PNASWTGNLRAIKWSDMEDRHG--GCHGHY-VHGICIYGNGDLKWLVNSPSLFANKFELNTYPLTVECLELRHRERT 388          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Human
Match: GCNT2 (glucosaminyl (N-acetyl) transferase 2 (I blood group) [Source:HGNC Symbol;Acc:HGNC:4204])

HSP 1 Score: 136.346 bits (342), Expect = 8.437e-36
Identity = 93/283 (32.86%), Postives = 140/283 (49.47%), Query Frame = 2
Query:    2 YRPWNYYCIHIDKKSSNDFISAIEELVKCINLKSNNTINTKNRVEVEWGTMSVLTAELNCMKELYENFKDWKYFINLSGQEFPLKTNAELVKILKAFKGANNVEGY-------------------YKDRRNDRIPNAKIPFP--IIWYTGSVHITVNHDFVSFVLKSPQSKILLDSLKNQFIPEETYFSTLNYNSILRIPGSFVGGPDENQYHDGKSGGFITRFKNSGQYSCESKYIIRQICIWGVGDLPKLTSVPNLFAHKFREDFQPATLRCLEKWYYEKV 787
            Y P N YC+H+D+K+++ F  A+++L+ C      N      +  V +G +S L A+LNC+++L  +   WKY IN  GQ+FPLKTN E+V+ LK FKG N   G                    +K+    +    K P P  ++ Y G+ ++ +  DF +FVL+   +  LL   K+ + P+E ++ TLN     RIPG  V G   N    G                C   Y +  ICI+G GDL  L + P+LFA+KF  +  P T+ CLE  + E+ 
Sbjct:  118 YMPQNVYCVHLDQKATDAFKGAVKQLLSCFP----NAFLASKKESVVYGGISRLQADLNCLEDLVASEVPWKYVINTCGQDFPLKTNREIVQYLKGFKGKNITPGVLPPDHAVGRTKYVHQELLNHKNSYVIKTTKLKTPPPHDMVIYFGTAYVALTRDFANFVLQDQLALDLLSWSKDTYSPDEHFWVTLN-----RIPG--VPGSMPNASWTGNLRAIKWSDMEDRHGGCHGHY-VHGICIYGNGDLKWLVNSPSLFANKFELNTYPLTVECLELRHRERT 388          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Human
Match: GCNT2 (glucosaminyl (N-acetyl) transferase 2 (I blood group) [Source:HGNC Symbol;Acc:HGNC:4204])

HSP 1 Score: 136.346 bits (342), Expect = 8.437e-36
Identity = 93/283 (32.86%), Postives = 140/283 (49.47%), Query Frame = 2
Query:    2 YRPWNYYCIHIDKKSSNDFISAIEELVKCINLKSNNTINTKNRVEVEWGTMSVLTAELNCMKELYENFKDWKYFINLSGQEFPLKTNAELVKILKAFKGANNVEGY-------------------YKDRRNDRIPNAKIPFP--IIWYTGSVHITVNHDFVSFVLKSPQSKILLDSLKNQFIPEETYFSTLNYNSILRIPGSFVGGPDENQYHDGKSGGFITRFKNSGQYSCESKYIIRQICIWGVGDLPKLTSVPNLFAHKFREDFQPATLRCLEKWYYEKV 787
            Y P N YC+H+D+K+++ F  A+++L+ C      N      +  V +G +S L A+LNC+++L  +   WKY IN  GQ+FPLKTN E+V+ LK FKG N   G                    +K+    +    K P P  ++ Y G+ ++ +  DF +FVL+   +  LL   K+ + P+E ++ TLN     RIPG  V G   N    G                C   Y +  ICI+G GDL  L + P+LFA+KF  +  P T+ CLE  + E+ 
Sbjct:  118 YMPQNVYCVHLDQKATDAFKGAVKQLLSCFP----NAFLASKKESVVYGGISRLQADLNCLEDLVASEVPWKYVINTCGQDFPLKTNREIVQYLKGFKGKNITPGVLPPDHAVGRTKYVHQELLNHKNSYVIKTTKLKTPPPHDMVIYFGTAYVALTRDFANFVLQDQLALDLLSWSKDTYSPDEHFWVTLN-----RIPG--VPGSMPNASWTGNLRAIKWSDMEDRHGGCHGHY-VHGICIYGNGDLKWLVNSPSLFANKFELNTYPLTVECLELRHRERT 388          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Celegans
Match: gly-1 (GLY-1; GLYcosylation related [Source:UniProtKB/TrEMBL;Acc:G5ECK8])

HSP 1 Score: 115.161 bits (287), Expect = 3.577e-28
Identity = 76/271 (28.04%), Postives = 133/271 (49.08%), Query Frame = 2
Query:    2 YRPWNYYCIHIDKKSSNDFISAIEELVKCINLKSNNTINTKNRVEVEWGTMSVLTAELNCMKELYENFKDWKYFINLSGQEFPLKTNAELVKILKAFKGANNVE-GYYKDRRNDRIPNAKIPFPIIWYTGSVHITVNHDFVSFVLKSPQSKILLDSLKNQFIPEETYFST-LNYNSILRIPGS------------FVGGPDENQYHDGKSGGFITRFKNSG-QYSCESKYIIRQICIWGVGDLPKLTSVPNLFAHKFREDFQPATLRCLEK 769
            Y+P + +CI +D +S N++ S I+ L  C        ++       +WG+  +L     C   L ++ + WKY+  LSG + P++TN E+V+I KA  G+ N +   ++  R   +     P P+  Y  S+ + V  +   +++ SP+ + LL  L   +IP+E+++ST L   ++L +PGS            F   P      +     +I R++  G Q  C  K +    C++GV D+ ++ + P L AHK   +FQPA   C+ K
Sbjct:  150 YQPQHMFCITVDDQSPNEYKSVIQALPSCFP-----NMHVFIGEPSQWGSFGILKNVYTCFNWLSKSKQKWKYYQYLSGTDLPIRTNLEMVRIFKALNGSMNTDVSTFEVDRYKNMEGVLPPMPV--YKSSMSVVVPREGADYLISSPRVQKLLKYLSKTWIPDESFWSTVLGSPALLPVPGSIRVRDILWLRKNFKLRPPYENTVNSIGTSYIGRYQVWGWQKECFGK-VKDFSCVFGVEDIEEIMTRPELVAHKLYLEFQPAAFMCMLK 412          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Celegans
Match: gly-17 (GLYcosylation related [Source:UniProtKB/TrEMBL;Acc:O02315])

HSP 1 Score: 112.849 bits (281), Expect = 9.927e-28
Identity = 74/265 (27.92%), Postives = 131/265 (49.43%), Query Frame = 2
Query:    2 YRPWNYYCIHIDKKSSNDFISAIEELVKCINLKSNNTINTKNRVEVEWGTMSVLTAELNCMKELYENFKDWKYFINLSGQEFPLKTNAELVKILKAFKGANNVE-GYYKDRRNDRIPNAKIPFPIIWYTGSVHITVNHDFVSFVLKSPQSKILLDSLKNQFIPEETYFSTLNYN-SILRIPGSF-VGGPDENQYHDGKSGGFITRFKNSGQYSCESKYIIRQICIWGVGDLPKLTSVPNLFAHKFREDFQPATLRCLEKWYYEKV 787
            Y+P N YCI + + S+  F+  ++EL  C        +    R  ++WG+  ++ +   C++ L     DWKYF  LSG + PLKTN E+V+ILK   G  N+    Y+DR  +     + P P+  +  S+   +     +++  S   + LL+ L+  ++ +E ++ TL  N  +  +PGSF    P  N +     G +++R +   +  C + Y+  + C++G+GD+P L     L AHK   + +P    CL K +  + 
Sbjct:  130 YQPQNEYCIAVGENSAPAFLILLKELANCFP-----NVYFMKRPPIKWGSFEIINSVYGCLEFLSHLKSDWKYFQYLSGVDIPLKTNLEMVRILKRLNGTVNIGISTYEDRLLNGKNKTESPLPL--FKSSLSSLIPRKAANYLSSSSVPQQLLEFLRTTWVADEGFWGTLFGNKDLFNVPGSFNFNDPLTNGW-----GNYVSRHQLWVESECHN-YMKDRSCVFGIGDVPNLMKSRALVAHKLYIESEPEAFFCLLKRHRHRT 381          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Celegans
Match: gly-15 (GLYcosylation related [Source:UniProtKB/TrEMBL;Acc:L8E6J1])

HSP 1 Score: 110.153 bits (274), Expect = 1.233e-26
Identity = 85/278 (30.58%), Postives = 133/278 (47.84%), Query Frame = 2
Query:    2 YRPWNYYCIHIDKKSSNDFISAIEELVKCINLKSNNTINTKNRVEVEWGTMSVLTAELNCMKELYENFKDWKYFINLSGQEFPLKTNAELVKILKAFKGANNVE----GYYKDRRNDRIPNAKIPFPIIWYTGSVHITVNHDFVSFVLKSPQSKILLDSLKNQFIPEETYFSTLNYNSI-LRIPGSF----------------VGGPDENQYHDGKSGGFITRFK---NSGQYSCESKYIIRQICIWGVGDLPKLTSVPNLFAHKFREDFQPATLRCL 763
            Y+P N +C+ +D  SS +FI  +  L +C        I      E+ W    +LT+   C+  L +   DWKYF  LSG + PLK+N E+++ILKA  G+ N E     +Y  R N + P +  P P+  Y  S+  T +    +F++ S +    +D L+     +E+ ++T+  N   L +PG F                +G   ENQ  D  +G +++R++   N     C+  Y  R  C++GV DLP L +   L AHK    +QPA   CL
Sbjct:  126 YQPQNQFCLAVDGNSSVEFIGLVRMLSRCYG-----NIQYFITDEIRWCGYEILTSVFQCVDYLAKLPSDWKYFQYLSGVDAPLKSNLEMIRILKALNGSFNAEILPFEFY--RLNRKRPWSS-PLPL--YKTSLSATFSRKSANFMVNSEKVLEQIDFLRGTTCADESLWATIAGNPKELPMPGGFDAKAWIHKNYRRTRGKLGKYGENQKID--NGYYVSRYQQYVNRAPVKCKG-YYYRLSCVFGVYDLPNLINRHELVAHKLYFSYQPAAFMCL 390          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Celegans
Match: gly-16 (GLY-16; GLYcosylation related [Source:UniProtKB/TrEMBL;Acc:G5EDP7])

HSP 1 Score: 105.145 bits (261), Expect = 5.894e-25
Identity = 74/273 (27.11%), Postives = 131/273 (47.99%), Query Frame = 2
Query:    2 YRPWNYYCIHIDKKSSNDFISAIEELVKCINLKSNNTINTKNRVEVEWGTMSVLTAELNCMKELYENFKDWKYFINLSGQEFPLKTNAELVKILKAFKGANNVE-GYYKDRRNDRIPNAKIPFPIIWYTGSVHITVNHDFVSFVLKSPQSKILLDSLKNQFIPEETYFSTLNYN-SILRIPGSF---------------VGGPDENQYHDGKSGGFITRFKNSGQYSCESKYIIRQICIWGVGDLPKLTSVPNLFAHKFREDFQPATLRCLEK 769
            Y+P N YCI + + S++ F+  +EEL  C        ++   R  + WG+  ++ +  +C+K L     +WKYF  LSG + PLKTN E+V+ILK+  G  NVE   Y++RR       + P P+  +  S+   +     +++  S   + LL+ L+N ++ +E ++ TL  N  +  +PGS                +  P +  ++      +I+R +   +  C + ++    C++G+GD+  L     L AHK     +P    CL K
Sbjct:  120 YQPQNEYCIAVGENSASTFLILLEELSDCFP-----NVHFMKRPPITWGSYEIINSVYDCLKFLSHLKSNWKYFQYLSGVDIPLKTNLEMVRILKSLNGTANVEIKVYENRRLLGQNETESPLPL--FKSSLSSLIPRKAANYLASSSIPQQLLEFLRNTWVADEGFWGTLFGNKGLFDVPGSLNFEEWIYFKENARANLTKPTDGWFY------YISRHQIWFESGCHN-HMKDGSCVFGIGDVSNLLQAKALVAHKLYLTSEPEAYFCLLK 378          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Celegans
Match: gly-19 (GLY-19; GLYcosylation related [Source:UniProtKB/TrEMBL;Acc:G5EBK7])

HSP 1 Score: 104.76 bits (260), Expect = 1.050e-24
Identity = 78/274 (28.47%), Postives = 133/274 (48.54%), Query Frame = 2
Query:    2 YRPWNYYCIHIDKKSSNDFISAIEELVKCINLKSNNTINTKNRVEVEWGTMSVLTAELNCMKELYENFKDWKYFINLSGQEFPLKTNAELVKILKAFKGANNVE--GYYKDRRNDRIPNAKIPFPIIWYTGSVHITVNHDFVSFVLKSPQSKILLDSLKNQFIPEETYFSTLNYN-SILRIPGSFVGGPDENQYHDGKSGGF---------ITRFKNSGQYSCESKYIIRQICIWGVGDLPKLTSVPNLFAHKFREDFQPATLRCLEKWYYEKV 787
            Y P N YCI + + S+  F + + E+  C +      ++   R  + WG+  ++ +  +C++ L     DW+YF  LSG + PLKTN E+V+ILK   G +NVE   Y + R   +  N   P P+  +  S+   +     + +  S  ++ LL+ L N  I +E ++ TL  N     I GS +   D  +Y D ++  F         I+R +      C++ Y+    C++G+GD+P+L +   L AHKF    +P    CL K ++ + 
Sbjct:  137 YHPQNEYCIAVGENSAPIFQNLLREVSTCFS-----NVHFMKRPPISWGSHEIIDSVYDCLEFLSHLETDWRYFQYLSGVDIPLKTNLEMVQILKHLNGTSNVEITNYQQARLTGKNENES-PLPL--FKSSLSAIIPRKAANQLASSNTARKLLEFLWNTEIADEGFWGTLFGNKDQFNISGS-INSKDWMEYRDNQNNIFNPTDGWSYYISRDQIWDPELCKN-YMKDDSCVFGIGDVPRLRTSKALVAHKFYLKSEPEAYFCLLKEHHRRT 400          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Fly
Match: oxt (gene:FBgn0015360 transcript:FBtr0072904)

HSP 1 Score: 81.2629 bits (199), Expect = 2.229e-16
Identity = 77/289 (26.64%), Postives = 125/289 (43.25%), Query Frame = 2
Query:    2 YRPWNYYCIHIDKKSSNDFISAIEELVKCINLKSNNTINTKNRVEVEWGTMSVLTAELNCMKELYENFKDWKYFINLSGQEFPLKTNAELVKILKAFKGANNVEGYYK------------------DRRNDRIPNAKIPFPIIWYTGSVHITVNHDFVSFVLKSPQSKILLDSL----KNQFIPEETYFSTLNYNSILRIPGSFVGGPDENQYHDGKSGGFITRFKNSGQYSCESKYIIRQICIWGVGDL-----PKLTSVPN---LFAHKFREDFQPATLRCLEKWYY 778
            Y P + Y IH+D++    +   +E   K  N++       + R    WG  S+LT  L CM++L ++   W + INLS  +FP+KT  +LV  L A  G N V+G+ +                  D    RI + K+P  I    GS  + ++  FV +V    +   LL +L    ++  +P E++F T+  N+  +   S+V    +N  H       +T +K      C+ K+++   C     D      P+L +       FA KF      A L  LE+W Y
Sbjct:  272 YAPEHVYYIHVDERQDYLYRKLLELESKFPNIRL-----ARKRFSTIWGGASLLTMLLQCMEDLLQSNWHWDFVINLSESDFPVKTLDKLVDFLSANPGRNFVKGHGRETQKFIQKQGLDKTFVECDTHMWRIGDRKLPAGIQVDGGSDWVALSRPFVGYVTHPREDDELLQALLKLFRHTLLPAESFFHTVLRNT--KHCTSYV----DNNLH-------VTNWKRKQGCKCQYKHVV-DWCGCSPNDFKPEDWPRLQATEQKSLFFARKFEPVINQAVLLQLEEWLY 541          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Zebrafish
Match: gcnt7 (glucosaminyl (N-acetyl) transferase family member 7 [Source:ZFIN;Acc:ZDB-GENE-120919-3])

HSP 1 Score: 141.354 bits (355), Expect = 1.306e-37
Identity = 95/285 (33.33%), Postives = 147/285 (51.58%), Query Frame = 2
Query:    2 YRPWNYYCIHIDKKSSNDFISAIEELVKCINLKSNNTINTKNRVEVEWGTMSVLTAELNCMKELYENFKDWKYFINLSGQEFPLKTNAELVKILKA--FKGANNVEG-------------YYKDRRNDRIPNA---KIPFP--IIWYTGSVHITVNHDFVSFVLKSPQSKILLDSLKNQFIPEETYFSTLNYNSILRIPGSFVGGPDENQYHDGKSGGFITRFKNSGQYSCESKYIIRQICIWGVGDLPKLTSVPNLFAHKFREDFQPATLRCLEKWYYEKVERE 796
            Y P N YCIHID+K+S  + S++  L +C      N   +   V+V +   S L A++NCMK+L E+   WK  INL GQ++P++TN ELV+ ++   +K  N   G              Y + +N  +      K P P  +  Y G+ + ++   FV +VL +P +K LL   K+ + P+E Y+ TLN+  I   PGS V G  E      K     +  + +    C+ +Y IR IC++G+GDLP L    ++FA+KF     P  L C+E W+  KV ++
Sbjct:  133 YAPQNVYCIHIDQKASEKYKSSVRNLSRCFP----NVFLSSVNVKVTYAGFSRLQADINCMKDLVESPIQWKKVINLCGQDYPIQTNLELVRYMQTPEWKDRNMTPGIKQPPSMRYRTAFQYVEVKNTHVAQTGRKKGPPPHNLKIYFGTAYYSLTRPFVEYVLDNPVAKDLLSWSKDSYSPDEHYWVTLNH--IKEAPGSNVEGEWEGNVRAVK----WSDQQGTAHQGCKGQY-IRGICVYGIGDLPWLIEKESMFANKFEMASFPEALDCMELWHRHKVLQQ 406          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Zebrafish
Match: gcnt4b (glucosaminyl (N-acetyl) transferase 4b [Source:ZFIN;Acc:ZDB-GENE-091118-69])

HSP 1 Score: 134.035 bits (336), Expect = 4.139e-35
Identity = 93/290 (32.07%), Postives = 141/290 (48.62%), Query Frame = 2
Query:    2 YRPWNYYCIHIDKKSSNDFISAIEELVKCINLKSNNTINTKNRVEVEWGTMSVLTAELNCMKELYENFKDWKYFINLSGQEFPLKTNAELVKILKAFKGANNVEGYYKDRRNDR------IPNAKI----------------PFPIIWYTGSVHITVNHDFVSFVLKSPQSKILLDSLKNQFIPEETYFSTLNYNSILRIPGSFVGGPDENQYHDGKSGGFITRFKNSGQYSCESKYI-------IRQICIWGVGDLPKLTSVPNLFAHKFREDFQPATLRCLEKWYYEK 784
            Y P N YCIH D+KSS DF+ A+  L +CI     N         V++  +S L A+LNC+ +L ++   WKY INL GQ+FPL+TNAELV  LK  KG N VE  +   +N R      + N K                 P+ I  + GS + T++ +FV FV  S  ++  L   ++ F P+E +++TL     +R+PG     P E    +      I++ +     + E +         +R+ICI+G  +L  L +  + FA+K      P  + CLE+   EK
Sbjct:  124 YVPHNIYCIHYDRKSSTDFMLAMNGLARCIP----NVFIASKLERVQYAGISRLRADLNCLSDLLDSEVKWKYVINLCGQDFPLRTNAELVSDLKGLKGRNMVESKWPGAKNRRWSVHHLLKNKKFEFYNTPVSTSDKKRPPPYDIEMFVGSAYFTLSREFVYFVHWSYLARNFLAWSEDTFSPDEHFWATL-----VRVPGV----PGEVPRSEADISELISKTRLVKWSAFEGRLYPRCTGVHVRKICIYGAAELRWLLNYGHWFANKVDPKVDPVLIECLEEKLAEK 400          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Zebrafish
Match: gcnt4b (glucosaminyl (N-acetyl) transferase 4b [Source:ZFIN;Acc:ZDB-GENE-091118-69])

HSP 1 Score: 134.035 bits (336), Expect = 4.173e-35
Identity = 93/290 (32.07%), Postives = 141/290 (48.62%), Query Frame = 2
Query:    2 YRPWNYYCIHIDKKSSNDFISAIEELVKCINLKSNNTINTKNRVEVEWGTMSVLTAELNCMKELYENFKDWKYFINLSGQEFPLKTNAELVKILKAFKGANNVEGYYKDRRNDR------IPNAKI----------------PFPIIWYTGSVHITVNHDFVSFVLKSPQSKILLDSLKNQFIPEETYFSTLNYNSILRIPGSFVGGPDENQYHDGKSGGFITRFKNSGQYSCESKYI-------IRQICIWGVGDLPKLTSVPNLFAHKFREDFQPATLRCLEKWYYEK 784
            Y P N YCIH D+KSS DF+ A+  L +CI     N         V++  +S L A+LNC+ +L ++   WKY INL GQ+FPL+TNAELV  LK  KG N VE  +   +N R      + N K                 P+ I  + GS + T++ +FV FV  S  ++  L   ++ F P+E +++TL     +R+PG     P E    +      I++ +     + E +         +R+ICI+G  +L  L +  + FA+K      P  + CLE+   EK
Sbjct:  142 YVPHNIYCIHYDRKSSTDFMLAMNGLARCIP----NVFIASKLERVQYAGISRLRADLNCLSDLLDSEVKWKYVINLCGQDFPLRTNAELVSDLKGLKGRNMVESKWPGAKNRRWSVHHLLKNKKFEFYNTPVSTSDKKRPPPYDIEMFVGSAYFTLSREFVYFVHWSYLARNFLAWSEDTFSPDEHFWATL-----VRVPGV----PGEVPRSEADISELISKTRLVKWSAFEGRLYPRCTGVHVRKICIYGAAELRWLLNYGHWFANKVDPKVDPVLIECLEEKLAEK 418          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Zebrafish
Match: si:dkeyp-87d8.8 (si:dkeyp-87d8.8 [Source:ZFIN;Acc:ZDB-GENE-041111-161])

HSP 1 Score: 133.65 bits (335), Expect = 1.016e-34
Identity = 94/290 (32.41%), Postives = 139/290 (47.93%), Query Frame = 2
Query:    2 YRPWNYYCIHIDKKSSNDFISAIEELVKCINLKSNNTINTKNRVEVEWGTMSVLTAELNCMKELYENFKDWKYFINLSGQEFPLKTNAELVKILKAFKGANNVEGYYKDRRNDR--------------------IPNAKIPFP--IIWYTGSVHITVNHDFVSFVLKSPQSKILLDSLKNQFIPEETYFSTLNYNSILRIPGSFVGGPDENQYHDGKSGGFITRFKNSGQYSCESKYI-------IRQICIWGVGDLPKLTSVPNLFAHKFREDFQPATLRCLEKWYYEK 784
            Y P N YCIH D+KSS DF+ A+  L +CI     N         V++  +S L A+LNC+ +L ++   WKY INL GQ+FPL+TNAELV  LK  KG N VE  +   +  R                     P  K P P  I  + GS + T++ +FV FV  S  +K  L   ++ F P+E +++TL     +R+PG     P E    +      I++ +     + E +         +R+ICI+G  +L  L +  + FA+K      P  + CLE+   EK
Sbjct:  137 YVPHNIYCIHYDRKSSTDFMLAMNGLARCIP----NVFIASKLERVQYAGISRLRADLNCLSDLLDSEVKWKYVINLCGQDFPLRTNAELVSDLKGLKGRNMVESKWPGGKKIRWSVHHLLKNNDSEYYDFPVSTPEEKPPPPHNIEMFVGSAYFTLSREFVYFVHWSSLAKDFLAWSEDTFSPDEHFWATL-----VRVPGV----PGEVPRSEADISELISKTRLVKWSAFEGRLYPRCTGVHVRKICIYGAAELRWLLNYGHWFANKVDPKVDPVLIECLEEKLAEK 413          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Zebrafish
Match: si:dkeyp-87d8.8 (si:dkeyp-87d8.8 [Source:ZFIN;Acc:ZDB-GENE-041111-161])

HSP 1 Score: 132.88 bits (333), Expect = 1.353e-34
Identity = 92/290 (31.72%), Postives = 141/290 (48.62%), Query Frame = 2
Query:    2 YRPWNYYCIHIDKKSSNDFISAIEELVKCINLKSNNTINTKNRVEVEWGTMSVLTAELNCMKELYENFKDWKYFINLSGQEFPLKTNAELVKILKAFKGANNVEGYYKDRRNDR------IPNAKI----------------PFPIIWYTGSVHITVNHDFVSFVLKSPQSKILLDSLKNQFIPEETYFSTLNYNSILRIPGSFVGGPDENQYHDGKSGGFITRFKNSGQYSCESKYI-------IRQICIWGVGDLPKLTSVPNLFAHKFREDFQPATLRCLEKWYYEK 784
            Y P N YCIH D+KSS DF+ A+  L +C+     N         V++  +S L A+LNC+ +L ++   WKY INL GQ+FPL+TNAELV  LK  KG N VE  +   +N R      + N K                 P+ I  + GS + T++ +FV FV  S  ++  L   ++ F P+E +++TL     +R+PG     P E    +      I++ +     + E +         +R+ICI+G  +L  L +  + FA+K      P  + CLE+   EK
Sbjct:  150 YVPHNIYCIHYDRKSSTDFMLAMNGLARCMP----NVFIASKLERVQYAGISRLRADLNCLSDLLDSEVKWKYVINLCGQDFPLRTNAELVSDLKGLKGRNMVESKWPGAKNRRWSVHHLLKNKKFEFYNTPVSTSDKKRPPPYDIEMFVGSAYFTLSREFVYFVHWSYLARNFLAWSEDTFSPDEHFWATL-----VRVPGV----PGEVPRSEADISELISKTRLVKWSAFEGRLYPRCTGVHVRKICIYGAAELRWLLNYGHWFANKVDPKVDPVLIECLEEKLAEK 426          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Xenopus
Match: gcnt2.2 (glucosaminyl (N-acetyl) transferase 2 (I blood group), gene 2 [Source:NCBI gene;Acc:100038221])

HSP 1 Score: 156.762 bits (395), Expect = 2.256e-43
Identity = 97/274 (35.40%), Postives = 141/274 (51.46%), Query Frame = 2
Query:    2 YRPWNYYCIHIDKKSSNDFISAIEELVKCINLKSNNTINTKNRVEVEWGTMSVLTAELNCMKELYENFKDWKYFINLSGQEFPLKTNAELVKILKAFKGANNVEG--------------YYKDRRNDRIPNAKI-----PFPIIWYTGSVHITVNHDFVSFVLKSPQSKILLDSLKNQFIPEETYFSTLNYNSILRIPGSFVGGPDENQYHDGKSGGFITRFKNSGQYSCESKYIIRQICIWGVGDLPKLTSVPNLFAHKFREDFQPATLRCLE 766
            Y P N YC+H+D+K+S DF+ A++ LV+C      NT        V +G +S L A+LNCMK+L  +   WKY INL GQ+FPLKTN E++  +K+FKG N   G              + +D  N R+   ++     P  I  Y GS ++ +  +F  F+L+  ++  LL   K+ + P+E Y+ TL  N I  +PGS      E Q    K      + K  G Y       +R ICI+G GDL  L +  ++FA+KF     P T+ CLE
Sbjct:  137 YMPQNIYCVHVDEKASADFMQAVDSLVQCFP----NTFLASKMEPVVYGGISRLQADLNCMKDLLASDVQWKYVINLCGQDFPLKTNKEIIHHIKSFKGKNITPGVLPPAHAIPRTKYVHREDIVNSRVVRTRVLKPPPPHNITIYFGSAYVALTREFTRFILEDQRATNLLLWSKDTYSPDEHYWVTL--NRIADVPGSAPDASWEGQLRAVKWKDMKDQEKCHGHY-------VRDICIYGTGDLQWLMNSRSIFANKFEAKSYPPTVECLE 397          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Xenopus
Match: adsl (adenylosuccinate lyase [Source:Xenbase;Acc:XB-GENE-1001539])

HSP 1 Score: 153.68 bits (387), Expect = 1.782e-42
Identity = 95/274 (34.67%), Postives = 142/274 (51.82%), Query Frame = 2
Query:    2 YRPWNYYCIHIDKKSSNDFISAIEELVKCINLKSNNTINTKNRVEVEWGTMSVLTAELNCMKELYENFKDWKYFINLSGQEFPLKTNAELVKILKAFKGANNVEG--------------YYKDRRNDRIPNAKI-----PFPIIWYTGSVHITVNHDFVSFVLKSPQSKILLDSLKNQFIPEETYFSTLNYNSILRIPGSFVGGPDENQYHDGKSGGFITRFKNSGQYSCESKYIIRQICIWGVGDLPKLTSVPNLFAHKFREDFQPATLRCLE 766
            Y P N YC+H+D+K+S DF+ A++ LV+C      NT        V +G +S L A+LNCMK+L  +   WKY INL GQ+FPLKTN E++  +K+FKG N   G              + +D  N R+   ++     P  I  Y GS ++ +  +F  F+L+  ++  LL   K+ + P+E Y+ TL  N I   PGS    PD     D ++  +     + G   C   Y +R +C++G GDL  L   P++F +KF     P T+ CLE
Sbjct:  115 YMPQNIYCVHVDEKASADFMQAVDSLVQCFP----NTFLASKMEPVVYGGISRLQADLNCMKDLLASDVQWKYVINLCGQDFPLKTNREIIHHIKSFKGKNITPGVLPPAHAIPRTKYVHREDIVNSRVVRTRVLKPPPPHNITIYFGSAYVALTREFTRFILEDQRATNLLLWSKDTYSPDEHYWVTL--NRIADFPGSV---PDAKWEGDLRAIKWSDDKTHDG---CHGHY-VRDVCVYGTGDLQWLLKSPSMFGNKFELASYPPTVECLE 375          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Xenopus
Match: umod.1 (uromodulin (uromucoid, Tamm-Horsfall glycoprotein), gene 1 [Source:Xenbase;Acc:XB-GENE-479389])

HSP 1 Score: 151.754 bits (382), Expect = 1.781e-41
Identity = 101/284 (35.56%), Postives = 148/284 (52.11%), Query Frame = 2
Query:    2 YRPWNYYCIHIDKKSSNDFISAIEELVKCINLKSNNTINTKNRVEVEWGTMSVLTAELNCMKELYENFKDWKYFINLSGQEFPLKTNAELVKILK-AFKGANNVEG----------------YYKDRRNDRI-PNAKI----PFPIIWYTGSVHITVNHDFVSFVLKSPQSKILLDSLKNQFIPEETYFSTLNYNSILRIPGSFVGGPDENQYHDGKSGGFITRFKNSGQYSCESKYIIRQICIWGVGDLPKLTSVPNLFAHKFREDFQPATLRCLEKWYYEKV 787
            Y P N YC+HID+KS  DFI A++EL  C      N      +  V +   S L A++NCM+EL  +   W+Y INL GQ+FP+KTN E+++ LK ++KG N   G                 ++D+    I P A +    P  +  Y G+ + ++  DFV FVL   ++K LL+  K+ + P+E Y+ TL  N +   PGS    PD     + ++  +  + + S    C   Y +R ICI+G+GDL  L S P+LFA+KF  D  P    CLE+ Y  KV
Sbjct:  134 YAPQNLYCVHIDQKSPKDFIQAVQELAGCFG----NIFIPSRQENVVYAGFSRLQADINCMEELSRSDTKWRYVINLCGQDFPIKTNREIIQYLKTSWKGRNLTPGVVQPPHMKYRTNVSYKVFQDQETSYIYPTATLKSGPPRNLTLYFGTAYYSLTRDFVQFVLSDLRAKDLLEWSKDTYSPDEHYWVTL--NRLRDAPGS---TPDAQWEGNIRAVKWKDQ-EGSVHSGCYGHY-VRDICIYGLGDLQWLASSPHLFANKFDSDTYPLVTDCLERSYRLKV 406          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Xenopus
Match: gcnt2.2 (glucosaminyl (N-acetyl) transferase 2 (I blood group), gene 2 [Source:NCBI gene;Acc:100038221])

HSP 1 Score: 141.739 bits (356), Expect = 4.401e-38
Identity = 91/274 (33.21%), Postives = 133/274 (48.54%), Query Frame = 2
Query:    2 YRPWNYYCIHIDKKSSNDFISAIEELVKCINLKSNNTINTKNRVEVEWGTMSVLTAELNCMKELYENFKDWKYFINLSGQEFPLKTNAELVKILKAFKGANNVEG--------------YYKDRRNDRIPNAKI-----PFPIIWYTGSVHITVNHDFVSFVLKSPQSKILLDSLKNQFIPEETYFSTLNYNSILRIPGSFVGGPDENQYHDGKSGGFITRFKNSGQYSCESKYIIRQICIWGVGDLPKLTSVPNLFAHKFREDFQPATLRCLE 766
            Y P N YC+H+D+K+S DF+ A++ LV+C      NT        V +G +S L A+LNCMK+L  +   WKY INL GQ+FPLKTN E++  +K+FKG N   G              + +D  N R+   ++     P  I  Y GS ++ +  +F  F+L+  ++  LL   K+ + P+E Y+ TLN     RI G +V                                  R ICI+G GDL  L +  ++FA+KF     P T+ CLE
Sbjct:  137 YMPQNIYCVHVDEKASADFMQAVDSLVQCFP----NTFLASKMEPVVYGGISRLQADLNCMKDLLASDVQWKYVINLCGQDFPLKTNKEIIHHIKSFKGKNITPGVLPPAHAIPRTKYVHREDIVNSRVVRTRVLKPPPPHNITIYFGSAYVALTREFTRFILEDQRATNLLLWSKDTYSPDEHYWVTLN-----RIAGHYV----------------------------------RDICIYGTGDLQWLMNSRSIFANKFEAKSYPPTVECLE 367          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Xenopus
Match: ccdc77 (coiled-coil domain containing 77 [Source:Xenbase;Acc:XB-GENE-959311])

HSP 1 Score: 135.191 bits (339), Expect = 2.396e-35
Identity = 87/284 (30.63%), Postives = 139/284 (48.94%), Query Frame = 2
Query:    2 YRPWNYYCIHIDKKSSNDFISAIEELVKCINLKSNNTINTKNRVEVEWGTMSVLTAELNCMKELYENFKDWKYFINLSGQEFPLKTNAELVKILKAFKGANNVEG-------------YYK--DRRNDRIPNAKIPFPI--IWYTGSVHITVNHDFVSFVLKSPQSKILLDSLKNQFIPEETYFSTLNYNSILRIPGSFVGGPDENQYHDGKSGGFITRF-----------KNSGQYSCESKYIIRQICIWGVGDLPKLTSVPNLFAHKFREDFQPATLRCLEK 769
            Y P NYYCIH+DKKSS  F++A++ +  C      N         V + + + + A+LNCM +L+     WKY INL G +FP+KTN E+V++LK  K  N++E              +Y+  D    +    K P P+    ++GS +  V   FVS++L++ + +  L+  K+ + P+E  ++TL      RIPG   G    N  +D        RF           K +    C   + +R +C++G GDL  +    +LF +KF  D  P  ++CLE+
Sbjct:  141 YTPQNYYCIHVDKKSSTSFLNAVKAITSCFE----NVFIASQLENVVYASWARVQADLNCMTDLHNKNAKWKYLINLCGMDFPIKTNREMVEMLKGLKSQNSLETEKMPPHKEVRWRKHYEIVDNAIRKTEEDKTPPPLETPVFSGSAYFVVTRAFVSYILENEKIQRFLEWSKDTYSPDEFIWATLQ-----RIPG-VPGSVPANSKYDVSDMNAYARFVKWAYLEGDVAKGAPYPPCAGNH-VRSVCVFGAGDLEFMLQKHHLFGNKFDIDVDPTAIKCLEE 413          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Mouse
Match: Gcnt1 (glucosaminyl (N-acetyl) transferase 1, core 2 [Source:MGI Symbol;Acc:MGI:95676])

HSP 1 Score: 143.665 bits (361), Expect = 1.323e-38
Identity = 89/283 (31.45%), Postives = 142/283 (50.18%), Query Frame = 2
Query:    2 YRPWNYYCIHIDKKSSNDFISAIEELVKCINLKSNNTINTKNRVEVEWGTMSVLTAELNCMKELYENFKDWKYFINLSGQEFPLKTNAELVKILKAFKGANNVEG---------YYKDR--------RNDRIPNAKIPFPIIWYTGSVHITVNHDFVSFVLKSPQSKILLDSLKNQFIPEETYFSTLNYNSILRIPGSFVGGPDENQYHDGKSGGFITRF----------KNSGQYSCESKYIIRQICIWGVGDLPKLTSVPNLFAHKFREDFQPATLRCLEK 769
            Y P N+YCIH+D+K+   F++A++ +  C +    N         V + + S + A+LNCMK+LY    +WKY INL G +FP+KTN E+V+ LK   G NN+E           +K R         N  I  A  P     ++GS +  V  ++V +VL++   + L++  ++ + P+E  ++T+    I  +PGSF   P  N+Y D      I RF           N   Y   S   +R +C++G GDL  +    +LFA+KF  D  P  ++CL++
Sbjct:  144 YMPQNFYCIHVDRKAEESFLAAVQGIASCFD----NVFVASQLESVVYASWSRVKADLNCMKDLYRMNANWKYLINLCGMDFPIKTNLEIVRKLKCSTGENNLETEKMPPNKEERWKKRYTVVDGKLTNTGIVKAPPPLKTPLFSGSAYFVVTREYVGYVLENENIQKLMEWAQDTYSPDEFLWATI--QRIPEVPGSF---PSSNKY-DLSDMNAIARFVKWQYFEGHVSNGAPYPPCSGVHVRSVCVFGAGDLSWMLRQHHLFANKFDMDVDPFAIQCLDE 416          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Mouse
Match: Gcnt1 (glucosaminyl (N-acetyl) transferase 1, core 2 [Source:MGI Symbol;Acc:MGI:95676])

HSP 1 Score: 143.665 bits (361), Expect = 1.323e-38
Identity = 89/283 (31.45%), Postives = 142/283 (50.18%), Query Frame = 2
Query:    2 YRPWNYYCIHIDKKSSNDFISAIEELVKCINLKSNNTINTKNRVEVEWGTMSVLTAELNCMKELYENFKDWKYFINLSGQEFPLKTNAELVKILKAFKGANNVEG---------YYKDR--------RNDRIPNAKIPFPIIWYTGSVHITVNHDFVSFVLKSPQSKILLDSLKNQFIPEETYFSTLNYNSILRIPGSFVGGPDENQYHDGKSGGFITRF----------KNSGQYSCESKYIIRQICIWGVGDLPKLTSVPNLFAHKFREDFQPATLRCLEK 769
            Y P N+YCIH+D+K+   F++A++ +  C +    N         V + + S + A+LNCMK+LY    +WKY INL G +FP+KTN E+V+ LK   G NN+E           +K R         N  I  A  P     ++GS +  V  ++V +VL++   + L++  ++ + P+E  ++T+    I  +PGSF   P  N+Y D      I RF           N   Y   S   +R +C++G GDL  +    +LFA+KF  D  P  ++CL++
Sbjct:  144 YMPQNFYCIHVDRKAEESFLAAVQGIASCFD----NVFVASQLESVVYASWSRVKADLNCMKDLYRMNANWKYLINLCGMDFPIKTNLEIVRKLKCSTGENNLETEKMPPNKEERWKKRYTVVDGKLTNTGIVKAPPPLKTPLFSGSAYFVVTREYVGYVLENENIQKLMEWAQDTYSPDEFLWATI--QRIPEVPGSF---PSSNKY-DLSDMNAIARFVKWQYFEGHVSNGAPYPPCSGVHVRSVCVFGAGDLSWMLRQHHLFANKFDMDVDPFAIQCLDE 416          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Mouse
Match: Gcnt1 (glucosaminyl (N-acetyl) transferase 1, core 2 [Source:MGI Symbol;Acc:MGI:95676])

HSP 1 Score: 143.665 bits (361), Expect = 1.323e-38
Identity = 89/283 (31.45%), Postives = 142/283 (50.18%), Query Frame = 2
Query:    2 YRPWNYYCIHIDKKSSNDFISAIEELVKCINLKSNNTINTKNRVEVEWGTMSVLTAELNCMKELYENFKDWKYFINLSGQEFPLKTNAELVKILKAFKGANNVEG---------YYKDR--------RNDRIPNAKIPFPIIWYTGSVHITVNHDFVSFVLKSPQSKILLDSLKNQFIPEETYFSTLNYNSILRIPGSFVGGPDENQYHDGKSGGFITRF----------KNSGQYSCESKYIIRQICIWGVGDLPKLTSVPNLFAHKFREDFQPATLRCLEK 769
            Y P N+YCIH+D+K+   F++A++ +  C +    N         V + + S + A+LNCMK+LY    +WKY INL G +FP+KTN E+V+ LK   G NN+E           +K R         N  I  A  P     ++GS +  V  ++V +VL++   + L++  ++ + P+E  ++T+    I  +PGSF   P  N+Y D      I RF           N   Y   S   +R +C++G GDL  +    +LFA+KF  D  P  ++CL++
Sbjct:  144 YMPQNFYCIHVDRKAEESFLAAVQGIASCFD----NVFVASQLESVVYASWSRVKADLNCMKDLYRMNANWKYLINLCGMDFPIKTNLEIVRKLKCSTGENNLETEKMPPNKEERWKKRYTVVDGKLTNTGIVKAPPPLKTPLFSGSAYFVVTREYVGYVLENENIQKLMEWAQDTYSPDEFLWATI--QRIPEVPGSF---PSSNKY-DLSDMNAIARFVKWQYFEGHVSNGAPYPPCSGVHVRSVCVFGAGDLSWMLRQHHLFANKFDMDVDPFAIQCLDE 416          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Mouse
Match: Gcnt1 (glucosaminyl (N-acetyl) transferase 1, core 2 [Source:MGI Symbol;Acc:MGI:95676])

HSP 1 Score: 143.665 bits (361), Expect = 1.323e-38
Identity = 89/283 (31.45%), Postives = 142/283 (50.18%), Query Frame = 2
Query:    2 YRPWNYYCIHIDKKSSNDFISAIEELVKCINLKSNNTINTKNRVEVEWGTMSVLTAELNCMKELYENFKDWKYFINLSGQEFPLKTNAELVKILKAFKGANNVEG---------YYKDR--------RNDRIPNAKIPFPIIWYTGSVHITVNHDFVSFVLKSPQSKILLDSLKNQFIPEETYFSTLNYNSILRIPGSFVGGPDENQYHDGKSGGFITRF----------KNSGQYSCESKYIIRQICIWGVGDLPKLTSVPNLFAHKFREDFQPATLRCLEK 769
            Y P N+YCIH+D+K+   F++A++ +  C +    N         V + + S + A+LNCMK+LY    +WKY INL G +FP+KTN E+V+ LK   G NN+E           +K R         N  I  A  P     ++GS +  V  ++V +VL++   + L++  ++ + P+E  ++T+    I  +PGSF   P  N+Y D      I RF           N   Y   S   +R +C++G GDL  +    +LFA+KF  D  P  ++CL++
Sbjct:  144 YMPQNFYCIHVDRKAEESFLAAVQGIASCFD----NVFVASQLESVVYASWSRVKADLNCMKDLYRMNANWKYLINLCGMDFPIKTNLEIVRKLKCSTGENNLETEKMPPNKEERWKKRYTVVDGKLTNTGIVKAPPPLKTPLFSGSAYFVVTREYVGYVLENENIQKLMEWAQDTYSPDEFLWATI--QRIPEVPGSF---PSSNKY-DLSDMNAIARFVKWQYFEGHVSNGAPYPPCSGVHVRSVCVFGAGDLSWMLRQHHLFANKFDMDVDPFAIQCLDE 416          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Mouse
Match: Gcnt2 (glucosaminyl (N-acetyl) transferase 2, I-branching enzyme [Source:MGI Symbol;Acc:MGI:1100870])

HSP 1 Score: 139.043 bits (349), Expect = 5.275e-37
Identity = 91/278 (32.73%), Postives = 134/278 (48.20%), Query Frame = 2
Query:    2 YRPWNYYCIHIDKKSSNDFISAIEELVKCINLKSNNTINTKNRVEVEWGTMSVLTAELNCMKELYENFKDWKYFINLSGQEFPLKTNAELVKILKAFKGAN-----------------------NVEGYYKDRRNDRIPNAKIPFPIIWYTGSVHITVNHDFVSFVLKSPQSKILLDSLKNQFIPEETYFSTLNYNSILRIPGSFVGGPDENQYHDGKSGGFITRFKNSGQYSCESKYIIRQICIWGVGDLPKLTSVPNLFAHKFREDFQPATLRCLE 766
            Y P N YC+H+D K+++ F  A+ +L+ C      N        +V +G  S L A+LNCMK+L  +   WKY +N  GQ+FPLKTN E++  LK FKG N                         +GY+  + N  I     P  +I Y G+ ++ +  DFV+F+L   ++  LL+  K+ + P+E ++ TLN     RIPG   G    N    G           +    C   Y +  ICI+G GDL  L +  +LFA+KF  +  P T+ CLE
Sbjct:  116 YMPQNVYCVHVDSKATDTFKEAVRQLLSCFP----NAFLASKVEQVVYGGFSRLQADLNCMKDLVASKVPWKYVLNTCGQDFPLKTNKEIINHLKRFKGKNITPGVLPPAYIVVRTKYVHQERKGKDGYFMHKTN--ILKTPPPHQLIIYFGTAYVALTRDFVNFILNDERAIALLEWSKDTYSPDEHFWVTLN-----RIPG-VPGSMPPNASWTGNLRAVKWMDMEAKHGGCHGHY-VHGICIYGNGDLQWLINSQSLFANKFELNTYPLTVECLE 380          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. UniProt/SwissProt
Match: sp|Q09324|GCNT1_MOUSE (Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase OS=Mus musculus OX=10090 GN=Gcnt1 PE=1 SV=2)

HSP 1 Score: 143.665 bits (361), Expect = 9.253e-38
Identity = 89/283 (31.45%), Postives = 142/283 (50.18%), Query Frame = 2
Query:    2 YRPWNYYCIHIDKKSSNDFISAIEELVKCINLKSNNTINTKNRVEVEWGTMSVLTAELNCMKELYENFKDWKYFINLSGQEFPLKTNAELVKILKAFKGANNVEG---------YYKDR--------RNDRIPNAKIPFPIIWYTGSVHITVNHDFVSFVLKSPQSKILLDSLKNQFIPEETYFSTLNYNSILRIPGSFVGGPDENQYHDGKSGGFITRF----------KNSGQYSCESKYIIRQICIWGVGDLPKLTSVPNLFAHKFREDFQPATLRCLEK 769
            Y P N+YCIH+D+K+   F++A++ +  C +    N         V + + S + A+LNCMK+LY    +WKY INL G +FP+KTN E+V+ LK   G NN+E           +K R         N  I  A  P     ++GS +  V  ++V +VL++   + L++  ++ + P+E  ++T+    I  +PGSF   P  N+Y D      I RF           N   Y   S   +R +C++G GDL  +    +LFA+KF  D  P  ++CL++
Sbjct:  144 YMPQNFYCIHVDRKAEESFLAAVQGIASCFD----NVFVASQLESVVYASWSRVKADLNCMKDLYRMNANWKYLINLCGMDFPIKTNLEIVRKLKCSTGENNLETEKMPPNKEERWKKRYTVVDGKLTNTGIVKAPPPLKTPLFSGSAYFVVTREYVGYVLENENIQKLMEWAQDTYSPDEFLWATI--QRIPEVPGSF---PSSNKY-DLSDMNAIARFVKWQYFEGHVSNGAPYPPCSGVHVRSVCVFGAGDLSWMLRQHHLFANKFDMDVDPFAIQCLDE 416          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. UniProt/SwissProt
Match: sp|P97402|GCNT2_MOUSE (N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase OS=Mus musculus OX=10090 GN=Gcnt2 PE=2 SV=2)

HSP 1 Score: 138.658 bits (348), Expect = 4.349e-36
Identity = 95/276 (34.42%), Postives = 136/276 (49.28%), Query Frame = 2
Query:    2 YRPWNYYCIHIDKKSSNDFISAIEELVKCINLKSNNTINTKNRVEVEWGTMSVLTAELNCMKELYENFKDWKYFINLSGQEFPLKTNAELVKILKAFKGANNVEGY-----------YKDRRN--------DRIPNAKIPFP--IIWYTGSVHITVNHDFVSFVLKSPQSKILLDSLKNQFIPEETYFSTLNYNSILRIPGSFVGGPDENQYHDGKSGGFITRFKNSGQYSCESKYIIRQICIWGVGDLPKLTSVPNLFAHKFREDFQPATLRCLE 766
            + P N YC+H+D+K++ +F  A+E+LV C      N         V +G +S L A+LNC+K+L  +   WKY IN  GQ+FPLKTN E+V+ LK  KG N   G            Y  R +         R    K P P  +  Y GS ++ ++ +F +FVL+ P++  LL   K+ F P+E ++ TLN     RIPG   G    N    G           +    C   Y +  ICI+G GDL  L +  +LFA+KF  +  P T+ CLE
Sbjct:  116 FMPQNIYCVHVDEKATAEFKGAVEQLVSCFP----NAFLASKMEPVVYGGISRLQADLNCIKDLSTSEVPWKYAINTCGQDFPLKTNKEIVQYLKGLKGKNLTPGVLPPAHAIGRTRYVHREHLSKELSYVIRTTALKPPPPHNLTIYFGSAYVALSREFANFVLRDPRAVDLLHWSKDTFSPDEHFWVTLN-----RIPG-VPGSMPPNASWTGNLRAVKWMDMEAKHGGCHGHY-VHGICIYGNGDLQWLINSQSLFANKFELNTYPLTVECLE 380          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. UniProt/SwissProt
Match: sp|Q8N0V5|GNT2A_HUMAN (N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase OS=Homo sapiens OX=9606 GN=GCNT2 PE=1 SV=1)

HSP 1 Score: 136.346 bits (342), Expect = 4.052e-35
Identity = 93/283 (32.86%), Postives = 140/283 (49.47%), Query Frame = 2
Query:    2 YRPWNYYCIHIDKKSSNDFISAIEELVKCINLKSNNTINTKNRVEVEWGTMSVLTAELNCMKELYENFKDWKYFINLSGQEFPLKTNAELVKILKAFKGANNVEGY-------------------YKDRRNDRIPNAKIPFP--IIWYTGSVHITVNHDFVSFVLKSPQSKILLDSLKNQFIPEETYFSTLNYNSILRIPGSFVGGPDENQYHDGKSGGFITRFKNSGQYSCESKYIIRQICIWGVGDLPKLTSVPNLFAHKFREDFQPATLRCLEKWYYEKV 787
            Y P N YC+H+D+K+++ F  A+++L+ C      N      +  V +G +S L A+LNC+++L  +   WKY IN  GQ+FPLKTN E+V+ LK FKG N   G                    +K+    +    K P P  ++ Y G+ ++ +  DF +FVL+   +  LL   K+ + P+E ++ TLN     RIPG  V G   N    G                C   Y +  ICI+G GDL  L + P+LFA+KF  +  P T+ CLE  + E+ 
Sbjct:  118 YMPQNVYCVHLDQKATDAFKGAVKQLLSCFP----NAFLASKKESVVYGGISRLQADLNCLEDLVASEVPWKYVINTCGQDFPLKTNREIVQYLKGFKGKNITPGVLPPDHAVGRTKYVHQELLNHKNSYVIKTTKLKTPPPHDMVIYFGTAYVALTRDFANFVLQDQLALDLLSWSKDTYSPDEHFWVTLN-----RIPG--VPGSMPNASWTGNLRAIKWSDMEDRHGGCHGHY-VHGICIYGNGDLKWLVNSPSLFANKFELNTYPLTVECLELRHRERT 388          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. UniProt/SwissProt
Match: sp|Q92180|GCNT1_BOVIN (Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase OS=Bos taurus OX=9913 GN=GCNT1 PE=2 SV=1)

HSP 1 Score: 132.494 bits (332), Expect = 1.230e-33
Identity = 86/282 (30.50%), Postives = 141/282 (50.00%), Query Frame = 2
Query:    2 YRPWNYYCIHIDKKSSNDFISAIEELVKCINLKSNNTINTKNRVEVEWGTMSVLTAELNCMKELYENFKDWKYFINLSGQEFPLKTNAELVKILKAFKGANNVE-----GYYKDR--RNDRIPNAKI----------PFPIIWYTGSVHITVNHDFVSFVLKSPQSKILLDSLKNQFIPEETYFSTLNYNSILRIPGSFVGGPDENQYHDGKSGGFITRFKN----SGQYSCESKYI-----IRQICIWGVGDLPKLTSVPNLFAHKFREDFQPATLRCLEK 769
            Y P N+YCIH+D KS   F++A   +  C +    N         V + + S + A+LNCM++LY+    WKY INL G +FP+KTN E+V+ LK   G NN+E      + K+R  ++  + N K+          P     ++GS H  V+ ++V +VL++   +  ++  K+ + P+E  ++T+    I  +PGS       +  +D      I RF       G  S  + Y      +R +C++G GDL  L  V +LFA+KF  D     ++CL++
Sbjct:  144 YMPQNFYCIHVDAKSEKSFLAAAVGIASCFS----NVFVASQLESVVYASWSRVQADLNCMQDLYQMNAGWKYLINLCGMDFPIKTNLEIVRKLKLLMGENNLETEKMPSHKKERWKKHYEVVNGKLTNMGTDKIHPPLETPLFSGSAHFVVSREYVEYVLQNQNIQKFMEWAKDTYSPDEYLWATI--QRIPEVPGSL----SLSYKYDTSDMQAIARFVKWQYFEGDVSKGAPYPPCSVHVRSVCVFGAGDLNWLLHVHHLFANKFDTDIDLFAIQCLDE 415          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. UniProt/SwissProt
Match: sp|Q8CH87|GCNT3_RAT (Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 OS=Rattus norvegicus OX=10116 GN=Gcnt3 PE=1 SV=1)

HSP 1 Score: 132.494 bits (332), Expect = 1.857e-33
Identity = 87/285 (30.53%), Postives = 144/285 (50.53%), Query Frame = 2
Query:    2 YRPWNYYCIHIDKKSSNDFISAIEELVKCINLKSNNTINTKNRVEVEWGTMSVLTAELNCMKELYENFKDWKYFINLSGQEFPLKTNAELVKILKAFKGANNVEG------------YYKDRRND--RIPNAKIPFP--IIWYTGSVHITVNHDFVSFVLKSPQSKILLDSLKNQFIPEETYFSTLNYNSILRIPGSFVGGPDENQYHDGKSGGFITRFK-------NSGQYSCESKYIIRQICIWGVGDLPKLTSVPNLFAHKFREDFQPATLRCLEKWYYEKV 787
            Y P N YC+H+D+KSS  F  A+  +V C      N       V V + + S + A+LNCM++L ++   W+Y +N  G +FP+KTNAE+VK LK   G N++E             Y+ +  +   R    K P P  I  +TG+ ++  + DF+  VL + +++ L++ +K+ + P+E  ++TL   S +  PGS    P  +   D +S   +T+++       N   Y+  S    R IC++G GDL  +    +L A+KF        L+CLE++   K 
Sbjct:  154 YTPQNIYCVHVDQKSSETFQQAVRAIVSCFP----NVFIANKLVSVVYASWSRVQADLNCMEDLLQSPVPWEYLLNTCGTDFPIKTNAEMVKALKLLNGQNSMESEVPPPHKTFRWKYHYEVADTLYRTSKEKTPPPNNITMFTGNAYMVASRDFIEHVLSNSKARQLIEWVKDTYSPDEHLWATLQRASWM--PGSDPLHPKFD-LSDMRSIARLTKWQDHEGDIENGAPYTSCSGIHQRAICVYGSGDLHWILQNHHLLANKFDPKVDDNVLQCLEEYLRHKA 431          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. TrEMBL
Match: A0A2T7P144 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_12287 PE=4 SV=1)

HSP 1 Score: 223.402 bits (568), Expect = 3.710e-66
Identity = 119/266 (44.74%), Postives = 159/266 (59.77%), Query Frame = 2
Query:    2 YRPWNYYCIHIDKKSSNDFISAIEELVKCINLKSNNTINTKNRVEVEWGTMSVLTAELNCMKELYENFKDWKYFINLSGQEFPLKTNAELVKILKAFKGANNVEGYYKDRRNDRIPNA-KIPFPIIWYTGSVHITVNHDFVSFVLKSPQSKILLDSLKNQFIPEETYFSTLNYNSILRIPGSFVGGPDENQYHDGKSGGFITRFKNSGQYSCESKYIIRQICIWGVGDLPKLTSVPNLFAHKFREDFQPATLRCLEKWYYEKVERE 796
            YRP N YCIH+D+K+   +   +  +  C +    N   T   V+V WGT +VL  EL CMK+L+ +FK WKYFINL+GQEFPL+TN ELV+IL A+ GAN+VE   K    +R  +A   P  II   G+VHI VN DFV +VL SP ++  L+  +   IP+ET+F++LN+N  L I GS+ G P+     D  +  F+TRFKN G Y C     IR ICI   GDLP L   P +FA+KF +D+    L CL +  Y  +  E
Sbjct:   92 YRPQNVYCIHVDQKADQSYRDTMAAIADCFH----NVFLTSRSVDVRWGTFTVLEPELICMKDLW-HFKKWKYFINLTGQEFPLRTNFELVRILTAYNGANDVESIVKRANKERWASAGPTPHGIILVKGAVHIAVNRDFVDYVLHSPVAQDFLNWTRRVHIPDETFFASLNHNPQLGIRGSYKGYPET----DPVTKPFLTRFKNWGDYPCAEGNWIRDICILSTGDLPLLDKRPEMFANKFYQDYSRVALECLHQRLYNHMRDE 348          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. TrEMBL
Match: A0A2T7P139 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_12289 PE=4 SV=1)

HSP 1 Score: 222.631 bits (566), Expect = 8.210e-66
Identity = 118/266 (44.36%), Postives = 160/266 (60.15%), Query Frame = 2
Query:    2 YRPWNYYCIHIDKKSSNDFISAIEELVKCINLKSNNTINTKNRVEVEWGTMSVLTAELNCMKELYENFKDWKYFINLSGQEFPLKTNAELVKILKAFKGANNVEGYYKDRRNDRIPNA-KIPFPIIWYTGSVHITVNHDFVSFVLKSPQSKILLDSLKNQFIPEETYFSTLNYNSILRIPGSFVGGPDENQYHDGKSGGFITRFKNSGQYSCESKYIIRQICIWGVGDLPKLTSVPNLFAHKFREDFQPATLRCLEKWYYEKVERE 796
            YRP N YCIH+D+K+   +   +  +V C +    N       V+V+WGT +VL  EL CMK+L+  FK WKYFINL+GQEFPLKTN ELV+IL A+ GAN+VE   +    +R  +A   P  II   G+VHI VN DFV +VL SP ++  L+  +   +P+ET+F++LN+N  L I GS+ G P+     D  +  F+TRFKN  Q+ C  +  IRQICI   GDLP L   P +FA+KF +D+    L CL +  Y     E
Sbjct:   87 YRPQNVYCIHVDQKADQSYRDTMAAIVDCFH----NVFLASRSVDVQWGTFTVLEPELICMKDLWP-FKKWKYFINLTGQEFPLKTNFELVRILTAYNGANDVESTTETANKERWASAGPAPHGIIPVKGAVHIVVNRDFVDYVLHSPVAQDFLNWTRRVDVPDETFFASLNHNPQLGIRGSYKGYPET----DPVTKPFLTRFKNWRQFPCAEEMRIRQICILSTGDLPLLDKRPEMFANKFYQDYSRVALECLHQRLYNHTRDE 343          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. TrEMBL
Match: A0A2T7P154 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_12288 PE=4 SV=1)

HSP 1 Score: 220.705 bits (561), Expect = 4.051e-65
Identity = 118/266 (44.36%), Postives = 158/266 (59.40%), Query Frame = 2
Query:    2 YRPWNYYCIHIDKKSSNDFISAIEELVKCINLKSNNTINTKNRVEVEWGTMSVLTAELNCMKELYENFKDWKYFINLSGQEFPLKTNAELVKILKAFKGANNVEGYYKDRRNDRIPNA-KIPFPIIWYTGSVHITVNHDFVSFVLKSPQSKILLDSLKNQFIPEETYFSTLNYNSILRIPGSFVGGPDENQYHDGKSGGFITRFKNSGQYSCESKYIIRQICIWGVGDLPKLTSVPNLFAHKFREDFQPATLRCLEKWYYEKVERE 796
            YRP N YCIH+D+K+   +   +  +  C +    N   T   V+V WGT +VL  EL CMK+L+ +FK WKYFINL+GQEFPL+TN ELV+IL A+ GAN+VE   K    +R  +A   P  II   GSVHI VN DFV +VL SP ++  L+  +   +P+ET+F++LN+N  L I GS+ G P+     D  +  F+TRFKN G Y C      R ICI   GDLP L + P +FA+KF +D+    L CL +  Y     E
Sbjct:   87 YRPQNVYCIHVDQKADQSYRDTMAAIADCFH----NVFLTSRSVDVRWGTFTVLEPELICMKDLW-HFKKWKYFINLTGQEFPLRTNFELVRILTAYNGANDVESIVKRANKERWASAGPTPHGIIPVKGSVHIVVNRDFVDYVLHSPVAQDFLNWTRRVDVPDETFFASLNHNPQLGIRGSYKGYPET----DPVTKPFLTRFKNWGDYPCAEGNFNRDICILSTGDLPLLDTRPEMFANKFYQDYSRVALECLHERLYNHTRDE 343          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. TrEMBL
Match: A0A2C9JUK0 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 PE=4 SV=1)

HSP 1 Score: 220.32 bits (560), Expect = 1.013e-64
Identity = 122/266 (45.86%), Postives = 161/266 (60.53%), Query Frame = 2
Query:    2 YRPWNYYCIHIDKKSSNDFISAIEELVKCINLKSNNTINTKNRVEVEWGTMSVLTAELNCMKELYENFKDWKYFINLSGQEFPLKTNAELVKILKAFKGANNVEGYYKDRRNDRIPNAKIPFPIIWYTGSVHITVNHDFVSFVLKSPQSKILLDSLKNQFIPEETYFSTLNYNSILRIPGSFVGGPDENQYHDGKSGGFITRFKNSGQYSCESKYIIRQICIWGVGDLPKLTSVPNLFAHKFREDFQPATLRCLEKWYYEKVEREI 799
            YRP NYYCIH+DKKS  +F  A+  + +C      N      R+ V WGT SVL  EL CM++L+  F+ WKYFINL+GQEFPL+TN ELV+ILK+++GAN++EG  K     R+P    P  I    GSVHI VN DFV ++L    +K LLD +KN  IP+ET+F+TLN+N  L I G++ G P E    D     F+TRFKN G+  C   + +R ICI   GDLP L    ++FA+KF     P  + CLE+  Y     E+
Sbjct:  130 YRPQNYYCIHVDKKSDQNFFIAVSAIAECFE----NVFIAPERLAVHWGTFSVLEPELVCMQQLWR-FRKWKYFINLTGQEFPLRTNWELVQILKSYRGANDLEGTIK----RRLPTDP-PHNITAIKGSVHIAVNRDFVDYILHHRTAKDLLDWVKNTSIPDETFFTTLNHNPQLGIRGTYKGVP-ETDNDDSMIKPFLTRFKNWGEKLCAGHW-VRGICILSTGDLPLLGRAKHMFANKFFLWEDPIAIGCLEEMIYNNTRDEL 383          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. TrEMBL
Match: A0A2T7NME5 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_18141 PE=4 SV=1)

HSP 1 Score: 219.55 bits (558), Expect = 1.354e-64
Identity = 117/272 (43.01%), Postives = 163/272 (59.93%), Query Frame = 2
Query:    2 YRPWNYYCIHIDKKSSNDFISAIEELVKCINLKSNNTINTKNRVEVEWGTMSVLTAELNCMKELYENFKDWKYFINLSGQEFPLKTNAELVKILKAFKGANNVEGYYKDRRNDRIPNAKIP-FPIIWYTGSVHITVNHDFVSFVLKSPQSKILLDSLKNQFIPEETYFSTLNYNSILRIPGSFVGGPDENQYHDGKSGGFITRFKNSGQ------------YSCESKYIIRQICIWGVGDLPKLTSVPNLFAHKFREDFQPATLRCLEKWYY 778
            YRP N+YC+H+D+K+    + A+  +  C+     N       V+V WG  SVL  EL CM++L+  +K W+YFINL+GQEFPLKTN +LV+IL A  G+N V+     R NDR  N  +P   I  Y G+VH+ VN  FV ++L +P +   L  L+   +P+E++FSTLNYN  LR+PG+++G PD     D     ++ RFKN G             + C  K  +R IC++GVGDLP LTS   LFA+KF  +F+P TL+CLE W Y
Sbjct:   85 YRPHNFYCLHVDQKADPSLLEAVRSIASCLE----NVFVASESVDVIWGEFSVLEPELVCMRDLWR-YKKWRYFINLTGQEFPLKTNLQLVRILTALNGSNLVDCTTNGRDNDRWYNNFLPPHGIKPYKGNVHVVVNRGFVDYILHNPVAHDYLSWLRRTDVPDESFFSTLNYNPHLRVPGAYLGPPDT----DAHLKPYLARFKNWGHNWRDGLDRMNFNWPCYGKR-VRTICVFGVGDLPMLTSRKELFANKFYINFEPLTLQCLEDWLY 346          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Cavefish
Match: ENSAMXT00000050168.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001873.1:355693:357685:-1 gene:ENSAMXG00000033034.1 transcript:ENSAMXT00000050168.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 156.762 bits (395), Expect = 1.354e-43
Identity = 96/282 (34.04%), Postives = 148/282 (52.48%), Query Frame = 2
Query:    2 YRPWNYYCIHIDKKSSNDFISAIEELVKCINLKSNNTINTKNRVEVEWGTMSVLTAELNCMKELYENFKDWKYFINLSGQEFPLKTNAELVKILKAFKGANNVEG-------YYKDRRNDRIPNAKI----------PFPIIWYTGSVHITVNHDFVSFVLKSPQSKILLDSLKNQFIPEETYFSTLNYNSILRIPGSFVGGPDENQYHDGKSGGFITRF----KNSGQYS-----CESKYIIRQICIWGVGDLPKLTSVPNLFAHKFREDFQPATLRCLEK 769
            Y P N+YCIH+DKK+S    +AI   V C +    N        EV + + S + A++NCMK+LY+    WKYFINL GQ+FP+KTN E+V+ LK   G N++E         Y+ ++   + N  I          P  I  ++G  +I V+  F+ FVL+ P+++ L+   K+ + P+E  ++T+      RIPG   G    +   D      I+R      + G++      C+  + +R IC++GVGDL  +    +LFA+KF  DF P  +RCLEK
Sbjct:  136 YAPQNFYCIHVDKKASESTRAAINATVSCFD----NVFIASQLEEVVYASWSRVQADINCMKDLYQISDRWKYFINLCGQDFPMKTNLEMVRALKGLHGGNSLETETMPSNKEYRWKKRHIVKNGAIQYTNEAKKPPPSRIKMFSGGAYIVVSRAFIRFVLEDPKAQELISWSKDTYSPDEFLWATMQ-----RIPG-VPGYIRAHHKFDRSDMNTISRLIKWAGHEGEFDAVYPPCQGTH-VRAICVYGVGDLQWMLQQDHLFANKFDTDFDPIAIRCLEK 406          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Cavefish
Match: ENSAMXT00000026751.2 (glucosaminyl (N-acetyl) transferase 1 [Source:NCBI gene;Acc:103024919])

HSP 1 Score: 152.91 bits (385), Expect = 4.574e-42
Identity = 100/282 (35.46%), Postives = 149/282 (52.84%), Query Frame = 2
Query:    2 YRPWNYYCIHIDKKSSNDFISAIEELVKCINLKSNNTINTKNRVEVEWGTMSVLTAELNCMKELYENFKDWKYFINLSGQEFPLKTNAELVKILKAFKGANNVEG---------YYKDR---RNDRIPN---AKIPFP--IIWYTGSVHITVNHDFVSFVLKSPQSKILLDSLKNQFIPEETYFSTLNYNSILRIPGSFVGGPDENQYHDGKSGGFITRF----KNSGQYS-----CESKYIIRQICIWGVGDLPKLTSVPNLFAHKFREDFQPATLRCLEK 769
            Y P N+YCIH+DKK+S    +AI   V C +    N        EV + + S + A++NCMK+LY+    WKYFINL GQ+FP+KTN E+V+ LK   G N++E           +K R   +N  I N   AK P P  I  ++G  +I V+  F+ FVL+ P+++ L+   K+ + P+E  ++T+      RIPG   G    +   D      I+R      + G +      C+  + +R IC++G GDL  +    +LFA+KF  DF P  +RCLEK
Sbjct:  142 YAPQNFYCIHVDKKASESTRAAINATVSCFD----NVFIASQLEEVVYASWSRVQADINCMKDLYQISDRWKYFINLCGQDFPMKTNLEMVRALKGLHGGNSLETETMPSNKEYRWKKRHIVKNGDIHNTNEAKKPPPSGIKMFSGGAYIVVSRVFIRFVLEDPKAQELILWSKDTYSPDEFLWATMQ-----RIPG-VPGYIRAHHKFDRTDMNTISRLIKWVYHEGDFDAVYPPCQGTH-VRSICVYGAGDLQWMLQQDHLFANKFDTDFDPIAIRCLEK 412          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Cavefish
Match: gcnt4b (beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 4-like [Source:NCBI gene;Acc:103021884])

HSP 1 Score: 132.494 bits (332), Expect = 1.496e-34
Identity = 92/291 (31.62%), Postives = 142/291 (48.80%), Query Frame = 2
Query:    2 YRPWNYYCIHIDKKSSNDFISAIEELVKCINLKSNNTINTKNRVEVEWGTMSVLTAELNCMKELYENFKDWKYFINLSGQEFPLKTNAELVKILKAFKGANNVE----GYYKDRRND-----------------RIPNAKIPFP--IIWYTGSVHITVNHDFVSFVLKSPQSKILLDSLKNQFIPEETYFSTLNYNSILRIPGSFVGGPDENQYHDGKSGGFITRFK-------NSGQYSCESKYIIRQICIWGVGDLPKLTSVPNLFAHKFREDFQPATLRCLEKWYYEK 784
            Y P N YCIH D KSS +F++A++ L  C+     N         V++ +++ L A+LNC+ +L E+   W+Y INL GQ+FPL++N ELV+ LKA KGA+ +E       K RR                   +   AK P P  +  + GS + T++ +FVSFV  SP  K  L   ++ + P+E +++TL     +R+PG     P E    D       +R +           Y   +   IR +CI+G G+L  L +  + FA+K      P  + CLE+   E+
Sbjct:  136 YVPHNSYCIHYDLKSSPEFMAAMQGLALCLP----NVFIASKLERVQYASITRLRADLNCLSDLMESKVKWRYVINLCGQDFPLRSNVELVEELKALKGASMLETARPSPLKKRRFSFSYTLKDVGSQYHQHPMKTDQAKSPPPHKLEMFVGSAYFTLSREFVSFVQWSPMVKDFLSWSEDTYSPDEHFWATL-----IRVPGV----PGELSRSDPDVSDLASRTRLVKWQYLEGKLYPACTGVHIRSVCIYGAGELRWLLNDGHWFANKLDPRVDPVLVECLEEKLAER 413          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Cavefish
Match: gcnt4a (glucosaminyl (N-acetyl) transferase 4 [Source:NCBI gene;Acc:103033386])

HSP 1 Score: 128.257 bits (321), Expect = 5.568e-33
Identity = 93/290 (32.07%), Postives = 142/290 (48.97%), Query Frame = 2
Query:    2 YRPWNYYCIHIDKKSSNDFISAIEELVKCINLKSNNTINTKNRVEVEWGTMSVLTAELNCMKELYENFKDWKYFINLSGQEFPLKTNAELVKILKAFKGANNVEG-----------YYKDRRND------RIP----NAKI--PFPIIWYTGSVHITVNHDFVSFVLKSPQSKILLDSLKNQFIPEETYFSTLNYNSILRIPGSFVGGP-DENQYHDGKSGGFITRFK--NSGQYSCESKYIIRQICIWGVGDLPKLTSVPNLFAHKFREDFQPATLRCLEKWYYEKVER 793
            Y P N YCIH D+KSS  FI+A++ L KC      N         VE+  ++ L A+LNC+ +L  +   WKY INL GQ+FPL++N ELV+ LK   GAN +E             ++ +  D      ++P    NAK   P  I  + GS +  ++ DFV +V  +  +K  LD   + + P+E +++TL      R+PG     P  E    D KS   + +++      Y   +   +R +CI+G  +L  L    + FA+KF     P  ++CLE+   EK  R
Sbjct:  146 YAPTNIYCIHYDQKSSESFIAAVKNLAKCFP----NIFIASKLESVEYAHITRLNADLNCLSDLMSSEVKWKYAINLCGQDFPLRSNYELVEELKKLNGANMLESSRPSELKRERFVFQHKLQDVPYEYHKLPIKTTNAKSAPPHDIEMFIGSAYFVLSRDFVHYVQTAQVAKDFLDWSADTYSPDEHFWATLA-----RVPGVPGEIPRSEPDVTDLKSKTRLVKWEYLEGSLYPGCTGTHMRSVCIYGAAELRWLLDDGHWFANKFDPKVDPVLIKCLEEILEEKKLR 426          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Cavefish
Match: gcnt3 (glucosaminyl (N-acetyl) transferase 3, mucin type [Source:ZFIN;Acc:ZDB-GENE-110411-253])

HSP 1 Score: 119.013 bits (297), Expect = 1.057e-29
Identity = 76/290 (26.21%), Postives = 132/290 (45.52%), Query Frame = 2
Query:    2 YRPWNYYCIHIDKKSSNDFISAIEELVKCINLKSNNTINTKNRVEVEWGTMSVLTAELNCMKELYENFKDWKYFINLSGQEFPLKTNAELVKILKAFKGANNVEGY----YKDRR------------NDRIPNAKIPFPIIWYTGSVHITVNHDFVSFVLKSPQSKILLDSLKNQFIPEETYFSTLNYNSILRIPGSFVGGPDENQYHDGKSGGFITR----------FKNSGQYSCESKYIIRQICIWGVGDLPKLTSVPNLFAHKFREDFQPATLRCLEKWYYEKVER 793
            Y P N YC+H+D KSS +F+ A++ +  C+     N         V + + S + A++NCM++L ++   W+Y +N  G +FP+KTNAE+V+ LK   G N++E      YK +R               I     P     +TG+ +  V+ +FV  +  SP+    ++  K+ + P+E  ++TL      R+P      P   +Y D      I R           +    Y   +      +C++G GD+  +    +LFA+KF  +     ++CLE +   +  R
Sbjct:  141 YSPQNIYCVHVDTKSSKEFMEAVKAITSCLP----NVFVASKLESVVYASWSRVQADINCMQDLLKSSVQWRYLLNTCGADFPIKTNAEMVRTLKQLNGRNSMESEATNDYKKQRWVYQHNVTTSVIRTSIKKTDPPIKSPMFTGNAYFVVSREFVEHMFSSPEILNFMEWEKDTYSPDEHMWATLQ-----RMPNMPGSNPPNGKY-DESDMLAIARLVKWSYLEGDLRKGAPYPPCTGAHRHAVCVYGAGDIKWIVRQKHLFANKFDPEVDDIAIKCLEAYLSGQTGR 420          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Sea Lamprey
Match: GCNT2 (glucosaminyl (N-acetyl) transferase 2 (I blood group) [Source:HGNC Symbol;Acc:HGNC:4204])

HSP 1 Score: 137.117 bits (344), Expect = 4.350e-37
Identity = 97/292 (33.22%), Postives = 140/292 (47.95%), Query Frame = 2
Query:    2 YRPWNYYCIHIDKKSSNDFISAIEELVKCINLKSNNTINTKNRVEVEWGTMSVLTAELNCMKELYENFKDWKYFINLSGQEFPLKTNAELVKILK-AFKGANNVEGYY------------------KDRRND-RIPNAKIPFP--IIWYTGSVHITVNHDFVSFVLKSPQSKILLDSLKNQFIPEETYFSTLNYNSILRIPG-----SFVGGPDENQYHDGKSGGFITRFKNSGQYSCESKYIIRQICIWGVGDLPKLTSVPNLFAHKFREDFQPATLRCLEKWYYEKVERE 796
            Y P N YCIH+D KSS  F  +++ L  C +    N         V +   S L A++NCM++L      WKY +NL GQ+FPL+TN E+V+ILK  ++G N   G +                  KD++   R   AK P P  I    G+ +  V  +FV +VL   +++ LL+  +  F P+E YF TL  NS+   PG     S+ G     ++ DG+               C+  Y +R IC++G GDL  LT   +LFA+KF     P  L CLE W  ++   E
Sbjct:  115 YMPQNIYCIHVDVKSSESFKKSMQRLAGCFD----NVFLASRSETVVYAGFSRLKADINCMRDLATRPTPWKYVLNLCGQDFPLRTNQEIVRILKNKWRGKNITPGIFQPPHMKWRTQYVYKEVVDKDKKQMIRTNVAKGPPPHGINLCFGTAYYAVTREFVQYVLDDKKAQDLLEWSQETFSPDEHYFVTL--NSLPDAPGANTVPSWEGNTRAVKWRDGE----------KTHKGCKGHY-VRDICVYGEGDLEWLTKRSDLFANKFEMQRYPLVLECLEHWARQRTLNE 389          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Sea Lamprey
Match: gcnt3 (glucosaminyl (N-acetyl) transferase 3, mucin type [Source:ZFIN;Acc:ZDB-GENE-110411-253])

HSP 1 Score: 129.413 bits (324), Expect = 5.102e-34
Identity = 84/295 (28.47%), Postives = 140/295 (47.46%), Query Frame = 2
Query:    2 YRPWNYYCIHIDKKSSNDFISAIEELVKCINLKSNNTINTKNRVEVEWGTMSVLTAELNCMKELYENFKDWKYFINLSGQEFPLKTNAELVKILKAFKGANNVE---------GYYKDRR---NDRIPN-----AKIPFPIIWYTGSVHITVNHDFVSFVLKSPQSKILLDSLKNQFIPEETYFSTLNYNSILRIPGSFVGGPDENQY--HDGKSGGFITR--------FKNSGQYSCESKYIIRQICIWGVGDLPKLTSVPNLFAHKFREDFQPATLRCLEKWYYEKVEREIWT 805
            Y P N YC+H+D+KS   +  A+  L  C      N      +  V + +   + A+LNCM++L    + WKYFINL G +FP+KTN E+V+ L+A  G N++E         G ++ R    ND + +     +  P P   ++G+ +I V   FV  VL  P ++ L++  K+ F P+E  ++TL      R+PG     P  ++Y   D  +   + R         + +    C   + +R ICI    DL  +    +LF +K   D     + CLE++   K  R++++
Sbjct:  144 YAPQNVYCLHVDQKSPPPYQEAVRALAACFP----NVFMASRQERVVYTSWLRVQADLNCMRDLVAAPQPWKYFINLCGLDFPIKTNLEMVRALRALNGENSMESMHTPGGKVGRWQIRHEIVNDGLRSTGEKKSPPPIPTPMFSGNAYIVVTRAFVEHVLSDPTARALMEWEKDTFSPDEHLWATLQ-----RLPGVPGSTPPHDKYDVEDMMAIARLVRWSYMEGDTLQGAAYPPCRGTH-MRAICINSAKDLAWVLKQRHLFVNKLDSDVDELAVHCLERYLRRKALRQVFS 428          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Sea Lamprey
Match: gcnt3 (glucosaminyl (N-acetyl) transferase 3, mucin type [Source:ZFIN;Acc:ZDB-GENE-110411-253])

HSP 1 Score: 126.716 bits (317), Expect = 5.097e-33
Identity = 80/296 (27.03%), Postives = 128/296 (43.24%), Query Frame = 2
Query:    2 YRPWNYYCIHIDKKSSNDFISAIEELVKCINLKSNNTINTKNRVEVEWGTMSVLTAELNCMKELYENFKD--WKYFINLSGQEFPLKTNAELVKILKAFKGANNVEGYYKDR-----------------RNDRIPNAKIPFPIIWYTGSVHITVNHDFVSFVLKSPQSKILLDSLKNQFIPEETYFSTLNYNSILRIPGSFVGGPDENQYHDGKSGGFITRF------------KNSGQYSCESKYIIRQICIWGVGDLPKLTSVPNLFAHKFREDFQPATLRCLEKWYYEKVERE 796
            Y P N YC+H+D KS   ++ A   L  C      N     +   V + + S + A+LNCM EL    +   W+YFINL G++FP+KTN E+V+ L+   G N++E     R                 R+  +     P P   + GS ++ V   FV  VL  P ++ L++   + + P+E  ++TL      R+PG   G    ++ HD      + R               +    C   + +R +C++G GDL  +    +LFA+K         + CLE    +K   E
Sbjct:  147 YAPQNLYCLHVDAKSPRAYLEAARALAACFP----NVFVAAHLERVVYASWSRVQADLNCMSELVAMAERVPWRYFINLCGRDFPIKTNLEMVRALRTLNGRNSLETVRMPRGKRARWTLSYKVAGNEIRSTGLTKRPPPIPTPMFAGSAYVVVTRAFVEHVLSDPAARALIEWAGDTYSPDEHLWATLQ-----RMPG-VPGSTPAHRIHDVTDAAALARLVKWSAFEGDVAGGGAAYPPCRGTH-VRDVCVYGAGDLAWVLRQHHLFANKVDTAVDHVAVHCLEHHLRKKALAE 431          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Sea Lamprey
Match: gcnt4a (glucosaminyl (N-acetyl) transferase 4a [Source:NCBI gene;Acc:324510])

HSP 1 Score: 120.168 bits (300), Expect = 4.393e-31
Identity = 82/276 (29.71%), Postives = 133/276 (48.19%), Query Frame = 2
Query:    8 PWNYYCIHIDKKSSNDFISAIEELVKCINLKSNNTINTKNRVEVEWGTMSVLTAELNCMKELYENFKDWKYFINLSGQEFPLKTNAELVKILKAFKGANNVE----GYYK----------DRRNDRIPN--------AKIPFPIIWYTGSVHITVNHDFVSFVLKSPQSKILLDSLKNQFIPEETYFSTLNYNSILRIPGSFVGGPDENQYHDGKSGGFITRFKNSGQYSCESKYIIRQICIWGVGDLPKLTSVPNLFAHKFREDFQPATLRCLEK 769
            P N YC+H+D KSS  F SA++ L KC +    N        EV +  +S L A++NC+ +L ++   WKY INL GQ+FPL++N ELV  LK+ +G + +E      YK          +RR+  +P         A  P  +  + GS +  ++ +FV F + S  +   L    + + P+E +++TL  +   + PG   GG  +      K+      +     Y   S   +R +CI+G  +L  L    + FA+KF     P  ++CLE+
Sbjct:   86 PQNVYCVHVDTKSSTTFKSAVQSLAKCFD----NVFVASKLEEVHYAHISRLQADINCLADLLKSPVRWKYAINLCGQDFPLRSNRELVSELKSLQGRSMLETGKPSAYKQQRFTHKFVLERRDSSLPALQHTQTALAPAPHGLEVFVGSAYFVLSREFVRFAITSAVAADFLRWCADTYSPDEHFWATLARSP--QAPGGGGGGKADVSDLQSKTRLVKWSYLEGRLYPVCSGRHVRSVCIYGAAELGWLLRDGHWFANKFDPHVDPVVVKCLEE 355          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Sea Lamprey
Match: gcnt4a (glucosaminyl (N-acetyl) transferase 4a [Source:NCBI gene;Acc:324510])

HSP 1 Score: 120.168 bits (300), Expect = 4.473e-31
Identity = 82/276 (29.71%), Postives = 133/276 (48.19%), Query Frame = 2
Query:    8 PWNYYCIHIDKKSSNDFISAIEELVKCINLKSNNTINTKNRVEVEWGTMSVLTAELNCMKELYENFKDWKYFINLSGQEFPLKTNAELVKILKAFKGANNVE----GYYK----------DRRNDRIPN--------AKIPFPIIWYTGSVHITVNHDFVSFVLKSPQSKILLDSLKNQFIPEETYFSTLNYNSILRIPGSFVGGPDENQYHDGKSGGFITRFKNSGQYSCESKYIIRQICIWGVGDLPKLTSVPNLFAHKFREDFQPATLRCLEK 769
            P N YC+H+D KSS  F SA++ L KC +    N        EV +  +S L A++NC+ +L ++   WKY INL GQ+FPL++N ELV  LK+ +G + +E      YK          +RR+  +P         A  P  +  + GS +  ++ +FV F + S  +   L    + + P+E +++TL  +   + PG   GG  +      K+      +     Y   S   +R +CI+G  +L  L    + FA+KF     P  ++CLE+
Sbjct:   87 PQNVYCVHVDTKSSTTFKSAVQSLAKCFD----NVFVASKLEEVHYAHISRLQADINCLADLLKSPVRWKYAINLCGQDFPLRSNRELVSELKSLQGRSMLETGKPSAYKQQRFTHKFVLERRDSSLPALQHTQTALAPAPHGLEVFVGSAYFVLSREFVRFAITSAVAADFLRWCADTYSPDEHFWATLARSP--QAPGGGGGGKADVSDLQSKTRLVKWSYLEGRLYPVCSGRHVRSVCIYGAAELGWLLRDGHWFANKFDPHVDPVVVKCLEE 356          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Nematostella
Match: EDO39617 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9I5])

HSP 1 Score: 137.887 bits (346), Expect = 2.433e-38
Identity = 93/255 (36.47%), Postives = 133/255 (52.16%), Query Frame = 2
Query:    2 YRPWNYYCIHIDKKSSNDFISAIEELVKCINLKSNNTINTKNRVEVEWGTMSVLTAELNCMKELYENFKDWKYFINLSGQEFPLKTNAELVKILKAFKGANNVEGY----YKDRRNDRIPNAK-------IPFPIIWYTGSVHITVNHDFVSFVLKSPQSKILLDSLKNQFIPEETYFSTLNYNSILRIPGSFVGGPDENQYHDGKSGGFITRFKNSGQYSCESKYIIRQICIWGVGDLPKLTSVPN---LFAHK 724
            Y P NYYCIHIDKK+++ F+ A + +V C+     N    K RV V+WG +S++ AEL+CM EL + FK WKY+INL GQ+FPL  N E+V++LK+  G NN+E      Y   R + + + +        P  +I   GSVH  +   F  FVL+   ++ LL  L++ F  +E +F+TL Y+     PG   G   E           I R K      C  +Y +R IC   + DL  + S  N   LF +K
Sbjct:   42 YMPQNYYCIHIDKKTNSYFVDAAQRMVACLP----NVFIAKTRVNVKWGEISLVKAELSCMTEL-QTFK-WKYYINLVGQDFPLYNNMEIVRVLKSLHGLNNIESIEMPAYNVHRVEFVRHGQKLLRKSPPPHGLIIRKGSVHGILTRKFTEFVLRDKVARDLLKWLEDVFAADEIFFATLQYDQA--TPGGIHGQQPE----------CIARVKRWRPGYCAGRY-VRNICWIDIRDLTWVLSEGNNRKLFVNK 277          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Nematostella
Match: EDO37446 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFS7])

HSP 1 Score: 128.257 bits (321), Expect = 1.873e-34
Identity = 83/280 (29.64%), Postives = 131/280 (46.79%), Query Frame = 2
Query:    2 YRPWNYYCIHIDKKSSNDFISAIEELVKCINLKSNNTINTKNRVEVEWGTMSVLTAELNCMKELYENFKDWKYFINLSGQEFPLKTNAELVKILKAFKGANNVEG--------------YYKDRRNDRIPNAKIPFPIIWYTGSVHITVNHDFVSFVLKSPQSKILLDSLKNQFIPEETYFSTLNYNSILRIPGSFVGGPDENQYHDGKSGGFITR-----FKNSGQYSCESKY--IIRQICIWGVGDLPKLTSVPN---LFAHKFREDFQPATLRCLEK 769
            Y P N YCIHID+K+   F  A+++++ C+     N       V+V WG  S++ A++NC++ L ++   WKY++++ GQ+FPL TN E+V+ +K     NN+E               Y   R   +I     PF I    G++H  +   FV F+L+S  +   +D   +  +P+ET+F+++                   Q H G  GG +       FK    Y  +  Y  IIRQ+C   + DL  + S  N   LF HK   D+    L CL +
Sbjct:   28 YMPHNVYCIHIDRKTRQSFHKAVKQMISCLP----NVFIASKLVKVYWGEFSIVQAKMNCLRNLLKSPVKWKYYLHMIGQDFPLYTNHEMVRAIKTLNYTNNMESIKVPISNRDRTEYVYIGSRTRTKILKPPPPFNITLRKGNIHAMLTRGFVEFLLESEIANAFIDWCNDTSVPDETFFASM-------------------QNHPGAPGGVVGDQPPYIFKLIRWYWFDRCYGRIIRQVCWIDIKDLRSVLSQFNLSFLFVHKIPFDYDIELLDCLSQ 284          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Nematostella
Match: EDO36835 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHI4])

HSP 1 Score: 50.8322 bits (120), Expect = 5.468e-7
Identity = 67/293 (22.87%), Postives = 120/293 (40.96%), Query Frame = 2
Query:    2 YRPWNYYCIHIDKKSSNDFISAIEELVKCINLKSNNTINTKNRVEVEWGTMSVLTAELNCMKELYENFKDWK--YFINLSGQEFPLKTNAELVKILKAFKGANNVEGYYK------------------DRRNDRIPNAKIPFPIIWYTGSVHITVNHDFVSFVLKSPQSKILLDSLKNQF----IPEETYFSTLNYNSILRIPGSFVGGPDENQYHDGKSGGFITRFKNSGQYSCESKYIIRQICI----WGVGDLPKL----TSVPNLFAHKFREDFQPATLRCLEKWYYEK 784
            Y   +Y+  HID +S  D++    E+   I    N  +   +   + WG  ++L   L  M++L    K+WK  +FINLSG +FP+K N  L   L++ +  N ++ + +                  D    R+ + K+P  +    GS  I +N  +  +++ S     L+  LK+ +    +P E++F T   N           GP    +    S   +T +K      C+ K+I+         +   D+ ++    +   N FA KF        +  L++W Y K
Sbjct:  102 YHTHHYFYFHIDTRS--DYLR--REVSNMIKDFPNAALAPWSMATI-WGGATLLQMLLKSMEDLIAR-KEWKWDFFINLSGNDFPIKVNTVLSSFLRSHRDVNFLKPHGRDIARFIKKQGLDRTFLQCDEHMWRLGDRKLPADLDIDGGSDWIALNRKYCDYLVTSRDE--LVTGLKHMYRYTLLPAESFFHTALRN-----------GPHCQNWL--SSNLRLTNWKRKLGCRCQYKHIVDWCGCSPNNFKPEDMARIKVNQSQSTNFFARKFEAIVNQEVINQLDEWLYGK 373          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Medaka
Match: ENSORLT00000007218.2 (glucosaminyl (N-acetyl) transferase 1 [Source:NCBI gene;Acc:101157299])

HSP 1 Score: 138.272 bits (347), Expect = 1.092e-36
Identity = 89/294 (30.27%), Postives = 144/294 (48.98%), Query Frame = 2
Query:    2 YRPWNYYCIHIDKKSSNDFISAIEELVKCINLKSNNTINTKNRVEVEWGTMSVLTAELNCMKELYENFKDWKYFINLSGQEFPLKTNAELVKILKAFKGANNVEG-------YYKDRRNDRIPNAKI----------PFPIIWYTGSVHITVNHDFVSFVLKSPQSKILLDSLKNQFIPEETYFSTLNYNSILRIPGSFVGGPDENQYHDGKSGGFITR-----FKNSGQYSCESKYI------IRQICIWGVGDLPKLTSVPNLFAHKFREDFQPATLRCLEKWYYEKVEREI 799
            Y P N+YC+H+DKK+     +AI  +  C      N       V+V +     + A+LNCM +LY   + WKYF+NL GQ+FPLKTN E+V+ILK   G N++E         ++     +I + KI          PF +   +G+ +I  +  ++  VL   + + L++ +K+ + P+E  ++T     I RIPG   G    N+ +D      + R     +    Q S ++ Y       +R IC++G GDL  L    + FA+KF  D  P  + CLE++  +K   E+
Sbjct:  143 YAPQNFYCVHVDKKAEPSVFAAILAISSCFP----NVFLVSQSVDVVYAGWPRVQADLNCMADLYNTSRRWKYFLNLCGQDFPLKTNLEMVRILKTLNGGNSMESENMPPEKKWRVTNAHQIVDGKIQAKGEAKSPSPFNLPIMSGNAYIVASRGYIHSVLHDKRIQALIEWMKDTYSPDEAIWAT-----IQRIPG-VPGSTRPNRKYDVSDINALARLVKWQWHEGSQDSLDALYPVCHGNHVRAICVYGAGDLQWLLENHHFFANKFDTDTDPIAIYCLERYLRKKALAEL 426          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Medaka
Match: gcnt7 (beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 7-like [Source:NCBI gene;Acc:101157298])

HSP 1 Score: 131.339 bits (329), Expect = 4.017e-34
Identity = 93/287 (32.40%), Postives = 141/287 (49.13%), Query Frame = 2
Query:    2 YRPWNYYCIHIDKKSSNDFISAIEELVKCINLKSNNTINTKNRVEVEWGTMSVLTAELNCMKELYENFKDWKYFINLSGQEFPLKTNAELVKIL--KAFKGANNVEG-----YYKDR---RNDRIPNAKI----------PFPIIWYTGSVHITVNHDFVSFVLKSPQSKILLDSLKNQFIPEETYFSTLNYNSILRIPGSFVGGPDENQYHDGKSGGFITRFK-----NSGQYSCESKYIIRQICIWGVGDLPKLTSVPNLFAHKFREDFQPATLRCLEKWYYEKV 787
            Y P N YCIHID K+  ++   +  LV C      N   +     V +G  S L A+LNCMK+L  +   WK  +NL GQ+FP+K+N ELV+ +  K ++  N   G     + + R   ++  I  + +          P  +  Y G+ +  +   FV FVLKSP +  LL   K+ + P+E Y+ TLN+  +   PGS V         DG   G I   K      +    C+  Y+ R IC++G+GD+  + +  N+FA+KF  +  P  L CLE+W+  KV
Sbjct:  125 YMPQNVYCIHIDAKAPLEYKKVVRGLVGCFE----NIFLSSQSETVTYGGYSRLQADLNCMKDLIRSNVGWKKVVNLCGQDFPIKSNLELVQYMQSKEWRDKNLTPGVKQPAHIRSRTEFQHQEIVGSHVIQKGEKKEPPPDNLQIYFGTAYYALTRAFVDFVLKSPIALNLLKWSKDAYSPDEHYWVTLNH--LKEAPGSRV---------DGGWEGDIRAIKWKDQEGTNHQGCKGHYV-RDICVYGMGDIEWIINNNNMFANKFESNAYPEALDCLEQWHRSKV 395          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Medaka
Match: gcnt3 (glucosaminyl (N-acetyl) transferase 3, mucin type [Source:NCBI gene;Acc:101155272])

HSP 1 Score: 125.561 bits (314), Expect = 4.613e-32
Identity = 87/282 (30.85%), Postives = 139/282 (49.29%), Query Frame = 2
Query:    2 YRPWNYYCIHIDKKSSNDFISAIEELVKCINLKSNNTINTKNRVEVEWGTMSVLTAELNCMKELYENFKDWKYFINLSGQEFPLKTNAELVKILKAFKGANNVE----GYYKDRRND-----------RIPNAKIPFPII--WYTGSVHITVNHDFVSFVLKSPQSKILLDSLKNQFIPEETYFSTLNYNSILRIPGSFVGGPDENQYHDGKSGGFITRFK---NSGQY-------SCESKYIIRQICIWGVGDLPKLTSVPNLFAHKFREDFQPATLRCLE 766
            Y P N YC+H+D+KSS ++ +A++ +V C      N         V + + S + A+LNCMK+L  +   WKY +N  G +FP+KTN E+V  LK   G N++E      YK  R +           R    K P PI    Y+G+ +  V+  FV  ++K  +++ L+D  K+ + P+E  ++TL    + ++PGS    P  ++Y       F    K   ++G          C   Y  R +C++GVGDL  L    +LFA+KF  +     +RC+E
Sbjct:  134 YAPQNVYCVHVDQKSSPEYQTAVKRIVSCFP----NIFIASKLERVVYASWSRVQADLNCMKDLLNSDVPWKYLLNTCGTDFPIKTNREMVSALKLLNGRNSMETEVTNDYKKGRWEYHHNVTDTSVIRTGVKKSPPPISSPMYSGNAYFIVSRAFVKHLMKDEEAQRLIDWEKDTYSPDEHLWATL--QRMPQVPGSL---PFNSKYDTSDMLAFARAVKWVYHTGDVRKGAPYPPCTGTY-RRAVCVYGVGDLLWLLQTHHLFANKFDPEVDDIAIRCME 405          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Medaka
Match: si:dkeyp-87d8.8 (glucosaminyl (N-acetyl) transferase 4 [Source:NCBI gene;Acc:101166645])

HSP 1 Score: 125.176 bits (313), Expect = 9.085e-32
Identity = 93/300 (31.00%), Postives = 148/300 (49.33%), Query Frame = 2
Query:    2 YRPWNYYCIHIDKKSSNDFISAIEELVKCINLKSNNTINTKNRVEVEWGTMSVLTAELNCMKELYENFKDWKYFINLSGQEFPLKTNAELVKILKAFKGANNVE-----GYYKDRRN----------------DRIPNAKIPFP--IIWYTGSVHITVNHDFVSFVLKSPQSKILLDSLKNQFIPEETYFSTLNYNSILRIPGSFVG--GPDENQYHDGKSGGFITRFK--NSGQYSCESKYIIRQICIWGVGDLPKLTSVPNLFAHKFREDFQPATLRCLEKWYYEKVEREIWTEKLLT 820
            Y P N YCIH D+KS+  F +A+E L +C+     N      R  V + ++S L A+LNC+ +L E+   WKY INL GQ+FPLK+N ELV  L+   G+N +E        KDR +                 R   AK P P  I  + G+ +  ++ +F+  +  S  +    D  K+ + P+E +++TL     +R+PG F G    ++    D  S   + ++       Y   +   +R +CI+G G+L  L +  + FA+KF     P  ++CLE+   EK +R ++T   LT
Sbjct:  140 YSPVNVYCIHYDQKSTPQFTAAMEGLARCLP----NVFIASKRESVFYASISRLQADLNCLHDLVESEVKWKYVINLCGQDFPLKSNMELVSELRKLNGSNMLETSRPSNIKKDRFSFHHELKDASFEYQKLPVRTDQAKSPPPHGIEMFIGNAYFVLSREFILHMTSSVIAMDFFDWSKDTYSPDEHFWATL-----VRVPG-FPGEVAREKPDITDLMSKTRLVKWSYLEGSLYPLCTGEHVRSVCIYGCGELRWLLNYGHWFANKFEPKVDPVLIQCLEERLEEK-QRSLFTRTSLT 428          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Medaka
Match: ENSORLT00000033084.1 (xylosyltransferase 1 [Source:NCBI gene;Acc:100049491])

HSP 1 Score: 68.9366 bits (167), Expect = 2.845e-12
Identity = 57/197 (28.93%), Postives = 92/197 (46.70%), Query Frame = 2
Query:    2 YRPWNYYCIHIDKKSSNDFISAIEELVKCINLKSNNTINTKNRVEVEWGTMSVLTAELNCMKELYENFK-DWKYFINLSGQEFPLKTNAELVKILKAFKGANNVEGYYKD-----RRND-------------RIPNAKIPFPIIWYTGSVHITVNHDFVSFVLKSPQSKILLDSLKN----QFIPEETYFSTLNYNS 523
            Y   +YY IH+D++S  DF+      V  +  +  N   T  R+   WG  S+LT  L  M++L       W +FINLS  +FP++TN +LV  L   +  N ++ + +D     R+               R+ + KIP  I    GS    ++  FV +V+ S     L++S+K       +P E++F T+  NS
Sbjct:  369 YHTSHYYYIHVDQRS--DFL---HREVLSLARQYPNVRVTPWRMATIWGGASLLTMYLRSMEDLLSMTDWSWDFFINLSAADFPIRTNEQLVAFLSKHRSKNFIKSHGRDNARFIRKQGLDRLFLECDAHMWRLGDRKIPEGIAVDGGSDWFLLSRSFVDYVVNS--GDELVNSMKRFYAYTLLPAESFFHTVLENS 558          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Planmine SMEST
Match: SMESG000009072.1 (SMESG000009072.1)

HSP 1 Score: 560.836 bits (1444), Expect = 0.000e+0
Identity = 266/270 (98.52%), Postives = 269/270 (99.63%), Query Frame = 2
Query:    2 YRPWNYYCIHIDKKSSNDFISAIEELVKCINLKSNNTINTKNRVEVEWGTMSVLTAELNCMKELYENFKDWKYFINLSGQEFPLKTNAELVKILKAFKGANNVEGYYKDRRNDRIPNAKIPFPIIWYTGSVHITVNHDFVSFVLKSPQSKILLDSLKNQFIPEETYFSTLNYNSILRIPGSFVGGPDENQYHDGKSGGFITRFKNSGQYSCESKYIIRQICIWGVGDLPKLTSVPNLFAHKFREDFQPATLRCLEKWYYEKVEREIWTEK 811
            YRPWNYYCIHIDKKSSNDFISAIEELVKCINLKSNNTINTKNRVEVEWGTMSVLTAELNCMKELYENFKDWKYFINLSGQEFPLKTNAELVKILKAFKGANNVEGYYKDRRNDRIPNAKIPFPIIWYTGSVHITVNHDFVSFVLKSPQSKILLDSLKNQFIPEE+YFSTLNYNSILRIPGSFVGGPDENQYHDGKSGGFITRFKNSGQYSCESKYIIRQICIWGVGDLPKLTSVPNLFAHKFREDFQPATLRCLEKWYYEKVE+EIWT +
Sbjct:   77 YRPWNYYCIHIDKKSSNDFISAIEELVKCINLKSNNTINTKNRVEVEWGTMSVLTAELNCMKELYENFKDWKYFINLSGQEFPLKTNAELVKILKAFKGANNVEGYYKDRRNDRIPNAKIPFPIIWYTGSVHITVNHDFVSFVLKSPQSKILLDSLKNQFIPEESYFSTLNYNSILRIPGSFVGGPDENQYHDGKSGGFITRFKNSGQYSCESKYIIRQICIWGVGDLPKLTSVPNLFAHKFREDFQPATLRCLEKWYYEKVEKEIWTGR 346          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Planmine SMEST
Match: SMESG000051787.1 (SMESG000051787.1)

HSP 1 Score: 400.593 bits (1028), Expect = 3.087e-138
Identity = 185/265 (69.81%), Postives = 220/265 (83.02%), Query Frame = 2
Query:    2 YRPWNYYCIHIDKKSSNDFISAIEELVKCINLKSNNTINTKNRVEVEWGTMSVLTAELNCMKELYENFKDWKYFINLSGQEFPLKTNAELVKILKAFKGANNVEGYYKDRRNDRIPNAKIPFPIIWYTGSVHITVNHDFVSFVLKSPQSKILLDSLKNQFIPEETYFSTLNYNSILRIPGSFVGGPDENQYHDGKSGGFITRFKNSGQYSCESKYIIRQICIWGVGDLPKLTSVPNLFAHKFREDFQPATLRCLEKWYYEKVERE 796
            YRPWNYYCIH+D KS  +F+ AI +L +C+N K NN INT NRV+V+WG MSVLTA+LNCMKELY+ +K+WKYFINL+GQEFPLKTNAELVKILKAFKGAN+VE YYK R ++RIP  K+PFPIIWYTGSVHI VN DFVSF+ +SP SK+LLDSL N FIP+ET+FSTLNYN  LRI GS+VG PDE Q  +   G   TR+KN GQY CESK I+R ICI GVGDLP++ + PNLFA+KF E+FQPATLRCLE+W Y+KV++E
Sbjct:  135 YRPWNYYCIHVDTKSKPEFVKAIGKLTECLNSKHNNVINTDNRVDVQWGKMSVLTADLNCMKELYQRYKNWKYFINLTGQEFPLKTNAELVKILKAFKGANHVEAYYKRRFDNRIPTVKMPFPIIWYTGSVHIIVNLDFVSFIFESPVSKVLLDSLNNHFIPDETFFSTLNYNPQLRISGSYVGNPDEIQSQNDSLGYMKTRYKNWGQYPCESKKIVRDICILGVGDLPRIVNAPNLFANKFYEEFQPATLRCLERWIYDKVDKE 399          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Planmine SMEST
Match: SMESG000051787.1 (SMESG000051787.1)

HSP 1 Score: 400.208 bits (1027), Expect = 4.618e-138
Identity = 185/265 (69.81%), Postives = 220/265 (83.02%), Query Frame = 2
Query:    2 YRPWNYYCIHIDKKSSNDFISAIEELVKCINLKSNNTINTKNRVEVEWGTMSVLTAELNCMKELYENFKDWKYFINLSGQEFPLKTNAELVKILKAFKGANNVEGYYKDRRNDRIPNAKIPFPIIWYTGSVHITVNHDFVSFVLKSPQSKILLDSLKNQFIPEETYFSTLNYNSILRIPGSFVGGPDENQYHDGKSGGFITRFKNSGQYSCESKYIIRQICIWGVGDLPKLTSVPNLFAHKFREDFQPATLRCLEKWYYEKVERE 796
            YRPWNYYCIH+D KS  +F+ AI +L +C+N K NN INT NRV+V+WG MSVLTA+LNCMKELY+ +K+WKYFINL+GQEFPLKTNAELVKILKAFKGAN+VE YYK R ++RIP  K+PFPIIWYTGSVHI VN DFVSF+ +SP SK+LLDSL N FIP+ET+FSTLNYN  LRI GS+VG PDE Q  +   G   TR+KN GQY CESK I+R ICI GVGDLP++ + PNLFA+KF E+FQPATLRCLE+W Y+KV++E
Sbjct:  134 YRPWNYYCIHVDTKSKPEFVKAIGKLTECLNSKHNNVINTDNRVDVQWGKMSVLTADLNCMKELYQRYKNWKYFINLTGQEFPLKTNAELVKILKAFKGANHVEAYYKRRFDNRIPTVKMPFPIIWYTGSVHIIVNLDFVSFIFESPVSKVLLDSLNNHFIPDETFFSTLNYNPQLRISGSYVGNPDEIQSQNDSLGYMKTRYKNWGQYPCESKKIVRDICILGVGDLPRIVNAPNLFANKFYEEFQPATLRCLERWIYDKVDKE 398          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Planmine SMEST
Match: SMESG000051810.1 (SMESG000051810.1)

HSP 1 Score: 397.127 bits (1019), Expect = 6.115e-137
Identity = 184/265 (69.43%), Postives = 219/265 (82.64%), Query Frame = 2
Query:    2 YRPWNYYCIHIDKKSSNDFISAIEELVKCINLKSNNTINTKNRVEVEWGTMSVLTAELNCMKELYENFKDWKYFINLSGQEFPLKTNAELVKILKAFKGANNVEGYYKDRRNDRIPNAKIPFPIIWYTGSVHITVNHDFVSFVLKSPQSKILLDSLKNQFIPEETYFSTLNYNSILRIPGSFVGGPDENQYHDGKSGGFITRFKNSGQYSCESKYIIRQICIWGVGDLPKLTSVPNLFAHKFREDFQPATLRCLEKWYYEKVERE 796
            YRPWNYYCIH+D KS  +F+ AI +L +C+N K NN INT NRV+V+WG MSVLTA+LNCMKELY+ +K+WKYFINL+GQEFPLKTNAELVKILKAFKGAN+VE YYK R ++RIP  K+PFPIIWYTGSVHI VN DFVSF+ +SP SK+LLDSL N FIP+ET+FSTLNYN  LRI GS+VG PDE Q  +   G   TR+KN GQY CESK I+  ICI GVGDLP++ + PNLFA+KF E+FQPATLRCLE+W Y+KV++E
Sbjct:  135 YRPWNYYCIHVDTKSKPEFVKAIGKLTECLNSKHNNVINTDNRVDVQWGKMSVLTADLNCMKELYQRYKNWKYFINLTGQEFPLKTNAELVKILKAFKGANHVEAYYKRRFDNRIPTVKMPFPIIWYTGSVHIIVNLDFVSFIFESPVSKVLLDSLNNHFIPDETFFSTLNYNPQLRISGSYVGNPDEIQSQNDSLGYMKTRYKNWGQYPCESKKIVPDICILGVGDLPRIVNAPNLFANKFYEEFQPATLRCLERWIYDKVDKE 399          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Planmine SMEST
Match: SMESG000051810.1 (SMESG000051810.1)

HSP 1 Score: 397.127 bits (1019), Expect = 7.684e-137
Identity = 184/265 (69.43%), Postives = 219/265 (82.64%), Query Frame = 2
Query:    2 YRPWNYYCIHIDKKSSNDFISAIEELVKCINLKSNNTINTKNRVEVEWGTMSVLTAELNCMKELYENFKDWKYFINLSGQEFPLKTNAELVKILKAFKGANNVEGYYKDRRNDRIPNAKIPFPIIWYTGSVHITVNHDFVSFVLKSPQSKILLDSLKNQFIPEETYFSTLNYNSILRIPGSFVGGPDENQYHDGKSGGFITRFKNSGQYSCESKYIIRQICIWGVGDLPKLTSVPNLFAHKFREDFQPATLRCLEKWYYEKVERE 796
            YRPWNYYCIH+D KS  +F+ AI +L +C+N K NN INT NRV+V+WG MSVLTA+LNCMKELY+ +K+WKYFINL+GQEFPLKTNAELVKILKAFKGAN+VE YYK R ++RIP  K+PFPIIWYTGSVHI VN DFVSF+ +SP SK+LLDSL N FIP+ET+FSTLNYN  LRI GS+VG PDE Q  +   G   TR+KN GQY CESK I+  ICI GVGDLP++ + PNLFA+KF E+FQPATLRCLE+W Y+KV++E
Sbjct:  134 YRPWNYYCIHVDTKSKPEFVKAIGKLTECLNSKHNNVINTDNRVDVQWGKMSVLTADLNCMKELYQRYKNWKYFINLTGQEFPLKTNAELVKILKAFKGANHVEAYYKRRFDNRIPTVKMPFPIIWYTGSVHIIVNLDFVSFIFESPVSKVLLDSLNNHFIPDETFFSTLNYNPQLRISGSYVGNPDEIQSQNDSLGYMKTRYKNWGQYPCESKKIVPDICILGVGDLPRIVNAPNLFANKFYEEFQPATLRCLERWIYDKVDKE 398          
The following BLAST results are available for this feature:
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GCNT21.575e-3833.92glucosaminyl (N-acetyl) transferase 2 (I blood gro... [more]
GCNT21.575e-3833.92glucosaminyl (N-acetyl) transferase 2 (I blood gro... [more]
GCNT23.497e-3632.51glucosaminyl (N-acetyl) transferase 2 (I blood gro... [more]
GCNT28.437e-3632.86glucosaminyl (N-acetyl) transferase 2 (I blood gro... [more]
GCNT28.437e-3632.86glucosaminyl (N-acetyl) transferase 2 (I blood gro... [more]
back to top
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gly-13.577e-2828.04GLY-1; GLYcosylation related [Source:UniProtKB/Tr... [more]
gly-179.927e-2827.92GLYcosylation related [Source:UniProtKB/TrEMBL;Ac... [more]
gly-151.233e-2630.58GLYcosylation related [Source:UniProtKB/TrEMBL;Ac... [more]
gly-165.894e-2527.11GLY-16; GLYcosylation related [Source:UniProtKB/T... [more]
gly-191.050e-2428.47GLY-19; GLYcosylation related [Source:UniProtKB/T... [more]
back to top
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
oxt2.229e-1626.64gene:FBgn0015360 transcript:FBtr0072904[more]
back to top
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gcnt71.306e-3733.33glucosaminyl (N-acetyl) transferase family member ... [more]
gcnt4b4.139e-3532.07glucosaminyl (N-acetyl) transferase 4b [Source:ZFI... [more]
gcnt4b4.173e-3532.07glucosaminyl (N-acetyl) transferase 4b [Source:ZFI... [more]
si:dkeyp-87d8.81.016e-3432.41si:dkeyp-87d8.8 [Source:ZFIN;Acc:ZDB-GENE-041111-1... [more]
si:dkeyp-87d8.81.353e-3431.72si:dkeyp-87d8.8 [Source:ZFIN;Acc:ZDB-GENE-041111-1... [more]
back to top
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gcnt2.22.256e-4335.40glucosaminyl (N-acetyl) transferase 2 (I blood gro... [more]
adsl1.782e-4234.67adenylosuccinate lyase [Source:Xenbase;Acc:XB-GENE... [more]
umod.11.781e-4135.56uromodulin (uromucoid, Tamm-Horsfall glycoprotein)... [more]
gcnt2.24.401e-3833.21glucosaminyl (N-acetyl) transferase 2 (I blood gro... [more]
ccdc772.396e-3530.63coiled-coil domain containing 77 [Source:Xenbase;A... [more]
back to top
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gcnt11.323e-3831.45glucosaminyl (N-acetyl) transferase 1, core 2 [Sou... [more]
Gcnt11.323e-3831.45glucosaminyl (N-acetyl) transferase 1, core 2 [Sou... [more]
Gcnt11.323e-3831.45glucosaminyl (N-acetyl) transferase 1, core 2 [Sou... [more]
Gcnt11.323e-3831.45glucosaminyl (N-acetyl) transferase 1, core 2 [Sou... [more]
Gcnt25.275e-3732.73glucosaminyl (N-acetyl) transferase 2, I-branching... [more]
back to top
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q09324|GCNT1_MOUSE9.253e-3831.45Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1... [more]
sp|P97402|GCNT2_MOUSE4.349e-3634.42N-acetyllactosaminide beta-1,6-N-acetylglucosaminy... [more]
sp|Q8N0V5|GNT2A_HUMAN4.052e-3532.86N-acetyllactosaminide beta-1,6-N-acetylglucosaminy... [more]
sp|Q92180|GCNT1_BOVIN1.230e-3330.50Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1... [more]
sp|Q8CH87|GCNT3_RAT1.857e-3330.53Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1... [more]
back to top
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2T7P1443.710e-6644.74Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A2T7P1398.210e-6644.36Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A2T7P1544.051e-6544.36Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A2C9JUK01.013e-6445.86Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A2T7NME51.354e-6443.01Uncharacterized protein OS=Pomacea canaliculata OX... [more]
back to top
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000050168.11.354e-4334.04pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000026751.24.574e-4235.46glucosaminyl (N-acetyl) transferase 1 [Source:NCBI... [more]
gcnt4b1.496e-3431.62beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1... [more]
gcnt4a5.568e-3332.07glucosaminyl (N-acetyl) transferase 4 [Source:NCBI... [more]
gcnt31.057e-2926.21glucosaminyl (N-acetyl) transferase 3, mucin type ... [more]
back to top
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GCNT24.350e-3733.22glucosaminyl (N-acetyl) transferase 2 (I blood gro... [more]
gcnt35.102e-3428.47glucosaminyl (N-acetyl) transferase 3, mucin type ... [more]
gcnt35.097e-3327.03glucosaminyl (N-acetyl) transferase 3, mucin type ... [more]
gcnt4a4.393e-3129.71glucosaminyl (N-acetyl) transferase 4a [Source:NCB... [more]
gcnt4a4.473e-3129.71glucosaminyl (N-acetyl) transferase 4a [Source:NCB... [more]
back to top
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO396172.433e-3836.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO374461.873e-3429.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO368355.468e-722.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000007218.21.092e-3630.27glucosaminyl (N-acetyl) transferase 1 [Source:NCBI... [more]
gcnt74.017e-3432.40beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1... [more]
gcnt34.613e-3230.85glucosaminyl (N-acetyl) transferase 3, mucin type ... [more]
si:dkeyp-87d8.89.085e-3231.00glucosaminyl (N-acetyl) transferase 4 [Source:NCBI... [more]
ENSORLT00000033084.12.845e-1228.93xylosyltransferase 1 [Source:NCBI gene;Acc:1000494... [more]
back to top
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000009072.10.000e+098.52SMESG000009072.1[more]
SMESG000051787.13.087e-13869.81SMESG000051787.1[more]
SMESG000051787.14.618e-13869.81SMESG000051787.1[more]
SMESG000051810.16.115e-13769.43SMESG000051810.1[more]
SMESG000051810.17.684e-13769.43SMESG000051810.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011842 ID=SMED30011842|Name=beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3|organism=Schmidtea mediterranea sexual|type=transcript|length=1109bp
TTATCGACCTTGGAATTATTATTGCATTCATATTGATAAAAAATCTAGTA
ATGACTTTATTTCTGCAATTGAGGAGTTAGTAAAGTGTATCAACTTAAAA
TCGAATAACACCATAAATACCAAAAATCGTGTCGAAGTGGAATGGGGTAC
GATGTCTGTGTTAACGGCAGAGTTAAATTGCATGAAAGAACTCTATGAGA
ATTTCAAAGATTGGAAATATTTCATTAATTTATCAGGACAAGAATTTCCA
TTGAAAACGAATGCAGAGTTGGTAAAAATACTCAAAGCTTTCAAAGGAGC
CAACAATGTTGAAGGCTACTATAAGGACAGACGTAATGACAGAATTCCTA
ATGCAAAAATTCCTTTTCCGATAATTTGGTACACGGGATCTGTTCATATC
ACTGTAAATCATGATTTTGTTTCTTTCGTGCTTAAATCCCCTCAATCTAA
AATCCTCCTTGATTCATTGAAAAACCAATTTATTCCAGAAGAAACGTACT
TTTCAACTCTCAATTACAATTCAATTCTTAGAATCCCTGGATCCTTTGTT
GGTGGCCCAGATGAAAACCAATATCATGATGGAAAATCCGGAGGTTTCAT
AACTCGATTCAAAAATTCGGGCCAATATTCCTGTGAAAGTAAGTACATAA
TTCGGCAAATCTGCATTTGGGGTGTCGGTGATTTGCCGAAATTGACGAGT
GTTCCTAATTTGTTCGCTCACAAATTTCGCGAAGATTTTCAGCCAGCAAC
TCTACGATGCTTAGAAAAATGGTATTACGAAAAAGTTGAAAGGGAAATTT
GGACCGAAAAATTATTGACTATCCTCATTGGAAAAATGGCTGAGATATTT
TCAAAGATACTTTCAGGGATGATATGCTGTGCACCAGAAATAATTCCTTT
TCATATATTTATGGCTACAGGAATTTACCTAGAAATGGTTCTCCAAAAAT
ATCTACAGTACACAAACCAAGACCTACTAAAGGTTGATAATTGCACGCAG
AAGGAAATACTTGATTTGGGTATTAAAATCAGAACTAAAGAAATTTAGAA
CATCCGTTGATTGTAATCAATAGTTTTAGTTGATGGAATAAATGTATTTA
TTTTTTGTC
back to top

protein sequence of SMED30011842-orf-1

>SMED30011842-orf-1 ID=SMED30011842-orf-1|Name=SMED30011842-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=349bp
YRPWNYYCIHIDKKSSNDFISAIEELVKCINLKSNNTINTKNRVEVEWGT
MSVLTAELNCMKELYENFKDWKYFINLSGQEFPLKTNAELVKILKAFKGA
NNVEGYYKDRRNDRIPNAKIPFPIIWYTGSVHITVNHDFVSFVLKSPQSK
ILLDSLKNQFIPEETYFSTLNYNSILRIPGSFVGGPDENQYHDGKSGGFI
TRFKNSGQYSCESKYIIRQICIWGVGDLPKLTSVPNLFAHKFREDFQPAT
LRCLEKWYYEKVEREIWTEKLLTILIGKMAEIFSKILSGMICCAPEIIPF
HIFMATGIYLEMVLQKYLQYTNQDLLKVDNCTQKEILDLGIKIRTKEI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000136whole organism
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR003406Glyco_trans_14
Vocabulary: molecular function
TermDefinition
GO:0008375acetylglucosaminyltransferase activity
GO:0016740transferase activity
GO:0016757transferase activity, transferring glycosyl groups
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003406Glycosyl transferase, family 14PFAMPF02485Branchcoord: 2..178
e-value: 1.4E-30
score: 106.6
NoneNo IPR availablePANTHERPTHR19297GLYCOSYLTRANSFERASE 14 FAMILY MEMBERcoord: 1..262
NoneNo IPR availablePANTHERPTHR19297:SF179GLUCOSAMINYL (N-ACETYL) TRANSFERASE 2, I-BRANCHING ENZYME (I BLOOD GROUP)coord: 1..262