TRAF interacting protein

Overview
NameTRAF interacting protein (AFJ24729.1)
Smed IDSMED30011838
Length (bp)1175
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of TRAF interacting protein (SMED30011838) t-SNE clustered cells

Violin plots show distribution of expression levels for TRAF interacting protein (SMED30011838) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of TRAF interacting protein (SMED30011838) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for TRAF interacting protein (SMED30011838) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011838

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30011838SMESG000027291.1 SmedASXL_010077SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
zeta neoblastSMED30011838SMESG000027291.1 dd_Smed_v4_15562_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30011838SMESG000027291.1 SMED_07668_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30011838SMESG000027291.1 SMED_07668_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of TRAF interacting protein vs. Ensembl Human
Match: TRAIP (TRAF interacting protein [Source:HGNC Symbol;Acc:HGNC:30764])

HSP 1 Score: 67.781 bits (164), Expect = 9.603e-12
Identity = 68/252 (26.98%), Postives = 112/252 (44.44%), Query Frame = 1
Query:   70 CSICQQSFSENCTVSALLCGHVFHSNCLTMWLNNK--SNCPQCRSPNVG--NYIKKLFFDKMXXXXXXXXXXXXXXXXXXFKLR-SELDKLKDLNYKITNELKIKSESNE----NLKKKLDQSQ---STQMSQYLSFTNQIYETNETNERFKMKLDKLKFMNDI---LKKSKPEIDLFIQKLPKDEPPQFKIEKLCSALVTCQNDLNYYKKNSDEISKKLARTIL----KNSTLKTEIDQLKEQMSNTDSNF 768
            C+IC   F  +  V+A+ CGH FH  CL  W        CPQCR   VG    I KLFFD   +  N    E      +N + + S+ DK K  +  I + L+   E       +L++ L +++   ST   Q      Q  ET +  E  +    K+K M  I   L+  +PE++  I+ +   +    ++   C +L     +L   +K S E++ KL + +     K  T+ +E+DQ K ++ +   + 
Sbjct:    7 CTICSDFFDHSRDVAAIHCGHTFHLQCLIQWFETAPSRTCPQCRI-QVGKRTIINKLFFDLAQEEENVLDAEFLKNELDNVRAQLSQKDKEKRDSQVIIDTLRDTLEERNATVVSLQQALGKAEMLCSTLKKQMKYLEQQQDETKQAQEEARRLRSKMKTMEQIELLLQSQRPEVEEMIRDMGVGQSAVEQLAVYCVSLKKEYENLKEARKASGEVADKLRKDLFSSRSKLQTVYSELDQAKLELKSAQKDL 257          
BLAST of TRAF interacting protein vs. Ensembl Human
Match: TRAIP (TRAF interacting protein [Source:HGNC Symbol;Acc:HGNC:30764])

HSP 1 Score: 60.4622 bits (145), Expect = 1.007e-9
Identity = 59/249 (23.69%), Postives = 101/249 (40.56%), Query Frame = 1
Query:   70 CSICQQSFSENCTVSALLCGHVFHSNCLTMWLNNK--SNCPQCRSPNVGNYIKKLF----FDKMXXXXXXXXXXXXXXXXXXFKLRSELDKLKDLNYKITNELKIKSESNENLKKKLDQSQ---STQMSQYLSFTNQIYETNETNERFKMKLDKLKFMNDI---LKKSKPEIDLFIQKLPKDEPPQFKIEKLCSALVTCQNDLNYYKKNSDEISKKLARTIL----KNSTLKTEIDQLKEQMSNTDSNF 768
            C+IC   F  +  V+A+ CGH FH  CL  W        CPQCR     N +   F     D +    +    E          LR   D L++ N  +            +L++ L +++   ST   Q      Q  ET +  E  +    K+K M  I   L+  +PE++  I+ +   +    ++   C +L     +L   +K S E++ KL + +     K  T+ +E+DQ K ++ +   + 
Sbjct:    7 CTICSDFFDHSRDVAAIHCGHTFHLQCLIQWFETAPSRTCPQCRIQEEENVLDAEFLKNELDNVRAQLSQKDKEKRDSQVIIDTLR---DTLEERNATVV-----------SLQQALGKAEMLCSTLKKQMKYLEQQQDETKQAQEEARRLRSKMKTMEQIELLLQSQRPEVEEMIRDMGVGQSAVEQLAVYCVSLKKEYENLKEARKASGEVADKLRKDLFSSRSKLQTVYSELDQAKLELKSAQKDL 241          
BLAST of TRAF interacting protein vs. Ensembl Human
Match: RNF103 (ring finger protein 103 [Source:HGNC Symbol;Acc:HGNC:12859])

HSP 1 Score: 59.3066 bits (142), Expect = 7.020e-9
Identity = 24/52 (46.15%), Postives = 31/52 (59.62%), Query Frame = 1
Query:   55 MLIC-HCSICQQSFSENCTVSALLCGHVFHSNCLTMWLNNKSN-CPQCRSPN 204
            ML C  C +C ++F   C +  L CGHVFH NC+ MWL    + CP CR P+
Sbjct:  615 MLHCTECVVCLENFENGCLLMGLPCGHVFHQNCIVMWLAGGRHCCPVCRWPS 666          
BLAST of TRAF interacting protein vs. Ensembl Human
Match: TRAIP (TRAF interacting protein [Source:HGNC Symbol;Acc:HGNC:30764])

HSP 1 Score: 55.4546 bits (132), Expect = 9.421e-9
Identity = 27/61 (44.26%), Postives = 32/61 (52.46%), Query Frame = 1
Query:   70 CSICQQSFSENCTVSALLCGHVFHSNCLTMWLNNKSN--CPQCR-SPNVG--NYIKKLFFD 237
            C+IC   F  +  V+A+ CGH FH  CL  W     +  CPQCR    VG    I KLFFD
Sbjct:    7 CTICSDFFDHSRDVAAIHCGHTFHLQCLIQWFETAPSRTCPQCRIQVRVGKRTIINKLFFD 67          
BLAST of TRAF interacting protein vs. Ensembl Human
Match: TRAIP (TRAF interacting protein [Source:HGNC Symbol;Acc:HGNC:30764])

HSP 1 Score: 52.7582 bits (125), Expect = 2.367e-8
Identity = 27/60 (45.00%), Postives = 32/60 (53.33%), Query Frame = 1
Query:   70 CSICQQSFSENCTVSALLCGHVFHSNCLTMWLNNKSN--CPQCRSPNVG--NYIKKLFFD 237
            C+IC   F  +  V+A+ CGH FH  CL  W     +  CPQCR   VG    I KLFFD
Sbjct:    7 CTICSDFFDHSRDVAAIHCGHTFHLQCLIQWFETAPSRTCPQCRI-QVGKRTIINKLFFD 65          
BLAST of TRAF interacting protein vs. Ensembl Celegans
Match: trul-1 (pep chromosome:WBcel235:II:279128:282576:-1 gene:WBGene00015194.1 transcript:B0432.13.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:trul-1)

HSP 1 Score: 69.707 bits (169), Expect = 9.038e-13
Identity = 26/62 (41.94%), Postives = 39/62 (62.90%), Query Frame = 1
Query:   58 LICHCSICQQSFSENCTVSALLCGHVFHSNCLTMWLNNKSNCPQCRS--PNVGNYIKKLFFD 237
            L   CSIC +   +N  +SA++CGH++H  C++ W+  K  CP CR   P  G +++KLFFD
Sbjct:    9 LQGSCSICFEDLKQNDKISAIVCGHIYHHGCISQWIATKRQCPSCRRTVPKNG-FVEKLFFD 69          
BLAST of TRAF interacting protein vs. Ensembl Celegans
Match: trul-1 (pep chromosome:WBcel235:II:278621:282576:-1 gene:WBGene00015194.1 transcript:B0432.13.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:trul-1)

HSP 1 Score: 69.707 bits (169), Expect = 9.038e-13
Identity = 26/62 (41.94%), Postives = 39/62 (62.90%), Query Frame = 1
Query:   58 LICHCSICQQSFSENCTVSALLCGHVFHSNCLTMWLNNKSNCPQCRS--PNVGNYIKKLFFD 237
            L   CSIC +   +N  +SA++CGH++H  C++ W+  K  CP CR   P  G +++KLFFD
Sbjct:    9 LQGSCSICFEDLKQNDKISAIVCGHIYHHGCISQWIATKRQCPSCRRTVPKNG-FVEKLFFD 69          
BLAST of TRAF interacting protein vs. Ensembl Celegans
Match: toe-4 (Target Of ERK kinase MPK-1 [Source:UniProtKB/TrEMBL;Acc:Q9XUM8])

HSP 1 Score: 49.2914 bits (116), Expect = 2.944e-6
Identity = 17/42 (40.48%), Postives = 24/42 (57.14%), Query Frame = 1
Query:   70 CSICQQSFSENCTVSALLCGHVFHSNCLTMWLNNKSNCPQCR 195
            C++C  SF +  ++  L C HVFH  C+  WL+    CP CR
Sbjct:  433 CTVCLSSFEDGESIQKLRCNHVFHPECIYKWLDINKRCPMCR 474          
BLAST of TRAF interacting protein vs. Ensembl Celegans
Match: plr-1 (Probable E3 ubiquitin-protein ligase plr-1 [Source:UniProtKB/Swiss-Prot;Acc:Q9U2B7])

HSP 1 Score: 48.9062 bits (115), Expect = 4.362e-6
Identity = 17/41 (41.46%), Postives = 22/41 (53.66%), Query Frame = 1
Query:   70 CSICQQSFSENCTVSALLCGHVFHSNCLTMWLNNKSNCPQC 192
            C IC + + E   +  L CGH FH  C+  WL +K  CP C
Sbjct:  317 CVICLEEYEEGTELRVLFCGHEFHPKCVDPWLLSKRRCPLC 357          
BLAST of TRAF interacting protein vs. Ensembl Celegans
Match: sel-11 (E3 ubiquitin-protein ligase hrd-1 [Source:UniProtKB/Swiss-Prot;Acc:Q20798])

HSP 1 Score: 47.7506 bits (112), Expect = 1.000e-5
Identity = 16/43 (37.21%), Postives = 25/43 (58.14%), Query Frame = 1
Query:   70 CSICQQSFSENCTVSALLCGHVFHSNCLTMWLNNKSNCPQCRS 198
            C IC++  + + +   L C HVFH++CL  W   +  CP CR+
Sbjct:  292 CIICREEMTVDASPKRLPCSHVFHAHCLRSWFQRQQTCPTCRT 334          
BLAST of TRAF interacting protein vs. Ensembl Fly
Match: nopo (gene:FBgn0034314 transcript:FBtr0086750)

HSP 1 Score: 61.6178 bits (148), Expect = 3.838e-10
Identity = 25/61 (40.98%), Postives = 36/61 (59.02%), Query Frame = 1
Query:   55 MLICHCSICQQSFSENCTVSALLCGHVFHSNCLTMWLNNKSNCPQCRSPNVGNYIKKLFFD 237
            ML  +C IC + F +   V A +CGH+FH NCL  WL+    CPQCR+      I +++F+
Sbjct:    1 MLNLNCVICAELFGQADEVFATVCGHMFHHNCLNQWLDRSKTCPQCRNKCTTRNIFRVYFN 61          
BLAST of TRAF interacting protein vs. Ensembl Fly
Match: nopo (gene:FBgn0034314 transcript:FBtr0332852)

HSP 1 Score: 61.6178 bits (148), Expect = 4.040e-10
Identity = 25/61 (40.98%), Postives = 36/61 (59.02%), Query Frame = 1
Query:   55 MLICHCSICQQSFSENCTVSALLCGHVFHSNCLTMWLNNKSNCPQCRSPNVGNYIKKLFFD 237
            ML  +C IC + F +   V A +CGH+FH NCL  WL+    CPQCR+      I +++F+
Sbjct:    1 MLNLNCVICAELFGQADEVFATVCGHMFHHNCLNQWLDRSKTCPQCRNKCTTRNIFRVYFN 61          
BLAST of TRAF interacting protein vs. Ensembl Fly
Match: CG10916 (gene:FBgn0034312 transcript:FBtr0086749)

HSP 1 Score: 58.9214 bits (141), Expect = 1.505e-9
Identity = 25/56 (44.64%), Postives = 32/56 (57.14%), Query Frame = 1
Query:   70 CSICQQSFSENCTV-SALLCGHVFHSNCLTMWLNNKSNCPQCRSPNVGNYIKKLFF 234
            C+IC + F  N  + S   CGHVFH +CLT WLN    CPQCR P     + +L+ 
Sbjct:   32 CAICNEFFRANDIIFSTSRCGHVFHKDCLTRWLNRSRTCPQCRDPCDRRRVHRLYL 87          
BLAST of TRAF interacting protein vs. Ensembl Fly
Match: CG10916 (gene:FBgn0034312 transcript:FBtr0332853)

HSP 1 Score: 58.9214 bits (141), Expect = 1.505e-9
Identity = 25/56 (44.64%), Postives = 32/56 (57.14%), Query Frame = 1
Query:   70 CSICQQSFSENCTV-SALLCGHVFHSNCLTMWLNNKSNCPQCRSPNVGNYIKKLFF 234
            C+IC + F  N  + S   CGHVFH +CLT WLN    CPQCR P     + +L+ 
Sbjct:   32 CAICNEFFRANDIIFSTSRCGHVFHKDCLTRWLNRSRTCPQCRDPCDRRRVHRLYL 87          
BLAST of TRAF interacting protein vs. Ensembl Fly
Match: Iru (gene:FBgn0037653 transcript:FBtr0081965)

HSP 1 Score: 51.6026 bits (122), Expect = 6.956e-7
Identity = 21/42 (50.00%), Postives = 25/42 (59.52%), Query Frame = 1
Query:   70 CSICQQSFSENCTVSALLCGHVFHSNCLTMWLNNKSNCPQCR 195
            CSIC   F  + TV  L C H++H NC+  WLN  S CP CR
Sbjct:  253 CSICWDDFKIDETVRKLPCSHLYHENCIVPWLNLHSTCPICR 294          
BLAST of TRAF interacting protein vs. Ensembl Zebrafish
Match: traip (TRAF-interacting protein [Source:ZFIN;Acc:ZDB-GENE-040801-30])

HSP 1 Score: 72.4034 bits (176), Expect = 1.713e-13
Identity = 73/292 (25.00%), Postives = 142/292 (48.63%), Query Frame = 1
Query:   64 CHCSICQQSFSENCTVSALLCGHVFHSNCLTMWLNNKSN--CPQCR-SPNVGNYIKKLFFDKMXXXXXXXXXXXXXXXXXXFKLRSELDKLKDLNYKITNELKIKSESNENL-------KKKLDQSQST-------------QMSQYLSFTNQIYETNETNERFKMKLDKLKFMNDILKKSKPEIDLFIQKLPKDEPPQFKIEKLCSALVTCQNDLNYYKKNSDEISKKLARTIL-KNSTLK---TEIDQLKEQMSNTDSNFPDLNTSELLDTPVTAMRTK---MRRQLTTP 849
             +C+IC   F  +  V+A+ CGH FH +CL  W  +  N  CPQCR   +  + I KLFFD   +++ + ++  +        L++ELD++K +  +   E + K ++ + L       KK LD+ +               QM+   S  N+     E  +R ++K+   + ++ +L+  + E++  I  +   +    ++   C +L    ++L    K+S+E+ +KL R ++  NS L+   +E ++ KE M        DL+++   D  +T+++ K   ++R L+TP
Sbjct:    5 AYCTICSDFFDHSKDVAAIHCGHTFHYSCLLQWFQSAPNKTCPQCRKQVSTRHIINKLFFDIAPEDDGAPVDPES--------LQNELDRMKAVLSEKEKEWREKQKTVDTLKDTIEKQKKDLDKVRKEIGDKEMLCSVLRKQMNFLESQKNEGQAAKEEAKRLRVKMKTYESLDVVLQGQRSEVEAMITDMGVGQSAVEQLSIYCISLKKEYDNLKGSLKSSNEMCEKLKREMISSNSKLQKATSETNRTKEDMKALQK---DLSSA---DKEITSLKKKVEILQRTLSTP 282          
BLAST of TRAF interacting protein vs. Ensembl Zebrafish
Match: traip (TRAF-interacting protein [Source:ZFIN;Acc:ZDB-GENE-040801-30])

HSP 1 Score: 72.4034 bits (176), Expect = 1.713e-13
Identity = 73/292 (25.00%), Postives = 142/292 (48.63%), Query Frame = 1
Query:   64 CHCSICQQSFSENCTVSALLCGHVFHSNCLTMWLNNKSN--CPQCR-SPNVGNYIKKLFFDKMXXXXXXXXXXXXXXXXXXFKLRSELDKLKDLNYKITNELKIKSESNENL-------KKKLDQSQST-------------QMSQYLSFTNQIYETNETNERFKMKLDKLKFMNDILKKSKPEIDLFIQKLPKDEPPQFKIEKLCSALVTCQNDLNYYKKNSDEISKKLARTIL-KNSTLK---TEIDQLKEQMSNTDSNFPDLNTSELLDTPVTAMRTK---MRRQLTTP 849
             +C+IC   F  +  V+A+ CGH FH +CL  W  +  N  CPQCR   +  + I KLFFD   +++ + ++  +        L++ELD++K +  +   E + K ++ + L       KK LD+ +               QM+   S  N+     E  +R ++K+   + ++ +L+  + E++  I  +   +    ++   C +L    ++L    K+S+E+ +KL R ++  NS L+   +E ++ KE M        DL+++   D  +T+++ K   ++R L+TP
Sbjct:    5 AYCTICSDFFDHSKDVAAIHCGHTFHYSCLLQWFQSAPNKTCPQCRKQVSTRHIINKLFFDIAPEDDGAPVDPES--------LQNELDRMKAVLSEKEKEWREKQKTVDTLKDTIEKQKKDLDKVRKEIGDKEMLCSVLRKQMNFLESQKNEGQAAKEEAKRLRVKMKTYESLDVVLQGQRSEVEAMITDMGVGQSAVEQLSIYCISLKKEYDNLKGSLKSSNEMCEKLKREMISSNSKLQKATSETNRTKEDMKALQK---DLSSA---DKEITSLKKKVEILQRTLSTP 282          
BLAST of TRAF interacting protein vs. Ensembl Zebrafish
Match: rnf103 (ring finger protein 103 [Source:ZFIN;Acc:ZDB-GENE-040912-171])

HSP 1 Score: 56.9954 bits (136), Expect = 2.315e-8
Identity = 23/52 (44.23%), Postives = 31/52 (59.62%), Query Frame = 1
Query:   55 MLIC-HCSICQQSFSENCTVSALLCGHVFHSNCLTMWLNNKSN-CPQCRSPN 204
            ML C  C +C ++F  +C V  L CGHVFH  C+ +WL    + CP CR P+
Sbjct:  588 MLHCTECVVCLENFETDCLVMGLPCGHVFHQQCIVVWLAGGRHCCPVCRWPS 639          
BLAST of TRAF interacting protein vs. Ensembl Zebrafish
Match: rnf130 (ring finger protein 130 [Source:ZFIN;Acc:ZDB-GENE-050522-525])

HSP 1 Score: 48.521 bits (114), Expect = 1.972e-6
Identity = 18/43 (41.86%), Postives = 24/43 (55.81%), Query Frame = 1
Query:   67 HCSICQQSFSENCTVSALLCGHVFHSNCLTMWLNNKSNCPQCR 195
            HC++C + +  N  V  L C HVFH  C+  WLN    CP C+
Sbjct:   20 HCAVCIEGYQLNDVVRILPCKHVFHKMCVDPWLNEHCTCPMCK 62          
BLAST of TRAF interacting protein vs. Ensembl Zebrafish
Match: BX005169.1 (pep chromosome:GRCz11:CHR_ALT_CTG14_1_32:36772984:36821569:-1 gene:ENSDARG00000112134.1 transcript:ENSDART00000183953.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX005169.1)

HSP 1 Score: 50.0618 bits (118), Expect = 2.011e-6
Identity = 18/43 (41.86%), Postives = 24/43 (55.81%), Query Frame = 1
Query:   67 HCSICQQSFSENCTVSALLCGHVFHSNCLTMWLNNKSNCPQCR 195
            HC++C + +  N  V  L C HVFH  C+  WLN    CP C+
Sbjct:  123 HCAVCIEGYQLNDVVRILPCKHVFHKMCVDPWLNEHCTCPMCK 165          
BLAST of TRAF interacting protein vs. Ensembl Xenopus
Match: traip (TRAF interacting protein [Source:NCBI gene;Acc:550072])

HSP 1 Score: 70.0922 bits (170), Expect = 1.546e-12
Identity = 71/292 (24.32%), Postives = 132/292 (45.21%), Query Frame = 1
Query:   64 CHCSICQQSFSENCTVSALLCGHVFHSNCLTMWLNNKSN--CPQCR-SPNVGNYIKKLFFDKMXXXXXXXXXXXXXXXXXXFKLRSELDKLK--------------DLNYKITNELKIKSESNENLKKKLDQSQ---STQMSQYLSFTNQIYETNETNERFKMKLDKLKFMNDI---LKKSKPEIDLFIQKLPKDEPPQFKIEKLCSALVTCQNDLNYYKKNSDEISKKLARTILK--NSTLKTEID--QLKEQMSNTDSNFPDLNTSELLDTPVTAMRTK---MRRQLTTP 849
             +C+IC   F  +  V+A+ CGH FH  CL  W ++  +  CPQCR   +    I KLFFD   +       E+         L++E+D++K               L   +   L +++ + ++L+K+L   +   ST   Q     NQ  ET    +  +   +KLK M  I   L+  +PE++  I+ +   +    ++   C +L     +L   +K+S E+++KL + I    N   K E+   +++E++S +     +       D  + +++ K   +++ LTTP
Sbjct:    5 AYCTICSDFFDNSRDVAAVTCGHTFHQECLLQWFHSAPHRTCPQCRIQVSSRQIINKLFFDIGGEEETVLDPES---------LKNEVDRIKVSLLAKEKEKRECQGLVDSLREMLDVRNVTIQSLQKELGDMEMLCSTLKKQMKFLDNQKSETKAAKDEARKLRNKLKTMESIEVLLQAQRPEVEEMIRNMGSGQAAVEQLAIYCVSLKKEYENLKEVRKSSAEMTEKLRKEIFASNNKAQKAELQLTKVREELSASQKELHN------ADKEIMSLKKKVEFLQKTLTTP 281          
BLAST of TRAF interacting protein vs. Ensembl Xenopus
Match: traip (TRAF interacting protein [Source:NCBI gene;Acc:550072])

HSP 1 Score: 65.0846 bits (157), Expect = 6.650e-11
Identity = 60/234 (25.64%), Postives = 105/234 (44.87%), Query Frame = 1
Query:   67 HCSICQQSFSENCTVSALLCGHVFHSNCLTMWLNNKSN--CPQCR-SPNVGNYIKKLFFDKMXXXXXXXXXXXXXXXXXXFKLRSELDKLK--------------DLNYKITNELKIKSESNENLKKKLDQSQ---STQMSQYLSFTNQIYETNETNERFKMKLDKLKFMNDI---LKKSKPEIDLFIQKLPKDEPPQFKIEKLCSALVTCQNDLNYYKKNSDEISKKLARTIL 699
            +C+IC   F  +  V+A+ CGH FH  CL  W ++  +  CPQCR   +    I KLFFD   +       E          L++E+D++K               L   +   L +++ + ++L+K+L   +   ST   Q     NQ  ET    +  +   +KLK M  I   L+  +PE++  I+ +   +    ++   C +L     +L   +K+S E+++KL + I 
Sbjct:    6 YCTICSDFFDNSRDVAAVTCGHTFHQECLLQWFHSAPHRTCPQCRIQVSSRQIINKLFFDIGGEEETVLDPE---------SLKNEVDRIKVSLLAKEKEKRECQGLVDSLREMLDVRNVTIQSLQKELGDMEMLCSTLKKQMKFLDNQKSETKAAKDEARKLRNKLKTMESIEVLLQAQRPEVEEMIRNMGSGQAAVEQLAIYCVSLKKEYENLKEVRKSSAEMTEKLRKEIF 230          
BLAST of TRAF interacting protein vs. Ensembl Xenopus
Match: dlc (putative ortholog of delta-like protein C precursor (SwissPro) [Source:Xenbase;Acc:XB-GENE-968497])

HSP 1 Score: 52.7582 bits (125), Expect = 6.986e-7
Identity = 26/61 (42.62%), Postives = 33/61 (54.10%), Query Frame = 1
Query:   55 MLIC-HCSICQQSFSENCTVSALLCGHVFHSNCLTMWL-NNKSNCPQCRSPNVGNYIKKLF 231
            ML C  C +C ++F     +  L CGHVFH NC+ MWL   +  CP CR     +Y KK F
Sbjct:  612 MLHCTECVVCLENFENGSLLMGLPCGHVFHQNCIVMWLAGGRHCCPVCR---WASYKKKHF 669          
BLAST of TRAF interacting protein vs. Ensembl Xenopus
Match: rnf130 (ring finger protein 130 [Source:NCBI gene;Acc:100124963])

HSP 1 Score: 51.2174 bits (121), Expect = 1.887e-6
Identity = 18/43 (41.86%), Postives = 26/43 (60.47%), Query Frame = 1
Query:   67 HCSICQQSFSENCTVSALLCGHVFHSNCLTMWLNNKSNCPQCR 195
            HC++C +S+ +N  V  L C HVFH  C+  WL+    CP C+
Sbjct:  238 HCAVCIESYKQNDIVRVLPCKHVFHKVCVDPWLSEHCTCPMCK 280          
BLAST of TRAF interacting protein vs. Ensembl Xenopus
Match: rnf181 (ring finger protein 181 [Source:NCBI gene;Acc:496625])

HSP 1 Score: 48.9062 bits (115), Expect = 2.019e-6
Identity = 19/42 (45.24%), Postives = 25/42 (59.52%), Query Frame = 1
Query:   70 CSICQQSFSENCTVSALLCGHVFHSNCLTMWLNNKSNCPQCR 195
            C +C   F E  TV  L C H+FHS+C+  WL   ++CP CR
Sbjct:   92 CPVCLLEFEEGETVRQLPCEHLFHSSCILPWLGKTNSCPLCR 133          
BLAST of TRAF interacting protein vs. Ensembl Mouse
Match: Traip (TRAF-interacting protein [Source:MGI Symbol;Acc:MGI:1096377])

HSP 1 Score: 68.5514 bits (166), Expect = 4.296e-12
Identity = 68/272 (25.00%), Postives = 126/272 (46.32%), Query Frame = 1
Query:   70 CSICQQSFSENCTVSALLCGHVFHSNCLTMWLNNK--SNCPQCRSPNVG--NYIKKLFFDKMXXXXXXXXXXXXXXXXXXFKLR-SELDKLKDLNYKITNELKIKSESN----ENLKKKLDQSQ--STQMSQYLSFTNQ----IYETNETNERFKMKLDKLKFMNDILKKSKPEIDLFIQKLPKDEPPQFKIEKLCSALVTCQNDLNYYKKNSDEISKKLARTIL----KNSTLKTEIDQLKEQMSNTDSNFPDLNTSELLDTPVTAMRTKM 828
            C+IC   F  +  V+A+ CGH FH  CL  W        CPQCR   VG    I KLFFD   +  N    E      ++ K + S+ D+ K  +  I + L+   E      E+L+  L++++   + + + + F  Q      +  E   R K K+  ++ +  +L+  + E++  I+ +   +    ++   C +L     +L   +K + E++ +L + ++    K  TL TE+DQ K ++ +      DL ++   D  +T++R K+
Sbjct:    7 CTICSDFFDHSRDVAAIHCGHTFHLQCLIQWFETAPSRTCPQCRI-QVGKKTIINKLFFDLAQEEENVLDAEFLKNELDSVKAQLSQKDREKRDSQAIIDTLRDTLEERNATVESLQNALNKAEMLCSTLKKQMKFLEQRQDETKQAREEAHRLKCKMKTMEQIELLLQSQRSEVEEMIRDMGVGQSAVEQLAVYCVSLKKEYENLKEARKATGELADRLKKDLVSSRSKLKTLNTELDQAKLELRSAQK---DLQSA---DQEITSLRKKL 271          
BLAST of TRAF interacting protein vs. Ensembl Mouse
Match: Rnf103 (ring finger protein 103 [Source:MGI Symbol;Acc:MGI:109483])

HSP 1 Score: 58.9214 bits (141), Expect = 7.031e-9
Identity = 21/46 (45.65%), Postives = 28/46 (60.87%), Query Frame = 1
Query:   70 CSICQQSFSENCTVSALLCGHVFHSNCLTMWL-NNKSNCPQCRSPN 204
            C +C ++F   C +  L CGHVFH NC+ MWL   +  CP CR P+
Sbjct:  619 CVVCLENFENGCLLMGLPCGHVFHQNCIVMWLAGGRHCCPVCRWPS 664          
BLAST of TRAF interacting protein vs. Ensembl Mouse
Match: Rnf103 (ring finger protein 103 [Source:MGI Symbol;Acc:MGI:109483])

HSP 1 Score: 58.9214 bits (141), Expect = 7.031e-9
Identity = 21/46 (45.65%), Postives = 28/46 (60.87%), Query Frame = 1
Query:   70 CSICQQSFSENCTVSALLCGHVFHSNCLTMWL-NNKSNCPQCRSPN 204
            C +C ++F   C +  L CGHVFH NC+ MWL   +  CP CR P+
Sbjct:  619 CVVCLENFENGCLLMGLPCGHVFHQNCIVMWLAGGRHCCPVCRWPS 664          
BLAST of TRAF interacting protein vs. Ensembl Mouse
Match: Rnf130 (ring finger protein 130 [Source:MGI Symbol;Acc:MGI:1891717])

HSP 1 Score: 52.7582 bits (125), Expect = 3.752e-7
Identity = 18/43 (41.86%), Postives = 27/43 (62.79%), Query Frame = 1
Query:   67 HCSICQQSFSENCTVSALLCGHVFHSNCLTMWLNNKSNCPQCR 195
            HC++C +S+ +N  V  L C HVFH +C+  WL+    CP C+
Sbjct:  263 HCAVCIESYKQNDVVRVLPCKHVFHKSCVDPWLSEHCTCPMCK 305          
BLAST of TRAF interacting protein vs. Ensembl Mouse
Match: Rnf130 (ring finger protein 130 [Source:MGI Symbol;Acc:MGI:1891717])

HSP 1 Score: 52.7582 bits (125), Expect = 4.011e-7
Identity = 18/43 (41.86%), Postives = 27/43 (62.79%), Query Frame = 1
Query:   67 HCSICQQSFSENCTVSALLCGHVFHSNCLTMWLNNKSNCPQCR 195
            HC++C +S+ +N  V  L C HVFH +C+  WL+    CP C+
Sbjct:  263 HCAVCIESYKQNDVVRVLPCKHVFHKSCVDPWLSEHCTCPMCK 305          
BLAST of TRAF interacting protein vs. UniProt/SwissProt
Match: sp|Q8VIG6|TRAIP_MOUSE (E3 ubiquitin-protein ligase TRAIP OS=Mus musculus OX=10090 GN=Traip PE=1 SV=2)

HSP 1 Score: 68.5514 bits (166), Expect = 3.005e-11
Identity = 68/272 (25.00%), Postives = 126/272 (46.32%), Query Frame = 1
Query:   70 CSICQQSFSENCTVSALLCGHVFHSNCLTMWLNNK--SNCPQCRSPNVG--NYIKKLFFDKMXXXXXXXXXXXXXXXXXXFKLR-SELDKLKDLNYKITNELKIKSESN----ENLKKKLDQSQ--STQMSQYLSFTNQ----IYETNETNERFKMKLDKLKFMNDILKKSKPEIDLFIQKLPKDEPPQFKIEKLCSALVTCQNDLNYYKKNSDEISKKLARTIL----KNSTLKTEIDQLKEQMSNTDSNFPDLNTSELLDTPVTAMRTKM 828
            C+IC   F  +  V+A+ CGH FH  CL  W        CPQCR   VG    I KLFFD   +  N    E      ++ K + S+ D+ K  +  I + L+   E      E+L+  L++++   + + + + F  Q      +  E   R K K+  ++ +  +L+  + E++  I+ +   +    ++   C +L     +L   +K + E++ +L + ++    K  TL TE+DQ K ++ +      DL ++   D  +T++R K+
Sbjct:    7 CTICSDFFDHSRDVAAIHCGHTFHLQCLIQWFETAPSRTCPQCRI-QVGKKTIINKLFFDLAQEEENVLDAEFLKNELDSVKAQLSQKDREKRDSQAIIDTLRDTLEERNATVESLQNALNKAEMLCSTLKKQMKFLEQRQDETKQAREEAHRLKCKMKTMEQIELLLQSQRSEVEEMIRDMGVGQSAVEQLAVYCVSLKKEYENLKEARKATGELADRLKKDLVSSRSKLKTLNTELDQAKLELRSAQK---DLQSA---DQEITSLRKKL 271          
BLAST of TRAF interacting protein vs. UniProt/SwissProt
Match: sp|Q9BWF2|TRAIP_HUMAN (E3 ubiquitin-protein ligase TRAIP OS=Homo sapiens OX=9606 GN=TRAIP PE=1 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 4.611e-11
Identity = 68/252 (26.98%), Postives = 112/252 (44.44%), Query Frame = 1
Query:   70 CSICQQSFSENCTVSALLCGHVFHSNCLTMWLNNK--SNCPQCRSPNVG--NYIKKLFFDKMXXXXXXXXXXXXXXXXXXFKLR-SELDKLKDLNYKITNELKIKSESNE----NLKKKLDQSQ---STQMSQYLSFTNQIYETNETNERFKMKLDKLKFMNDI---LKKSKPEIDLFIQKLPKDEPPQFKIEKLCSALVTCQNDLNYYKKNSDEISKKLARTIL----KNSTLKTEIDQLKEQMSNTDSNF 768
            C+IC   F  +  V+A+ CGH FH  CL  W        CPQCR   VG    I KLFFD   +  N    E      +N + + S+ DK K  +  I + L+   E       +L++ L +++   ST   Q      Q  ET +  E  +    K+K M  I   L+  +PE++  I+ +   +    ++   C +L     +L   +K S E++ KL + +     K  T+ +E+DQ K ++ +   + 
Sbjct:    7 CTICSDFFDHSRDVAAIHCGHTFHLQCLIQWFETAPSRTCPQCRI-QVGKRTIINKLFFDLAQEEENVLDAEFLKNELDNVRAQLSQKDKEKRDSQVIIDTLRDTLEERNATVVSLQQALGKAEMLCSTLKKQMKYLEQQQDETKQAQEEARRLRSKMKTMEQIELLLQSQRPEVEEMIRDMGVGQSAVEQLAVYCVSLKKEYENLKEARKASGEVADKLRKDLFSSRSKLQTVYSELDQAKLELKSAQKDL 257          
BLAST of TRAF interacting protein vs. UniProt/SwissProt
Match: sp|O00237|RN103_HUMAN (E3 ubiquitin-protein ligase RNF103 OS=Homo sapiens OX=9606 GN=RNF103 PE=1 SV=1)

HSP 1 Score: 59.3066 bits (142), Expect = 3.371e-8
Identity = 24/52 (46.15%), Postives = 31/52 (59.62%), Query Frame = 1
Query:   55 MLIC-HCSICQQSFSENCTVSALLCGHVFHSNCLTMWLNNKSN-CPQCRSPN 204
            ML C  C +C ++F   C +  L CGHVFH NC+ MWL    + CP CR P+
Sbjct:  615 MLHCTECVVCLENFENGCLLMGLPCGHVFHQNCIVMWLAGGRHCCPVCRWPS 666          
BLAST of TRAF interacting protein vs. UniProt/SwissProt
Match: sp|Q9R1W3|RN103_MOUSE (E3 ubiquitin-protein ligase RNF103 OS=Mus musculus OX=10090 GN=Rnf103 PE=2 SV=2)

HSP 1 Score: 58.9214 bits (141), Expect = 4.918e-8
Identity = 21/46 (45.65%), Postives = 28/46 (60.87%), Query Frame = 1
Query:   70 CSICQQSFSENCTVSALLCGHVFHSNCLTMWL-NNKSNCPQCRSPN 204
            C +C ++F   C +  L CGHVFH NC+ MWL   +  CP CR P+
Sbjct:  619 CVVCLENFENGCLLMGLPCGHVFHQNCIVMWLAGGRHCCPVCRWPS 664          
BLAST of TRAF interacting protein vs. UniProt/SwissProt
Match: sp|Q9EPZ8|RN103_RAT (E3 ubiquitin-protein ligase RNF103 OS=Rattus norvegicus OX=10116 GN=Rnf103 PE=2 SV=1)

HSP 1 Score: 58.5362 bits (140), Expect = 5.091e-8
Identity = 21/46 (45.65%), Postives = 28/46 (60.87%), Query Frame = 1
Query:   70 CSICQQSFSENCTVSALLCGHVFHSNCLTMWL-NNKSNCPQCRSPN 204
            C +C ++F   C +  L CGHVFH NC+ MWL   +  CP CR P+
Sbjct:  618 CVVCLENFENGCLLMGLPCGHVFHQNCIVMWLAGGRHCCPVCRWPS 663          
BLAST of TRAF interacting protein vs. TrEMBL
Match: I1ZI75 (TRAF interacting protein OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 706.827 bits (1823), Expect = 0.000e+0
Identity = 371/380 (97.63%), Postives = 375/380 (98.68%), Query Frame = 1
Query:   28 VPLNFNFKIMLICHCSICQQSFSENCTVSALLCGHVFHSNCLTMWLNNKSNCPQCRSPNVGNYIKKLFFDKMXXXXXXXXXXXXXXXXXXFKLRSELDKLKDLNYKITNELKIKSESNENLKKKLDQSQSTQMSQYLSFTNQIYETNETNERFKMKLDKLKFMNDILKKSKPEIDLFIQKLPKDEPPQFKIEKLCSALVTCQNDLNYYKKNSDEISKKLARTILKNSTLKTEIDQLKEQMSNTDSNFPDLNTSELLDTPVTAMRTKMRRQLTTPEMLLSSPDMSTNQQNEKHFRQKLLENPFRCTPKRSLSQKSSWKLDIMINRSKPTRLPPPHIIRLDSDTENHPSEEPVRKLKKVPRSKHIQPIKKDSTSSTPVYHSL 1167
            V L    +IMLICHCSICQQSFSENCTVSALLCGHVFHSNCLTMWLNNKSNCPQCRSPNVGNYIKKLFFDKMSDNNNSFINENNSVNEENFKLRSELDKLKDLNYKITNELKIKSESNENLKKKLDQSQSTQMSQYLSFTNQIYETNETNERFKMKLDKLKFMNDILKKSKPEIDLFIQKLPKDEPPQF+IEKLCSALVTCQNDLNYYKKNSDEISKKLARTILKNSTLKTEIDQLKE+MSNTDSNFPDLNTSELLDTPVTAMRTKMRRQLTTPEMLLSSPDMSTNQQNEKHFRQKLLENPFRCTPKRSLSQKSSWKLDIMINRSKPTRLPPPHIIRLDSDTENHPSEEPVRKLKKVPRSKHI+PIKKDSTSSTPVYHSL
Sbjct:   13 VKLTLVKQIMLICHCSICQQSFSENCTVSALLCGHVFHSNCLTMWLNNKSNCPQCRSPNVGNYIKKLFFDKMSDNNNSFINENNSVNEENFKLRSELDKLKDLNYKITNELKIKSESNENLKKKLDQSQSTQMSQYLSFTNQIYETNETNERFKMKLDKLKFMNDILKKSKPEIDLFIQKLPKDEPPQFQIEKLCSALVTCQNDLNYYKKNSDEISKKLARTILKNSTLKTEIDQLKEKMSNTDSNFPDLNTSELLDTPVTAMRTKMRRQLTTPEMLLSSPDMSTNQQNEKHFRQKLLENPFRCTPKRSLSQKSSWKLDIMINRSKPTRLPPPHIIRLDSDTENHPSEEPVRKLKKVPRSKHIKPIKKDSTSSTPVYHSL 392          
BLAST of TRAF interacting protein vs. TrEMBL
Match: I3KWR3 (TRAF-interacting protein OS=Oreochromis niloticus OX=8128 PE=4 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 2.995e-12
Identity = 74/292 (25.34%), Postives = 135/292 (46.23%), Query Frame = 1
Query:   64 CHCSICQQSFSENCTVSALLCGHVFHSNCLTMWLNNK--SNCPQCR-SPNVGNYIKKLFFDKMXXXXXXXXXXXXXXXXXXFKLRSELDKLKDLNYKITNELKIKSESNENLKKKLDQSQ--------------------STQMSQYLSFTNQIYETNETNERFKMKLDKLKFMNDILKKSKPEIDLFIQKLPKDEPPQFKIEKLCSALVTCQNDLNYYKKNSDEISKKLARTIL-KNSTLK---TEIDQLKEQMSNTDSNFPDLNTSELLDTPVTAMRTK---MRRQLTTP 849
             +C+IC   F  +  V+A+ CGH FH  CL  W        CPQCR   +  + I KLFFD   +  ++   E+         L++E+D++K L      +L+ K +  E+LK  +D+ +                     TQMS   +  N++    E   R + KL   + ++ +L+  + E++  I  +   +    ++   C +L    ++L    K S+++ +KL R +L  NS L+    E++Q KE M +  S   DL  +   D  +++++ K   +++ L+TP
Sbjct:    5 AYCTICSDFFDHSRDVAAIHCGHTFHYECLLQWFQTAPTKTCPQCRKQVSTRHIISKLFFDIGGEEESTADPES---------LQNEVDRVKALLSSKERDLRDKQKMVESLKDSMDKQRRDLDSLRKEIKEKDMLCSALKTQMSYLETQQNEVQAAKEEVRRLRTKLKTFESLDVLLQGQRAEVESMITDMGISQAAVEQLSIYCISLKKEYDNLKGTLKASNDMCEKLKREVLSSNSKLQKATIEVNQTKEDMKSLQS---DLTCA---DKEISSLKKKVEFLQKSLSTP 281          
BLAST of TRAF interacting protein vs. TrEMBL
Match: A0A4U1EHL3 (RING-type domain-containing protein OS=Monodon monoceros OX=40151 GN=EI555_015291 PE=4 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 9.880e-12
Identity = 96/384 (25.00%), Postives = 170/384 (44.27%), Query Frame = 1
Query:   70 CSICQQSFSENCTVSALLCGHVFHSNCLTMWLNNKSN--CPQCRSPNVG--NYIKKLFFDKMXXXXXXXXXXXXXXXXXXFKLRSELDKLKDLNYK--------------ITNELKIKSESNENLKKKLDQSQ---STQMSQYLSFTNQIYETNETNERFKMKLDKLKFMNDI---LKKSKPEIDLFIQKLPKDEPPQFKIEKLCSALVTCQNDLNYYKKNSDEISKKLARTIL----KNSTLKTEIDQLKEQMSNTDSNFPDLNTSELLDTPVTAMRTKMRRQLTTPEMLLSSPDMSTNQQNEKHFRQKLLENPFRCTPKRSLS---QKSSWKLDIMINRSKPTRLPPP--------HIIRLDSDTENHPSEEPVRKLKKVPR 1104
            C+IC   F  +  V+A+ CGH FH  CL  W     +  CPQCR   VG    I KLFFD   +  +    E          L++ELD  + L  +              + + L+ ++ + E+L+K LD+++   ST   Q      Q  ET +  E  +   +K+K M  I   L+  +PE++  I+ +   +    ++   C +L     +L   +K S E++ KL + +     K  T+ +E+DQ K ++ +      DL ++   D  + ++R K    LT  +  L+ P + +   N     + +LE+P    P   L+   ++ ++  DI +N +     PP         H  RL  +  + P +E ++K+ K P+
Sbjct:    7 CTICSDFFDHSRDVAAIHCGHTFHLQCLIQWFETAPSRTCPQCRI-QVGKRTIINKLFFDLAQEEESVLDAEF---------LKNELDNTRALLSQKEKEKRDGQLIIDTLRDTLEERNATVESLQKALDKAEMLCSTLKKQMKYLEQQQDETKQAREEARRLRNKMKTMERIELLLQSQRPEVEEMIRDMGVGQSAVEQLAVYCVSLKKEYENLKEARKASGELADKLKKDLFSSRSKLQTVYSELDQAKLELRSAQK---DLQSA---DKEIASLRKK----LTMLQETLNLPPVDSEAVN-----RLVLESP---APVEMLNLKLRRPAFGDDIDLNATFNVDTPPAQPSSTQHGHAKRLFPEKAHSPVQEVLKKMPKGPK 362          
BLAST of TRAF interacting protein vs. TrEMBL
Match: A0A2H2IID1 (RING-type domain-containing protein OS=Caenorhabditis japonica OX=281687 PE=4 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 1.203e-11
Identity = 48/155 (30.97%), Postives = 78/155 (50.32%), Query Frame = 1
Query:   70 CSICQQSFSENCTVSALLCGHVFHSNCLTMWLNNKSNCPQCRSPNVGN-YIKKLFFDKMXXXXXXXXXXXXXXXXXXFKLRSELDKLKDLNYKITNE---LKIKSESNENLKKKLDQSQSTQMSQYLSFTN----QIYETNETNERFKMKLDKLK 510
            CSIC  S  +   VSAL+CGH++H  C++ W+  K  CP CR P   N +++KLFFD ++              E + +LR+ L+  K+ N +I  E   LK+  +S E    K       ++++  +  N     + ET+  N + ++  DKLK
Sbjct:    9 CSICLGSLKQKDKVSALVCGHIYHHECISKWMAAKKQCPSCRRPVPKNGFVEKLFFDVLASEQIEEGEAEVDYAEVSCQLRAALNFEKEKNERIEKENESLKVSVKSLEKKVVKDKDKNKNEITRLQATVNTLKVSVEETSYLNNQLQIAKDKLK 163          
BLAST of TRAF interacting protein vs. TrEMBL
Match: A0A484GVV3 (RING-type domain-containing protein OS=Sousa chinensis OX=103600 GN=DBR06_SOUSAS2110255 PE=4 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 1.224e-11
Identity = 98/384 (25.52%), Postives = 174/384 (45.31%), Query Frame = 1
Query:   70 CSICQQSFSENCTVSALLCGHVFHSNCLTMWLNNKSN--CPQCRSPNVG--NYIKKLFFDKMXXXXXXXXXXXXXXXXXXFKLRSELDKLKDLNYK--------------ITNELKIKSESNENLKKKLDQSQ---STQMSQYLSFTNQIYETNETNERFKMKLDKLKFMNDI---LKKSKPEIDLFIQKLPKDEPPQFKIEKLCSALVTCQNDLNYYKKNSDEISKKLARTIL----KNSTLKTEIDQLKEQMSNTDSNFPDLNTSELLDTPVTAMRTKMRRQLTTPEMLLSSPDMSTNQQNEKHFRQKLLENPFRCTPKRSLS---QKSSWKLDIMINRSKPTRLPPP--------HIIRLDSDTENHPSEEPVRKLKKVPR 1104
            C+IC   F  +  V+A+ CGH+FH  CL  W     +  CPQCR   VG    I KLFFD           E +SV +  F L++ELD  + L  +              + + L+ ++ + E+L+K LD+++   ST   Q      Q  ET +  E  +   +K+K M  I   L+  +PE++  I+ +   +    ++   C +L     +L   +K S E++ KL + +     K  T+ +E+DQ K ++ +      DL ++   D  + ++R K    LT  +  L+ P + +   N     + +LE+P    P   L+   ++ ++  DI +N +     PP         H  RL  +  + P ++ ++K+ K P+
Sbjct:    7 CTICSDFFDHSRDVAAIHCGHIFHLQCLIQWFETAPSRTCPQCRI-QVGKRTIINKLFFD--------LAQEEDSVLDAEF-LKNELDNTRALLSQKEKEKRDGQLIIDTLRDTLEERNATVESLQKALDKAEMLCSTLKKQMKYLEQQQDETKQAREEARRLRNKMKTMERIELLLQSQRPEVEEMIRDMGVGQSAVEQLAVYCVSLKKEYENLKEARKASGELADKLKKDLFSSRSKLQTVYSELDQAKLELRSAQK---DLQSA---DKEIASLRKK----LTMLQETLNLPPVDSEAVN-----RLVLESP---APVEMLNLKLRRPAFGDDIDLNATFNVDTPPAQPSSTQHGHAKRLFPEKAHSPVQDVLKKMPKGPK 362          
BLAST of TRAF interacting protein vs. Ensembl Cavefish
Match: traip (TRAF interacting protein [Source:NCBI gene;Acc:103042100])

HSP 1 Score: 67.0106 bits (162), Expect = 8.286e-12
Identity = 66/295 (22.37%), Postives = 134/295 (45.42%), Query Frame = 1
Query:   64 CHCSICQQSFSENCTVSALLCGHVFHSNCLTMWLNNK--SNCPQCRSPNVGNY-IKKLFFDKMXXXXXXXXXXXXXXXXXXFKLRSELDKLKDLNYKITNELKIKSESNENLKKKLDQSQS--------------------TQMSQYLSFTNQIYE-TNETNERFKMKLDKLKFMNDILKKSKPEIDLFIQKLPKDEPPQFKIEKLCSALVTCQNDLNYYKKNSDEISKKLARTI------LKNSTLKTEIDQLKEQMSNTDSNFPDLNTSELLDTPVTAMRTK---MRRQLTTP 849
             +C+IC   F  +  V+A+ CGH FH  CL  W  +     CPQCR      + I KLFFD   ++  S  +  +        L++ELD++K    +     + K ++ +NL++ +++ ++                     QM QYL   ++  E   E  +R ++K+   + +N +L+  + E++  I  +   +    ++   C +L     +L    ++S+++ +KL R +      L+ +T   E+++ KE M     +  +       D  +T+++ K   +++ L+TP
Sbjct:    5 AYCTICSDFFDHSKDVAAIYCGHTFHYACLLQWFQSAPTKTCPQCRKQVSSRHIINKLFFDIAPEDEGSAADPES--------LQNELDRMKAAFSEKERGWREKQKAADNLRETIEKQRADLERVRREIGEKEMLCTTLRKQM-QYLESQHRESEAAKEEAKRLRVKMKTYESLNAVLQGQRAEVEAMISDMGVGQSAVEQLSIYCVSLKKEYYNLKGSLRSSNDMCEKLKRELFSSNNKLQKATF--EMNRAKEDMKALQKDLTN------ADKEITSLKKKVEILQKTLSTP 282          
BLAST of TRAF interacting protein vs. Ensembl Cavefish
Match: traip (TRAF interacting protein [Source:NCBI gene;Acc:103042100])

HSP 1 Score: 67.0106 bits (162), Expect = 9.314e-12
Identity = 66/295 (22.37%), Postives = 134/295 (45.42%), Query Frame = 1
Query:   64 CHCSICQQSFSENCTVSALLCGHVFHSNCLTMWLNNK--SNCPQCRSPNVGNY-IKKLFFDKMXXXXXXXXXXXXXXXXXXFKLRSELDKLKDLNYKITNELKIKSESNENLKKKLDQSQS--------------------TQMSQYLSFTNQIYE-TNETNERFKMKLDKLKFMNDILKKSKPEIDLFIQKLPKDEPPQFKIEKLCSALVTCQNDLNYYKKNSDEISKKLARTI------LKNSTLKTEIDQLKEQMSNTDSNFPDLNTSELLDTPVTAMRTK---MRRQLTTP 849
             +C+IC   F  +  V+A+ CGH FH  CL  W  +     CPQCR      + I KLFFD   ++  S  +  +        L++ELD++K    +     + K ++ +NL++ +++ ++                     QM QYL   ++  E   E  +R ++K+   + +N +L+  + E++  I  +   +    ++   C +L     +L    ++S+++ +KL R +      L+ +T   E+++ KE M     +  +       D  +T+++ K   +++ L+TP
Sbjct:    5 AYCTICSDFFDHSKDVAAIYCGHTFHYACLLQWFQSAPTKTCPQCRKQVSSRHIINKLFFDIAPEDEGSAADPES--------LQNELDRMKAAFSEKERGWREKQKAADNLRETIEKQRADLERVRREIGEKEMLCTTLRKQM-QYLESQHRESEAAKEEAKRLRVKMKTYESLNAVLQGQRAEVEAMISDMGVGQSAVEQLSIYCVSLKKEYYNLKGSLRSSNDMCEKLKRELFSSNNKLQKATF--EMNRAKEDMKALQKDLTN------ADKEITSLKKKVEILQKTLSTP 282          
BLAST of TRAF interacting protein vs. Ensembl Cavefish
Match: rnf103 (ring finger protein 103 [Source:NCBI gene;Acc:103028066])

HSP 1 Score: 56.225 bits (134), Expect = 3.131e-8
Identity = 23/52 (44.23%), Postives = 30/52 (57.69%), Query Frame = 1
Query:   55 MLIC-HCSICQQSFSENCTVSALLCGHVFHSNCLTMWLNNKSN-CPQCRSPN 204
            ML C  C +C ++F   C V  L CGHVFH  C+ +WL    + CP CR P+
Sbjct:  591 MLHCTECVVCLENFETECLVMGLPCGHVFHQQCIVVWLAGGRHCCPVCRWPS 642          
BLAST of TRAF interacting protein vs. Ensembl Cavefish
Match: rnf130 (ring finger protein 130 [Source:NCBI gene;Acc:103033921])

HSP 1 Score: 50.0618 bits (118), Expect = 2.753e-6
Identity = 18/43 (41.86%), Postives = 24/43 (55.81%), Query Frame = 1
Query:   67 HCSICQQSFSENCTVSALLCGHVFHSNCLTMWLNNKSNCPQCR 195
            HC++C + +  N  V  L C HVFH  C+  WLN    CP C+
Sbjct:  266 HCAVCIEGYQLNDVVCILPCKHVFHKMCVDPWLNEHCTCPMCK 308          
BLAST of TRAF interacting protein vs. Ensembl Cavefish
Match: rnf130 (ring finger protein 130 [Source:NCBI gene;Acc:103033921])

HSP 1 Score: 49.6766 bits (117), Expect = 2.863e-6
Identity = 18/43 (41.86%), Postives = 24/43 (55.81%), Query Frame = 1
Query:   67 HCSICQQSFSENCTVSALLCGHVFHSNCLTMWLNNKSNCPQCR 195
            HC++C + +  N  V  L C HVFH  C+  WLN    CP C+
Sbjct:  266 HCAVCIEGYQLNDVVCILPCKHVFHKMCVDPWLNEHCTCPMCK 308          
BLAST of TRAF interacting protein vs. Ensembl Sea Lamprey
Match: rnf103 (ring finger protein 103 [Source:ZFIN;Acc:ZDB-GENE-040912-171])

HSP 1 Score: 53.1434 bits (126), Expect = 7.397e-8
Identity = 17/43 (39.53%), Postives = 27/43 (62.79%), Query Frame = 1
Query:   70 CSICQQSFSENCTVSALLCGHVFHSNCLTMWL-NNKSNCPQCR 195
            C +C +++S  C ++ L CGH FH+ C+ +WL   +  CP CR
Sbjct:  640 CVVCLEAYSLGCLLTCLPCGHAFHARCIAIWLEGGRHCCPVCR 682          
BLAST of TRAF interacting protein vs. Ensembl Sea Lamprey
Match: RNF115 (ring finger protein 115 [Source:HGNC Symbol;Acc:HGNC:18154])

HSP 1 Score: 48.521 bits (114), Expect = 9.321e-7
Identity = 18/42 (42.86%), Postives = 27/42 (64.29%), Query Frame = 1
Query:   70 CSICQQSFSENCTVSALLCGHVFHSNCLTMWLNNKSNCPQCR 195
            C++C++ +S   +V  L C H+FHSNC+  WL    +CP CR
Sbjct:  204 CAVCKEDYSVGESVRQLPCLHLFHSNCIVPWLEMHDSCPVCR 245          
BLAST of TRAF interacting protein vs. Ensembl Sea Lamprey
Match: si:ch1073-392o20.1 (ring finger protein 122 [Source:HGNC Symbol;Acc:HGNC:21147])

HSP 1 Score: 43.8986 bits (102), Expect = 1.465e-6
Identity = 16/44 (36.36%), Postives = 23/44 (52.27%), Query Frame = 1
Query:   70 CSICQQSFSENCTVSALLCGHVFHSNCLTMWLNNKSNCPQCRSP 201
            C++C + F E   ++   C H FH  CL  WL  ++ CP C  P
Sbjct:   17 CAVCLEDFREKDELAVCPCKHAFHRKCLVKWLEIRNACPMCNKP 60          
BLAST of TRAF interacting protein vs. Ensembl Sea Lamprey
Match: rnf126 (ring finger protein 126 [Source:ZFIN;Acc:ZDB-GENE-070209-292])

HSP 1 Score: 46.595 bits (109), Expect = 4.662e-6
Identity = 16/43 (37.21%), Postives = 25/43 (58.14%), Query Frame = 1
Query:   70 CSICQQSFSENCTVSALLCGHVFHSNCLTMWLNNKSNCPQCRS 198
            CS+C++ F E      L C H++H++C+  WL     CP CR+
Sbjct:  225 CSVCKEDFDEGEKARQLPCKHIYHTDCIIPWLEMHDTCPVCRT 267          
BLAST of TRAF interacting protein vs. Ensembl Nematostella
Match: EDO40849 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S600])

HSP 1 Score: 56.6102 bits (135), Expect = 8.502e-9
Identity = 21/47 (44.68%), Postives = 25/47 (53.19%), Query Frame = 1
Query:   55 MLICHCSICQQSFSENCTVSALLCGHVFHSNCLTMWLNNKSNCPQCR 195
            M+   C+ICQ         S   CGHVFH  CL+ WLN    CP+CR
Sbjct:    1 MIRAFCTICQDLILTGHEASTGQCGHVFHQTCLSSWLNRNKTCPKCR 47          
BLAST of TRAF interacting protein vs. Ensembl Nematostella
Match: EDO49113 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGT9])

HSP 1 Score: 49.6766 bits (117), Expect = 1.338e-6
Identity = 22/55 (40.00%), Postives = 28/55 (50.91%), Query Frame = 1
Query:   55 MLIC-HCSICQQSFSENCTVSALLCGHVFHSNCLTMWLNNKSN-----CPQCRSP 201
            M+ C  C IC   F   CT+  L CGH FH +C+ +WL   +      CP CR P
Sbjct:  554 MIPCGECVICLDEFKPGCTLLGLPCGHSFHQHCIEVWLAGDNTAPHHCCPNCRWP 608          
BLAST of TRAF interacting protein vs. Ensembl Medaka
Match: traip (TRAF interacting protein [Source:NCBI gene;Acc:101166788])

HSP 1 Score: 58.9214 bits (141), Expect = 3.401e-9
Identity = 63/290 (21.72%), Postives = 128/290 (44.14%), Query Frame = 1
Query:   70 CSICQQSFSENCTVSALLCGHVFHSNCLTMWLNNK--SNCPQCR-SPNVGNYIKKLFFDKMXXXXXXXXXXXXXXXXXXFKLRSELDKLKDLNYKITNELKIKSESNENLKKKLDQSQ--------------------STQMSQYLSFTNQIYETNETNERFKMKLDKLKFMNDILKKSKPEIDLFIQKLPKDEPPQFKIEKLCSALVTCQNDLNYYKKNSDEISKKLARTILK--NSTLKT--EIDQLKEQMSNTDSNFPDLNTSELLDTPVTAMRTK---MRRQLTTP 849
            C+IC   F  +  V+A+ CGH FH  C+  W        CPQCR   +  + I KLFF+   +  ++   E+         L +EL +++ L      + + K ++ + LK  +D+ +                      QM+      N++    E   R + KL   + ++ +L+  + E++  I  +   +    ++   C +L    ++L    K+S+++ +KL R +L   N   KT  E+ Q KE +++  ++  +       D  +++++ K   +++ L+TP
Sbjct:    7 CTICSDLFDHSRDVAAIHCGHTFHYECVLKWFQTAPTKTCPQCRKQVSTRHIICKLFFNIGGEEESTLDPES---------LENELGRVRALLSSKEQDWRDKQKAMDILKDTVDRQKRDLDNMRKEIRDKDMLCSALKKQMTYMEMQQNEVQAAKEEARRLRTKLKTFESLDVLLQGQRAEVESMITDMGVSQSAVEQLSIYCISLKKEYDNLKGSLKSSNDMCEKLKREVLSSNNKLQKTSLELHQTKEDVTSLQADLAN------ADKEISSLKKKVDFLQKTLSTP 281          
BLAST of TRAF interacting protein vs. Ensembl Medaka
Match: rnf181 (ring finger protein 181 [Source:NCBI gene;Acc:101167798])

HSP 1 Score: 48.521 bits (114), Expect = 1.252e-6
Identity = 18/42 (42.86%), Postives = 24/42 (57.14%), Query Frame = 1
Query:   70 CSICQQSFSENCTVSALLCGHVFHSNCLTMWLNNKSNCPQCR 195
            C +C   F E  TV  + C H+FHS C+  WL   ++CP CR
Sbjct:   80 CPVCLLEFEEQETVREMPCKHLFHSGCILPWLGKTNSCPLCR 121          
BLAST of TRAF interacting protein vs. Ensembl Medaka
Match: si:dkeyp-86f7.4 (E3 ubiquitin-protein ligase RNF128 [Source:NCBI gene;Acc:101174167])

HSP 1 Score: 50.0618 bits (118), Expect = 2.274e-6
Identity = 16/43 (37.21%), Postives = 27/43 (62.79%), Query Frame = 1
Query:   70 CSICQQSFSENCTVSALLCGHVFHSNCLTMWLNNKSNCPQCRS 198
            C++C +S+ +   V+ L C H+FH  C+  WL ++  CP C+S
Sbjct:  250 CAVCIESYKQGDVVTVLTCDHIFHKACIEPWLLDRRTCPMCKS 292          
BLAST of TRAF interacting protein vs. Ensembl Medaka
Match: rnf130 (ring finger protein 130 [Source:NCBI gene;Acc:101165289])

HSP 1 Score: 50.0618 bits (118), Expect = 2.461e-6
Identity = 18/43 (41.86%), Postives = 25/43 (58.14%), Query Frame = 1
Query:   67 HCSICQQSFSENCTVSALLCGHVFHSNCLTMWLNNKSNCPQCR 195
            HC++C +++  N  V  L C HVFH  C+  WLN    CP C+
Sbjct:  240 HCAVCIEAYQLNDVVRILPCKHVFHKVCVDPWLNEHCTCPMCK 282          
BLAST of TRAF interacting protein vs. Ensembl Medaka
Match: rnf130 (ring finger protein 130 [Source:NCBI gene;Acc:101165289])

HSP 1 Score: 50.0618 bits (118), Expect = 2.765e-6
Identity = 18/43 (41.86%), Postives = 25/43 (58.14%), Query Frame = 1
Query:   67 HCSICQQSFSENCTVSALLCGHVFHSNCLTMWLNNKSNCPQCR 195
            HC++C +++  N  V  L C HVFH  C+  WLN    CP C+
Sbjct:  269 HCAVCIEAYQLNDVVRILPCKHVFHKVCVDPWLNEHCTCPMCK 311          
BLAST of TRAF interacting protein vs. Planmine SMEST
Match: SMESG000027291.1 (SMESG000027291.1)

HSP 1 Score: 701.049 bits (1808), Expect = 0.000e+0
Identity = 368/371 (99.19%), Postives = 370/371 (99.73%), Query Frame = 1
Query:   55 MLICHCSICQQSFSENCTVSALLCGHVFHSNCLTMWLNNKSNCPQCRSPNVGNYIKKLFFDKMXXXXXXXXXXXXXXXXXXFKLRSELDKLKDLNYKITNELKIKSESNENLKKKLDQSQSTQMSQYLSFTNQIYETNETNERFKMKLDKLKFMNDILKKSKPEIDLFIQKLPKDEPPQFKIEKLCSALVTCQNDLNYYKKNSDEISKKLARTILKNSTLKTEIDQLKEQMSNTDSNFPDLNTSELLDTPVTAMRTKMRRQLTTPEMLLSSPDMSTNQQNEKHFRQKLLENPFRCTPKRSLSQKSSWKLDIMINRSKPTRLPPPHIIRLDSDTENHPSEEPVRKLKKVPRSKHIQPIKKDSTSSTPVYHSL 1167
            MLICHCSICQQSFSENCTVSALLCGHVFHSNCLTMWLNNKSNCPQCRSPNVGNYIKKLFFDKMSDNNNSFINENNSVNEENFKLRSELDKLKDLNYKITNELKIKSESNENLKKKLDQSQSTQMSQYLSFTNQIYETNETNERFKMKLDKLKFMNDILKKSKPEIDLFIQKLPKDEPPQF+IEKLCSALVTCQNDLNYYKKNSDEISKKLARTILKNSTLKTEIDQLKEQMSNTDSNFPDLNTSELLDTPVTAMRTKMRRQLTTPEMLLSSPDMSTNQQNEKHFRQKLLENPFRCTPKRSLSQKSSWKLDIMINRSKPTRLPPPHIIRLDSDTENHP EEPVRKLKKVPRSKHI+PIKKDSTSSTPVYHSL
Sbjct:    1 MLICHCSICQQSFSENCTVSALLCGHVFHSNCLTMWLNNKSNCPQCRSPNVGNYIKKLFFDKMSDNNNSFINENNSVNEENFKLRSELDKLKDLNYKITNELKIKSESNENLKKKLDQSQSTQMSQYLSFTNQIYETNETNERFKMKLDKLKFMNDILKKSKPEIDLFIQKLPKDEPPQFQIEKLCSALVTCQNDLNYYKKNSDEISKKLARTILKNSTLKTEIDQLKEQMSNTDSNFPDLNTSELLDTPVTAMRTKMRRQLTTPEMLLSSPDMSTNQQNEKHFRQKLLENPFRCTPKRSLSQKSSWKLDIMINRSKPTRLPPPHIIRLDSDTENHPIEEPVRKLKKVPRSKHIKPIKKDSTSSTPVYHSL 371          
BLAST of TRAF interacting protein vs. Planmine SMEST
Match: SMESG000027291.1 (SMESG000027291.1)

HSP 1 Score: 626.706 bits (1615), Expect = 0.000e+0
Identity = 334/337 (99.11%), Postives = 336/337 (99.70%), Query Frame = 1
Query:  157 MWLNNKSNCPQCRSPNVGNYIKKLFFDKMXXXXXXXXXXXXXXXXXXFKLRSELDKLKDLNYKITNELKIKSESNENLKKKLDQSQSTQMSQYLSFTNQIYETNETNERFKMKLDKLKFMNDILKKSKPEIDLFIQKLPKDEPPQFKIEKLCSALVTCQNDLNYYKKNSDEISKKLARTILKNSTLKTEIDQLKEQMSNTDSNFPDLNTSELLDTPVTAMRTKMRRQLTTPEMLLSSPDMSTNQQNEKHFRQKLLENPFRCTPKRSLSQKSSWKLDIMINRSKPTRLPPPHIIRLDSDTENHPSEEPVRKLKKVPRSKHIQPIKKDSTSSTPVYHSL 1167
            MWLNNKSNCPQCRSPNVGNYIKKLFFDKMSDNNNSFINENNSVNEENFKLRSELDKLKDLNYKITNELKIKSESNENLKKKLDQSQSTQMSQYLSFTNQIYETNETNERFKMKLDKLKFMNDILKKSKPEIDLFIQKLPKDEPPQF+IEKLCSALVTCQNDLNYYKKNSDEISKKLARTILKNSTLKTEIDQLKEQMSNTDSNFPDLNTSELLDTPVTAMRTKMRRQLTTPEMLLSSPDMSTNQQNEKHFRQKLLENPFRCTPKRSLSQKSSWKLDIMINRSKPTRLPPPHIIRLDSDTENHP EEPVRKLKKVPRSKHI+PIKKDSTSSTPVYHSL
Sbjct:    1 MWLNNKSNCPQCRSPNVGNYIKKLFFDKMSDNNNSFINENNSVNEENFKLRSELDKLKDLNYKITNELKIKSESNENLKKKLDQSQSTQMSQYLSFTNQIYETNETNERFKMKLDKLKFMNDILKKSKPEIDLFIQKLPKDEPPQFQIEKLCSALVTCQNDLNYYKKNSDEISKKLARTILKNSTLKTEIDQLKEQMSNTDSNFPDLNTSELLDTPVTAMRTKMRRQLTTPEMLLSSPDMSTNQQNEKHFRQKLLENPFRCTPKRSLSQKSSWKLDIMINRSKPTRLPPPHIIRLDSDTENHPIEEPVRKLKKVPRSKHIKPIKKDSTSSTPVYHSL 337          
BLAST of TRAF interacting protein vs. Planmine SMEST
Match: SMESG000001799.1 (SMESG000001799.1)

HSP 1 Score: 77.7962 bits (190), Expect = 6.939e-16
Identity = 76/285 (26.67%), Postives = 135/285 (47.37%), Query Frame = 1
Query:   55 MLICHCSICQQSFSENCTVSALLCGHVFHSNCLTMWLNNKSNCPQCRSPNV-GNYIKKLFFDK------MXXXXXXXXXXXXXXXXXXFKLRSE----LDKLK----DLNYKIT----------NELKIKSESNENLKKKLDQSQSTQMSQYLSFTNQIYETNETNERFKMKLDKLKFMNDILKKSKPEIDLFIQKLPKDEPPQFKIEKLCSALVTCQNDLNYYKKNSDEISKKLARTILKNSTLKTEIDQLKEQMSNT--DSNFPDLNTSELLDTPVTAMRTKM 828
            M++  C IC + FS    ++ L CGH+FH  C+  W   K  CP CR   +  +Y++K+FFD+      + +  + F      +N    KL+ E    LDK++    + N KIT           +  +    NE L K+L   +    S   + T ++++ NE   + K +  KL F+ND+L  +  E+   +  L        +++ L SA V CQN+ N  +K+  ++  +L     KN  L+++I +L+E + +   +  F    + E ++ P+ A R K+
Sbjct:    1 MILASCLICFEPFSHKQNLTVLSCGHIFHQECILKWFKTKMACPTCRKTQLKKSYVEKVFFDQSNNEISLINTASDFNENEAILNSRITKLQMEKKDLLDKVEKNSHNFNDKITKLELENRELNKKFGVFVSLNETLSKELKSMREDYSS---AITEKVFKENEI-LQLKRENYKLNFINDMLTGTADELSQKMLSLRDLGDLSVQLDALSSAFVICQNEKNAIEKSKIKLKDELENVKTKNQKLQSKIFKLEETLKSVQNERKFDKQASFERIEQPI-ATRIKI 280          
BLAST of TRAF interacting protein vs. Planmine SMEST
Match: SMESG000076860.1 (SMESG000076860.1)

HSP 1 Score: 53.5286 bits (127), Expect = 1.855e-7
Identity = 22/46 (47.83%), Postives = 27/46 (58.70%), Query Frame = 1
Query:   70 CSICQQSFSENCTVSALLCGHVFHSNCLTMWLN--NKSNCPQCRSP 201
            C IC   F +N  +  L CGH FH +C+  WL   +K NCPQCR P
Sbjct:  530 CCICLGRFMQNEMLCGLPCGHAFHDSCIKTWLTECHKDNCPQCRWP 575          
BLAST of TRAF interacting protein vs. Planmine SMEST
Match: SMESG000076872.1 (SMESG000076872.1)

HSP 1 Score: 53.1434 bits (126), Expect = 2.073e-7
Identity = 22/46 (47.83%), Postives = 27/46 (58.70%), Query Frame = 1
Query:   70 CSICQQSFSENCTVSALLCGHVFHSNCLTMWLN--NKSNCPQCRSP 201
            C IC   F +N  +  L CGH FH +C+  WL   +K NCPQCR P
Sbjct:  516 CCICLGRFMQNEMLCGLPCGHAFHDSCIKTWLTECHKDNCPQCRWP 561          
The following BLAST results are available for this feature:
BLAST of TRAF interacting protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRAIP9.603e-1226.98TRAF interacting protein [Source:HGNC Symbol;Acc:H... [more]
TRAIP1.007e-923.69TRAF interacting protein [Source:HGNC Symbol;Acc:H... [more]
RNF1037.020e-946.15ring finger protein 103 [Source:HGNC Symbol;Acc:HG... [more]
TRAIP9.421e-944.26TRAF interacting protein [Source:HGNC Symbol;Acc:H... [more]
TRAIP2.367e-845.00TRAF interacting protein [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of TRAF interacting protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trul-19.038e-1341.94pep chromosome:WBcel235:II:279128:282576:-1 gene:W... [more]
trul-19.038e-1341.94pep chromosome:WBcel235:II:278621:282576:-1 gene:W... [more]
toe-42.944e-640.48Target Of ERK kinase MPK-1 [Source:UniProtKB/TrEM... [more]
plr-14.362e-641.46Probable E3 ubiquitin-protein ligase plr-1 [Sourc... [more]
sel-111.000e-537.21E3 ubiquitin-protein ligase hrd-1 [Source:UniProt... [more]
back to top
BLAST of TRAF interacting protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nopo3.838e-1040.98gene:FBgn0034314 transcript:FBtr0086750[more]
nopo4.040e-1040.98gene:FBgn0034314 transcript:FBtr0332852[more]
CG109161.505e-944.64gene:FBgn0034312 transcript:FBtr0086749[more]
CG109161.505e-944.64gene:FBgn0034312 transcript:FBtr0332853[more]
Iru6.956e-750.00gene:FBgn0037653 transcript:FBtr0081965[more]
back to top
BLAST of TRAF interacting protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traip1.713e-1325.00TRAF-interacting protein [Source:ZFIN;Acc:ZDB-GENE... [more]
traip1.713e-1325.00TRAF-interacting protein [Source:ZFIN;Acc:ZDB-GENE... [more]
rnf1032.315e-844.23ring finger protein 103 [Source:ZFIN;Acc:ZDB-GENE-... [more]
rnf1301.972e-641.86ring finger protein 130 [Source:ZFIN;Acc:ZDB-GENE-... [more]
BX005169.12.011e-641.86pep chromosome:GRCz11:CHR_ALT_CTG14_1_32:36772984:... [more]
back to top
BLAST of TRAF interacting protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traip1.546e-1224.32TRAF interacting protein [Source:NCBI gene;Acc:550... [more]
traip6.650e-1125.64TRAF interacting protein [Source:NCBI gene;Acc:550... [more]
dlc6.986e-742.62putative ortholog of delta-like protein C precurso... [more]
rnf1301.887e-641.86ring finger protein 130 [Source:NCBI gene;Acc:1001... [more]
rnf1812.019e-645.24ring finger protein 181 [Source:NCBI gene;Acc:4966... [more]
back to top
BLAST of TRAF interacting protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Traip4.296e-1225.00TRAF-interacting protein [Source:MGI Symbol;Acc:MG... [more]
Rnf1037.031e-945.65ring finger protein 103 [Source:MGI Symbol;Acc:MGI... [more]
Rnf1037.031e-945.65ring finger protein 103 [Source:MGI Symbol;Acc:MGI... [more]
Rnf1303.752e-741.86ring finger protein 130 [Source:MGI Symbol;Acc:MGI... [more]
Rnf1304.011e-741.86ring finger protein 130 [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of TRAF interacting protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8VIG6|TRAIP_MOUSE3.005e-1125.00E3 ubiquitin-protein ligase TRAIP OS=Mus musculus ... [more]
sp|Q9BWF2|TRAIP_HUMAN4.611e-1126.98E3 ubiquitin-protein ligase TRAIP OS=Homo sapiens ... [more]
sp|O00237|RN103_HUMAN3.371e-846.15E3 ubiquitin-protein ligase RNF103 OS=Homo sapiens... [more]
sp|Q9R1W3|RN103_MOUSE4.918e-845.65E3 ubiquitin-protein ligase RNF103 OS=Mus musculus... [more]
sp|Q9EPZ8|RN103_RAT5.091e-845.65E3 ubiquitin-protein ligase RNF103 OS=Rattus norve... [more]
back to top
BLAST of TRAF interacting protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
I1ZI750.000e+097.63TRAF interacting protein OS=Schmidtea mediterranea... [more]
I3KWR32.995e-1225.34TRAF-interacting protein OS=Oreochromis niloticus ... [more]
A0A4U1EHL39.880e-1225.00RING-type domain-containing protein OS=Monodon mon... [more]
A0A2H2IID11.203e-1130.97RING-type domain-containing protein OS=Caenorhabdi... [more]
A0A484GVV31.224e-1125.52RING-type domain-containing protein OS=Sousa chine... [more]
back to top
BLAST of TRAF interacting protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traip8.286e-1222.37TRAF interacting protein [Source:NCBI gene;Acc:103... [more]
traip9.314e-1222.37TRAF interacting protein [Source:NCBI gene;Acc:103... [more]
rnf1033.131e-844.23ring finger protein 103 [Source:NCBI gene;Acc:1030... [more]
rnf1302.753e-641.86ring finger protein 130 [Source:NCBI gene;Acc:1030... [more]
rnf1302.863e-641.86ring finger protein 130 [Source:NCBI gene;Acc:1030... [more]
back to top
BLAST of TRAF interacting protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
rnf1037.397e-839.53ring finger protein 103 [Source:ZFIN;Acc:ZDB-GENE-... [more]
RNF1159.321e-742.86ring finger protein 115 [Source:HGNC Symbol;Acc:HG... [more]
si:ch1073-392o20.11.465e-636.36ring finger protein 122 [Source:HGNC Symbol;Acc:HG... [more]
rnf1264.662e-637.21ring finger protein 126 [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of TRAF interacting protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TRAF interacting protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO408498.502e-944.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO491131.338e-640.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of TRAF interacting protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traip3.401e-921.72TRAF interacting protein [Source:NCBI gene;Acc:101... [more]
rnf1811.252e-642.86ring finger protein 181 [Source:NCBI gene;Acc:1011... [more]
si:dkeyp-86f7.42.274e-637.21E3 ubiquitin-protein ligase RNF128 [Source:NCBI ge... [more]
rnf1302.461e-641.86ring finger protein 130 [Source:NCBI gene;Acc:1011... [more]
rnf1302.765e-641.86ring finger protein 130 [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of TRAF interacting protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000027291.10.000e+099.19SMESG000027291.1[more]
SMESG000027291.10.000e+099.11SMESG000027291.1[more]
SMESG000001799.16.939e-1626.67SMESG000001799.1[more]
SMESG000076860.11.855e-747.83SMESG000076860.1[more]
SMESG000076872.12.073e-747.83SMESG000076872.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30011838
GenBankAFJ24729.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011838 ID=SMED30011838|Name=TRAF interacting protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1175bp
TTTGTTTGAATATTCTTTCTTAGCAAAGTTCCTTTGAATTTTAATTTTAA
GATTATGCTAATTTGTCATTGTTCAATTTGTCAGCAGTCTTTTAGTGAAA
ATTGTACAGTATCTGCTTTATTATGTGGACATGTTTTTCATTCAAATTGT
CTTACAATGTGGCTAAATAACAAGTCAAATTGTCCCCAATGTAGAAGTCC
AAATGTCGGAAATTACATTAAAAAACTATTTTTTGACAAAATGTCTGATA
ATAATAACTCCTTTATAAACGAAAATAATTCGGTTAACGAAGAAAATTTT
AAGTTGCGGTCAGAATTAGATAAACTAAAGGATTTAAACTACAAAATTAC
AAATGAATTGAAAATAAAGTCTGAGTCAAATGAGAATTTGAAAAAGAAAC
TAGATCAGTCTCAAAGCACTCAAATGTCACAGTATTTATCATTTACCAAC
CAAATTTATGAAACAAATGAAACAAATGAGAGATTTAAAATGAAACTAGA
TAAACTTAAATTTATGAATGATATCTTAAAAAAATCAAAGCCAGAAATAG
ATTTATTTATTCAAAAATTACCGAAAGATGAACCTCCACAATTTAAAATA
GAAAAATTATGTTCTGCACTTGTAACTTGCCAAAACGATTTAAATTATTA
TAAAAAAAACTCTGATGAAATTTCCAAGAAATTAGCAAGAACAATTTTGA
AAAATTCAACTCTTAAAACTGAAATTGATCAATTAAAAGAGCAGATGAGC
AACACCGATTCGAATTTTCCGGATTTGAACACGAGTGAACTTCTCGATAC
TCCCGTTACAGCGATGCGTACGAAAATGCGGAGACAGTTGACGACTCCTG
AAATGCTGTTGTCTTCTCCGGATATGTCGACCAATCAACAAAATGAAAAA
CATTTCCGCCAGAAATTACTAGAAAATCCATTCAGATGCACTCCAAAACG
ATCTCTCAGTCAGAAAAGCTCTTGGAAATTGGACATAATGATTAATAGAT
CGAAACCCACTCGATTGCCGCCTCCGCATATTATTCGACTCGACAGTGAC
ACGGAAAATCATCCGAGTGAGGAGCCAGTTAGGAAATTGAAAAAAGTACC
TCGTTCGAAACACATTCAGCCAATCAAAAAAGATTCAACCAGTTCGACTC
CAGTTTATCATTCGCTCTGAACGCC
back to top

protein sequence of SMED30011838-orf-1

>SMED30011838-orf-1 ID=SMED30011838-orf-1|Name=SMED30011838-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=372bp
MLICHCSICQQSFSENCTVSALLCGHVFHSNCLTMWLNNKSNCPQCRSPN
VGNYIKKLFFDKMSDNNNSFINENNSVNEENFKLRSELDKLKDLNYKITN
ELKIKSESNENLKKKLDQSQSTQMSQYLSFTNQIYETNETNERFKMKLDK
LKFMNDILKKSKPEIDLFIQKLPKDEPPQFKIEKLCSALVTCQNDLNYYK
KNSDEISKKLARTILKNSTLKTEIDQLKEQMSNTDSNFPDLNTSELLDTP
VTAMRTKMRRQLTTPEMLLSSPDMSTNQQNEKHFRQKLLENPFRCTPKRS
LSQKSSWKLDIMINRSKPTRLPPPHIIRLDSDTENHPSEEPVRKLKKVPR
SKHIQPIKKDSTSSTPVYHSL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004842ubiquitin-protein transferase activity
GO:0008270zinc ion binding
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0016567protein ubiquitination
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000429neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR001841Znf_RING
IPR013083Znf_RING/FYVE/PHD
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 102..122
NoneNo IPR availableCOILSCoilCoilcoord: 74..94
NoneNo IPR availableCOILSCoilCoilcoord: 210..237
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 331..371
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 331..346
NoneNo IPR availablePANTHERPTHR46569FAMILY NOT NAMEDcoord: 4..308
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 5..50
IPR001841Zinc finger, RING-typeSMARTSM00184ring_2coord: 6..46
e-value: 3.7E-6
score: 36.4
IPR001841Zinc finger, RING-typePFAMPF13639zf-RING_2coord: 5..47
e-value: 1.3E-9
score: 38.2
IPR001841Zinc finger, RING-typePROSITEPS50089ZF_RING_2coord: 6..47
score: 12.873
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 5..52
e-value: 1.5E-13
score: 52.0