5-hydroxytryptamine receptor

Overview
Name5-hydroxytryptamine receptor
Smed IDSMED30011836
Length (bp)1968
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of 5-hydroxytryptamine receptor (SMED30011836) t-SNE clustered cells

Violin plots show distribution of expression levels for 5-hydroxytryptamine receptor (SMED30011836) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of 5-hydroxytryptamine receptor (SMED30011836) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for 5-hydroxytryptamine receptor (SMED30011836) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011836

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30011836h1SMcG0003850 dd_Smed_v4_21082_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30011836h1SMcG0003850 dd_Smed_v4_21082_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30011836h1SMcG0003850 dd_Smed_v4_21082_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30011836h1SMcG0003850 dd_Smed_v6_21082_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
enteric muscle cellSMED30011836h1SMcG0003850 dd_Smed_v4_21082_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Human
Match: HTR1A (5-hydroxytryptamine receptor 1A [Source:HGNC Symbol;Acc:HGNC:5286])

HSP 1 Score: 155.221 bits (391), Expect = 1.299e-40
Identity = 93/196 (47.45%), Postives = 133/196 (67.86%), Query Frame = 3
Query:  153 LTSAVLGSLILCTIIGNVFVVAAIILEKNLQSVSNYLILSLAVADXXXXXXXXXXXXXXEISKQWFLGIELCDFWVCFDVLCCSASILHLVAIAFDRYWAVTN-IDYIRMRTAKRXXXXXXXXXXXXXXXXXPSRFYSSRTWENVYKSVVIDGLCNINDEYFYTIFSTVGAFYMPMFLLIGIYLKIYQTARARIRK 737
            +TS +LG+LI C ++GN  VVAAI LE++LQ+V+NYLI SLAV DLMV+ LV+ ++ L ++  +W LG   CD ++  DVLCC++SILHL AIA DRYWA+T+ IDY+  RT +R   +I + W +  +ISIP        W         D  C I+ ++ YTI+ST GAFY+P+ L++ +Y +I++ AR RIRK
Sbjct:   38 ITSLLLGTLIFCAVLGNACVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPML----GWRTPEDRSDPDA-CTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRK 228          

HSP 2 Score: 106.301 bits (264), Expect = 6.807e-24
Identity = 52/115 (45.22%), Postives = 68/115 (59.13%), Query Frame = 3
Query: 1527 LPTHGSRTDTYPKTFVTNSDFTSKKSFIEQQKQKLEHKRERKAARTLAIITGCFILCWLPFFIQALYLPFCGRQCVPNDIFSSFFLWLGYCNSLLNPIIYTIFSPEFRNAFNKIL 1871
            LP+    T   P +F   ++  +      + K+K+   RERK  +TL II G FILCWLPFFI AL LPFC   C    +  +   WLGY NSLLNP+IY  F+ +F+NAF KI+
Sbjct:  307 LPSEAGPTPCAPASFERKNERNA------EAKRKMALARERKTVKTLGIIMGTFILCWLPFFIVALVLPFCESSCHMPTLLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKII 415          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Human
Match: HTR1B (5-hydroxytryptamine receptor 1B [Source:HGNC Symbol;Acc:HGNC:5287])

HSP 1 Score: 134.42 bits (337), Expect = 1.437e-33
Identity = 86/193 (44.56%), Postives = 120/193 (62.18%), Query Frame = 3
Query:  165 VLGSLILCTIIGNVFVVAAIILEKNLQSVSNYLILSLAVADXXXXXXXXXXXXXXEISKQWFLGIELCDFWVCFDVLCCSASILHLVAIAFDRYWAVTN-IDYIRMRTAKRXXXXXXXXXXXXXXXXXPSRFYSSRTWENVYKSVVIDGLCNINDEYFYTIFSTVGAFYMPMFLLIGIYLKIYQTARARIRKH 740
            +L  + L T + N FV+A +   + L + +NYLI SLAV DL+V+ LVM +S +  ++ +W LG  +CDFW+  D+ CC+ASILHL  IA DRYWA+T+ ++Y   RT KR  +MI +VW  SI IS+P  F+     E      V++      D   YT++STVGAFY P  LLI +Y +IY  AR+RI K 
Sbjct:   55 LLALITLATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQVVCDFWLSSDITCCTASILHLCVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSISISLPPFFWRQAKAEEEVSECVVN-----TDHILYTVYSTVGAFYFPTLLLIALYGRIYVEARSRILKQ 242          

HSP 2 Score: 99.7525 bits (247), Expect = 8.489e-22
Identity = 45/85 (52.94%), Postives = 60/85 (70.59%), Query Frame = 3
Query: 1617 QKQKLEHKRERKAARTLAIITGCFILCWLPFFIQALYLPFCGRQCVPNDIFSSFFLWLGYCNSLLNPIIYTIFSPEFRNAFNKIL 1871
            +K+KL   RERKA +TL II G FI+CWLPFFI +L +P C   C  +     FF WLGY NSL+NPIIYT+ + +F+ AF+K++
Sbjct:  300 EKKKLMAARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHLAIFDFFTWLGYLNSLINPIIYTMSNEDFKQAFHKLI 384          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Human
Match: HTR1D (5-hydroxytryptamine receptor 1D [Source:HGNC Symbol;Acc:HGNC:5289])

HSP 1 Score: 120.939 bits (302), Expect = 4.965e-29
Identity = 84/192 (43.75%), Postives = 118/192 (61.46%), Query Frame = 3
Query:  159 SAVLGSLILCTIIGNVFVVAAIILEKNLQSVSNYLILSLAVADXXXXXXXXXXXXXXEISKQWFLGIELCDFWVCFDVLCCSASILHLVAIAFDRYWAVTN-IDYIRMRTAKRXXXXXXXXXXXXXXXXXPSRFYSSRTWENVYKSVVIDGLCNINDEYFYTIFSTVGAFYMPMFLLIGIYLKIYQTARARI 731
            + VL  + L T++ N FV+  I+L + L + +NYLI SLA  DL+V+ LVM +S+   I+  W  G  LCD W+  D+ CC+ASILHL  IA DRYWA+T+ ++Y + RTA     MI IVW +SI ISIP  F+     +      +++       +  YTI+ST GAFY+P  LLI +Y +IY+ AR RI
Sbjct:   42 AVVLSVITLATVLSNAFVLTTILLTRKLHTPANYLIGSLATTDLLVSILVMPISIAYTITHTWNFGQILCDIWLSSDITCCTASILHLCVIALDRYWAITDALEYSKRRTAGHAATMIAIVWAISICISIPPLFWRQAKAQEEMSDCLVN-----TSQISYTIYSTCGAFYIPSVLLIILYGRIYRAARNRI 228          

HSP 2 Score: 104.76 bits (260), Expect = 1.562e-23
Identity = 45/85 (52.94%), Postives = 59/85 (69.41%), Query Frame = 3
Query: 1617 QKQKLEHKRERKAARTLAIITGCFILCWLPFFIQALYLPFCGRQCVPNDIFSSFFLWLGYCNSLLNPIIYTIFSPEFRNAFNKIL 1871
            +++++   RERKA + L II G FI+CWLPFF+ +L LP C   C  +     FF WLGY NSL+NPIIYT+F+ EFR AF KI+
Sbjct:  287 ERKRISAARERKATKILGIILGAFIICWLPFFVVSLVLPICRDSCWIHPALFDFFTWLGYLNSLINPIIYTVFNEEFRQAFQKIV 371          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Human
Match: HTR1E (5-hydroxytryptamine receptor 1E [Source:HGNC Symbol;Acc:HGNC:5291])

HSP 1 Score: 117.087 bits (292), Expect = 7.564e-28
Identity = 83/180 (46.11%), Postives = 115/180 (63.89%), Query Frame = 3
Query:  210 VVAAIILEKNLQSVSNYLILSLAVADXXXXXXXXXXXXXXEISKQWFLGIELCDFWVCFDVLCCSASILHLVAIAFDRYWAVTN-IDYIRMRTAKRXXXXXXXXXXXXXXXXXPSRFYSSRTWENVYKSVVIDGLCNI-NDEYFYTIFSTVGAFYMPMFLLIGIYLKIYQTARARIRKHG 743
            V+ AI   K L   +NYLI SLAV DL+VA LVM +S++  +  +W LG  LC+ W+  D+ CC+ SILHL  IA DRYWA+TN I+Y R RTAKR  +MI+ VW +SI IS+P  F     W +  +       C I +D   YTI+ST+GAFY+P+ L++ +Y +IY  A++  +K G
Sbjct:   43 VIMAIGTTKKLHQPANYLICSLAVTDLLVAVLVMPLSIIYIVMDRWKLGYFLCEVWLSVDMTCCTCSILHLCVIALDRYWAITNAIEYARKRTAKRAALMILTVWTISIFISMPPLF-----WRSHRRLSPPPSQCTIQHDHVIYTIYSTLGAFYIPLTLILILYYRIYHAAKSLYQKRG 217          

HSP 2 Score: 82.0333 bits (201), Expect = 3.707e-16
Identity = 40/88 (45.45%), Postives = 59/88 (67.05%), Query Frame = 3
Query: 1617 QKQKLEHKRERKAARTLAIITGCFILCWLPFFIQALYLPFCGRQCVPNDIFSSFFLWLGYCNSLLNPIIYTIFSPEFRNAFNKILFGR 1880
            ++Q++   RERKAAR L +I G FIL WLPFFI+ L +       V +++ + F  WLGY NSL+NP++YT F+ +F+ AF K++  R
Sbjct:  277 ERQQISSTRERKAARILGLILGAFILSWLPFFIKELIVGL-SIYTVSSEV-ADFLTWLGYVNSLINPLLYTSFNEDFKLAFKKLIRCR 362          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Human
Match: HTR1F (5-hydroxytryptamine receptor 1F [Source:HGNC Symbol;Acc:HGNC:5292])

HSP 1 Score: 112.849 bits (281), Expect = 1.987e-26
Identity = 84/192 (43.75%), Postives = 117/192 (60.94%), Query Frame = 3
Query:  153 LTSAVLGSLILCTIIGNVFVVAAIILEKNLQSVSNYLILSLAVADXXXXXXXXXXXXXXEISKQWFLGIELCDFWVCFDVLCCSASILHLVAIAFDRYWAVTN-IDYIRMRTAKRXXXXXXXXXXXXXXXXXPSRFYSSRTWENVYKSVVIDGLCNI-NDEYFYTIFSTVGAFYMPMFLLIGIYLKIYQTAR 722
            L S  L  L L T   N  V+AAII+ + L   +NYLI SLAV D +VA LVM  S++  + + W +G  +CD W+  D+ CC+ SILHL AIA DRY A+T+ ++Y R RT K   IMI IVW +S+ IS+P  F+        ++    D  C I +D    TI+ST GAFY+P+ L++ +Y KIY+ A+
Sbjct:   25 LVSLTLSGLALMTTTINSLVIAAIIVTRKLHHPANYLICSLAVTDFLVAVLVMPFSIVYIVRESWIMGQVVCDIWLSVDITCCTCSILHLSAIALDRYRAITDAVEYARKRTPKHAGIMITIVWIISVFISMPPLFWR-------HQGTSRDDECIIKHDHIVSTIYSTFGAFYIPLALILILYYKIYRAAK 209          

HSP 2 Score: 100.908 bits (250), Expect = 2.440e-22
Identity = 47/101 (46.53%), Postives = 70/101 (69.31%), Query Frame = 3
Query: 1578 NSDFTSKKSFIEQQKQKLEHKRERKAARTLAIITGCFILCWLPFFIQALYLPFCGRQCVPNDIFSSFFLWLGYCNSLLNPIIYTIFSPEFRNAFNKILFGR 1880
             S+F  +KS+   ++QK+   RERKAA TL +I G F++CWLPFF++ L +  C + C  ++  S+F  WLGY NSL+NP+IYTIF+ +F+ AF K++  R
Sbjct:  269 RSEFKHEKSW---RRQKISGTRERKAATTLGLILGAFVICWLPFFVKELVVNVCDK-CKISEEMSNFLAWLGYLNSLINPLIYTIFNEDFKKAFQKLVRCR 365          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Celegans
Match: ser-4 (SERotonin/octopamine receptor family; Serotonin receptor [Source:UniProtKB/TrEMBL;Acc:G5EGH0])

HSP 1 Score: 134.806 bits (338), Expect = 9.012e-34
Identity = 84/201 (41.79%), Postives = 130/201 (64.68%), Query Frame = 3
Query:  141 IHVYLTSAVLGSLILCTIIGNVFVVAAIILEKNLQSVSNY-LILSLAVADXXXXXXXXXXXXXXEISKQWFLGIELCDFWVCFDVLCCSASILHLVAIAFDRYWAVTNIDYIRMRTAKRXXXXXXXXXXXXXXXXXPSRFYSSRTWENVYKSVVIDGLCNINDEYFYTIFSTVGAFYMPMFLLIGIYLKIYQTARARIRKH 740
            +   + ++VL  LIL   IGN+FV+ AII+E++L+    Y LI SLAVADL+V  +V  +     ++  W LG+ +CDFW+  DVL C+ASILHLVAIA DRYW++T+I Y++ RT KRI +M+ ++WF S++IS+    ++    E     V+   +C I+ +  Y +FST  AFY+P+  +I +Y KI + A+ R ++ 
Sbjct:   49 VQTVILASVLLVLILSCFIGNLFVILAIIMERDLRGRPQYYLIFSLAVADLLVGMIVTPLGAWFTVTGTWNLGVVVCDFWISVDVLVCTASILHLVAIALDRYWSITDICYVQNRTPKRITLMLAVIWFTSLLISLAP--FAGWKDEGFSDRVLKSHVCLISQQISYQVFSTATAFYIPLIAIICVYWKIMRAAKKRFKRE 247          

HSP 2 Score: 106.301 bits (264), Expect = 3.526e-24
Identity = 54/115 (46.96%), Postives = 71/115 (61.74%), Query Frame = 3
Query: 1536 HGSRTDTYPKTFVTNSDFTSKKSFIEQQ---KQKLEHKRERKAARTLAIITGCFILCWLPFFIQALYLPFCGRQCVPNDIFSSFFLWLGYCNSLLNPIIYTIFSPEFRNAFNKIL 1871
            H     T  +T +   +  SK   ++++   K+  E KRERKA RTLAIITG F+ CW PFF+ ++Y P CG Q  P  +     LWLGY NS LNPIIYT+FS +FR AF +I+
Sbjct:  324 HAPGDVTTQETKIDEENGRSKPGIVKRRRRTKESNEMKRERKAWRTLAIITGTFVACWTPFFLVSIYRPICGCQISP--VLEQVTLWLGYLNSALNPIIYTVFSQDFRAAFKRII 436          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Celegans
Match: ser-4 (SERotonin/octopamine receptor family; Serotonin receptor [Source:UniProtKB/TrEMBL;Acc:G5EGH0])

HSP 1 Score: 134.806 bits (338), Expect = 9.012e-34
Identity = 84/201 (41.79%), Postives = 130/201 (64.68%), Query Frame = 3
Query:  141 IHVYLTSAVLGSLILCTIIGNVFVVAAIILEKNLQSVSNY-LILSLAVADXXXXXXXXXXXXXXEISKQWFLGIELCDFWVCFDVLCCSASILHLVAIAFDRYWAVTNIDYIRMRTAKRXXXXXXXXXXXXXXXXXPSRFYSSRTWENVYKSVVIDGLCNINDEYFYTIFSTVGAFYMPMFLLIGIYLKIYQTARARIRKH 740
            +   + ++VL  LIL   IGN+FV+ AII+E++L+    Y LI SLAVADL+V  +V  +     ++  W LG+ +CDFW+  DVL C+ASILHLVAIA DRYW++T+I Y++ RT KRI +M+ ++WF S++IS+    ++    E     V+   +C I+ +  Y +FST  AFY+P+  +I +Y KI + A+ R ++ 
Sbjct:   49 VQTVILASVLLVLILSCFIGNLFVILAIIMERDLRGRPQYYLIFSLAVADLLVGMIVTPLGAWFTVTGTWNLGVVVCDFWISVDVLVCTASILHLVAIALDRYWSITDICYVQNRTPKRITLMLAVIWFTSLLISLAP--FAGWKDEGFSDRVLKSHVCLISQQISYQVFSTATAFYIPLIAIICVYWKIMRAAKKRFKRE 247          

HSP 2 Score: 106.301 bits (264), Expect = 3.526e-24
Identity = 54/115 (46.96%), Postives = 71/115 (61.74%), Query Frame = 3
Query: 1536 HGSRTDTYPKTFVTNSDFTSKKSFIEQQ---KQKLEHKRERKAARTLAIITGCFILCWLPFFIQALYLPFCGRQCVPNDIFSSFFLWLGYCNSLLNPIIYTIFSPEFRNAFNKIL 1871
            H     T  +T +   +  SK   ++++   K+  E KRERKA RTLAIITG F+ CW PFF+ ++Y P CG Q  P  +     LWLGY NS LNPIIYT+FS +FR AF +I+
Sbjct:  324 HAPGDVTTQETKIDEENGRSKPGIVKRRRRTKESNEMKRERKAWRTLAIITGTFVACWTPFFLVSIYRPICGCQISP--VLEQVTLWLGYLNSALNPIIYTVFSQDFRAAFKRII 436          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Celegans
Match: ser-2 (Tyramine receptor Ser-2 [Source:UniProtKB/Swiss-Prot;Acc:O02213])

HSP 1 Score: 110.923 bits (276), Expect = 8.531e-26
Identity = 77/199 (38.69%), Postives = 130/199 (65.33%), Query Frame = 3
Query:  165 VLGSL-----ILCTIIGNVFVVAAIILEKNLQSVSNYLILSLAVADXXXXXXXXXXXXXXEISK-QWFLGIELCDFWVCFDVLCCSASILHLVAIAFDRYWAVTN-IDYIRMRTAKRXXXXXXXXXXXXXXXXXPSRFYSSRTWENVYKSVVIDGLCNINDEYFYTIFSTVGAFYMPMFLLIGIYLKIYQTARARIRKH 740
            VLG++     I  T++GN  VV A+   + L+ V NY ++SLA +DL VA  VM + +++ ++  +W LG+ +C F+   D+L C++SIL+L AIA DRYWA+ N I+Y + RT K + I+I+IVW LS++IS+P        W N  ++++ D  C ++ E  + +FS  G+F++P+ +++ +Y+KI+ +AR RIR +
Sbjct:   55 VLGTITYLVIIAMTVVGNTLVVVAVFSYRPLKKVQNYFLVSLAASDLAVAIFVMPLHVVTFLAGGKWLLGVTVCQFFTTADILLCTSSILNLCAIALDRYWAIHNPINYAQKRTTKFVCIVIVIVWILSMLISVPPII----GWNNWQENMMEDS-CGLSTEKAFVVFSAAGSFFLPLLVMVVVYVKIFISARQRIRTN 248          

HSP 2 Score: 82.4185 bits (202), Expect = 2.120e-16
Identity = 38/88 (43.18%), Postives = 55/88 (62.50%), Query Frame = 3
Query: 1608 IEQQKQKLEHKRERKAARTLAIITGCFILCWLPFFIQALYLPFCGRQCVPNDIFSSFFLWLGYCNSLLNPIIYTIFSPEFRNAFNKIL 1871
            + ++++K+   +E++AA+T+A+I   F  CWLPFF+  +  PFC   C  +      F WLGY NS LNP +Y I + EFR AF KIL
Sbjct:  326 VLRKREKISVAKEKRAAKTIAVIIFVFSFCWLPFFVAYVIRPFC-ETCKLHAKVEQAFTWLGYINSSLNPFLYGILNLEFRRAFKKIL 412          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Celegans
Match: ser-2 (Tyramine receptor Ser-2 [Source:UniProtKB/Swiss-Prot;Acc:O02213])

HSP 1 Score: 110.923 bits (276), Expect = 8.587e-26
Identity = 77/199 (38.69%), Postives = 130/199 (65.33%), Query Frame = 3
Query:  165 VLGSL-----ILCTIIGNVFVVAAIILEKNLQSVSNYLILSLAVADXXXXXXXXXXXXXXEISK-QWFLGIELCDFWVCFDVLCCSASILHLVAIAFDRYWAVTN-IDYIRMRTAKRXXXXXXXXXXXXXXXXXPSRFYSSRTWENVYKSVVIDGLCNINDEYFYTIFSTVGAFYMPMFLLIGIYLKIYQTARARIRKH 740
            VLG++     I  T++GN  VV A+   + L+ V NY ++SLA +DL VA  VM + +++ ++  +W LG+ +C F+   D+L C++SIL+L AIA DRYWA+ N I+Y + RT K + I+I+IVW LS++IS+P        W N  ++++ D  C ++ E  + +FS  G+F++P+ +++ +Y+KI+ +AR RIR +
Sbjct:   47 VLGTITYLVIIAMTVVGNTLVVVAVFSYRPLKKVQNYFLVSLAASDLAVAIFVMPLHVVTFLAGGKWLLGVTVCQFFTTADILLCTSSILNLCAIALDRYWAIHNPINYAQKRTTKFVCIVIVIVWILSMLISVPPII----GWNNWQENMMEDS-CGLSTEKAFVVFSAAGSFFLPLLVMVVVYVKIFISARQRIRTN 240          

HSP 2 Score: 82.4185 bits (202), Expect = 2.015e-16
Identity = 38/88 (43.18%), Postives = 55/88 (62.50%), Query Frame = 3
Query: 1608 IEQQKQKLEHKRERKAARTLAIITGCFILCWLPFFIQALYLPFCGRQCVPNDIFSSFFLWLGYCNSLLNPIIYTIFSPEFRNAFNKIL 1871
            + ++++K+   +E++AA+T+A+I   F  CWLPFF+  +  PFC   C  +      F WLGY NS LNP +Y I + EFR AF KIL
Sbjct:  318 VLRKREKISVAKEKRAAKTIAVIIFVFSFCWLPFFVAYVIRPFC-ETCKLHAKVEQAFTWLGYINSSLNPFLYGILNLEFRRAFKKIL 404          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Celegans
Match: ser-2 (Tyramine receptor Ser-2 [Source:UniProtKB/Swiss-Prot;Acc:O02213])

HSP 1 Score: 110.538 bits (275), Expect = 9.306e-26
Identity = 77/199 (38.69%), Postives = 130/199 (65.33%), Query Frame = 3
Query:  165 VLGSL-----ILCTIIGNVFVVAAIILEKNLQSVSNYLILSLAVADXXXXXXXXXXXXXXEISK-QWFLGIELCDFWVCFDVLCCSASILHLVAIAFDRYWAVTN-IDYIRMRTAKRXXXXXXXXXXXXXXXXXPSRFYSSRTWENVYKSVVIDGLCNINDEYFYTIFSTVGAFYMPMFLLIGIYLKIYQTARARIRKH 740
            VLG++     I  T++GN  VV A+   + L+ V NY ++SLA +DL VA  VM + +++ ++  +W LG+ +C F+   D+L C++SIL+L AIA DRYWA+ N I+Y + RT K + I+I+IVW LS++IS+P        W N  ++++ D  C ++ E  + +FS  G+F++P+ +++ +Y+KI+ +AR RIR +
Sbjct:   58 VLGTITYLVIIAMTVVGNTLVVVAVFSYRPLKKVQNYFLVSLAASDLAVAIFVMPLHVVTFLAGGKWLLGVTVCQFFTTADILLCTSSILNLCAIALDRYWAIHNPINYAQKRTTKFVCIVIVIVWILSMLISVPPII----GWNNWQENMMEDS-CGLSTEKAFVVFSAAGSFFLPLLVMVVVYVKIFISARQRIRTN 251          

HSP 2 Score: 82.0333 bits (201), Expect = 2.249e-16
Identity = 38/88 (43.18%), Postives = 55/88 (62.50%), Query Frame = 3
Query: 1608 IEQQKQKLEHKRERKAARTLAIITGCFILCWLPFFIQALYLPFCGRQCVPNDIFSSFFLWLGYCNSLLNPIIYTIFSPEFRNAFNKIL 1871
            + ++++K+   +E++AA+T+A+I   F  CWLPFF+  +  PFC   C  +      F WLGY NS LNP +Y I + EFR AF KIL
Sbjct:  317 VLRKREKISVAKEKRAAKTIAVIIFVFSFCWLPFFVAYVIRPFC-ETCKLHAKVEQAFTWLGYINSSLNPFLYGILNLEFRRAFKKIL 403          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Fly
Match: 5-HT1A (gene:FBgn0004168 transcript:FBtr0086577)

HSP 1 Score: 172.555 bits (436), Expect = 5.665e-45
Identity = 103/194 (53.09%), Postives = 139/194 (71.65%), Query Frame = 3
Query:  141 IHVYLTSAVLGSLILCTIIGNVFVVAAIILEKNLQSVSNYLILSLAVADXXXXXXXXXXXXXXEISKQWFLGIELCDFWVCFDVLCCSASILHLVAIAFDRYWAVTNIDYIRMRTAKRXXXXXXXXXXXXXXXXXPSRFYSSRTWENV-YKSVVIDGLCNINDEYFYTIFSTVGAFYMPMFLLIGIYLKIYQTA 719
            + + +TS +LG +IL TIIGNVFV+AAIILE+NLQ+V+NYL+ SLAVADL VA LVM +  + EIS+ W LG ELCD W   DVLCC+ASILHLVAIA DRYWAVTNIDYI  RT+ R+ +MI  VW  ++I+S+  +F     W++  Y   +    C ++ +  Y +F+T   FY+P+ +++ +Y KIYQTA
Sbjct:  224 LRMAVTSVLLGLMILVTIIGNVFVIAAIILERNLQNVANYLVASLAVADLFVACLVMPLGAVYEISQGWILGPELCDIWTSCDVLCCTASILHLVAIAVDRYWAVTNIDYIHSRTSNRVFMMIFCVWTAAVIVSLAPQF----GWKDPDYLQRIEQQKCMVSQDVSYQVFATCCTFYVPLLVILALYWKIYQTA 413          

HSP 2 Score: 134.42 bits (337), Expect = 1.991e-32
Identity = 58/93 (62.37%), Postives = 73/93 (78.49%), Query Frame = 3
Query: 1608 IEQQKQKLEHKRERKAARTLAIITGCFILCWLPFFIQALYLPFCGRQCVPNDIFSSFFLWLGYCNSLLNPIIYTIFSPEFRNAFNKILFGRYQ 1886
            + ++K+ LE KRERKAA+TLAIITG F++CWLPFF+ AL +P C   C  +D  +S FLWLGY NS LNP+IYTIFSPEFR AF +ILFG ++
Sbjct:  734 VNKRKETLEAKRERKAAKTLAIITGAFVVCWLPFFVMALTMPLCA-ACQISDSVASLFLWLGYFNSTLNPVIYTIFSPEFRQAFKRILFGGHR 825          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Fly
Match: 5-HT1A (gene:FBgn0004168 transcript:FBtr0474126)

HSP 1 Score: 172.555 bits (436), Expect = 7.016e-45
Identity = 103/194 (53.09%), Postives = 139/194 (71.65%), Query Frame = 3
Query:  141 IHVYLTSAVLGSLILCTIIGNVFVVAAIILEKNLQSVSNYLILSLAVADXXXXXXXXXXXXXXEISKQWFLGIELCDFWVCFDVLCCSASILHLVAIAFDRYWAVTNIDYIRMRTAKRXXXXXXXXXXXXXXXXXPSRFYSSRTWENV-YKSVVIDGLCNINDEYFYTIFSTVGAFYMPMFLLIGIYLKIYQTA 719
            + + +TS +LG +IL TIIGNVFV+AAIILE+NLQ+V+NYL+ SLAVADL VA LVM +  + EIS+ W LG ELCD W   DVLCC+ASILHLVAIA DRYWAVTNIDYI  RT+ R+ +MI  VW  ++I+S+  +F     W++  Y   +    C ++ +  Y +F+T   FY+P+ +++ +Y KIYQTA
Sbjct:  224 LRMAVTSVLLGLMILVTIIGNVFVIAAIILERNLQNVANYLVASLAVADLFVACLVMPLGAVYEISQGWILGPELCDIWTSCDVLCCTASILHLVAIAVDRYWAVTNIDYIHSRTSNRVFMMIFCVWTAAVIVSLAPQF----GWKDPDYLQRIEQQKCMVSQDVSYQVFATCCTFYVPLLVILALYWKIYQTA 413          

HSP 2 Score: 134.035 bits (336), Expect = 2.659e-32
Identity = 58/93 (62.37%), Postives = 73/93 (78.49%), Query Frame = 3
Query: 1608 IEQQKQKLEHKRERKAARTLAIITGCFILCWLPFFIQALYLPFCGRQCVPNDIFSSFFLWLGYCNSLLNPIIYTIFSPEFRNAFNKILFGRYQ 1886
            + ++K+ LE KRERKAA+TLAIITG F++CWLPFF+ AL +P C   C  +D  +S FLWLGY NS LNP+IYTIFSPEFR AF +ILFG ++
Sbjct:  734 VNKRKETLEAKRERKAAKTLAIITGAFVVCWLPFFVMALTMPLCA-ACQISDSVASLFLWLGYFNSTLNPVIYTIFSPEFRQAFKRILFGGHR 825          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Fly
Match: 5-HT1B (gene:FBgn0263116 transcript:FBtr0330055)

HSP 1 Score: 165.236 bits (417), Expect = 1.879e-43
Identity = 105/205 (51.22%), Postives = 142/205 (69.27%), Query Frame = 3
Query:  138 WIHVYL--TSAVLGSLILCTIIGNVFVVAAIILEKNLQSVSNYLILSLAVADXXXXXXXXXXXXXXEISKQWFLGIELCDFWVCFDVLCCSASILHLVAIAFDRYWAVTNIDYIRMRTAKRXXXXXXXXXXXXXXXXXPSRFYSSRTWENV-YKSVVIDGLCNINDEYFYTIFSTVGAFYMPMFLLIGIYLKIYQTARARIRKHG 743
            W+ V +   + VLG +IL TIIGNVFV+AAIILE+NLQ+V+NYL+ SLAVADL VA LVM +  + EIS  W LG ELCD W   DVLCC+ASILHLVAIA DRYW VTNIDY  +RT +R+ +MI  VWF ++I+S+  +F     W++  Y   + +  C ++ +  Y IF+T   FY+P+ +++ +Y KIY  AR RI++  
Sbjct:   85 WLLVKMIAMAVVLGLMILVTIIGNVFVIAAIILERNLQNVANYLVASLAVADLFVACLVMPLGAVYEISNGWILGPELCDIWTSCDVLCCTASILHLVAIAADRYWTVTNIDYNNLRTPRRVFLMIFCVWFAALIVSLAPQF----GWKDPDYMKRIEEQHCMVSQDVGYQIFATCCTFYVPLLVILFLYWKIYIIARKRIQRRA 285          

HSP 2 Score: 124.79 bits (312), Expect = 1.100e-29
Identity = 55/90 (61.11%), Postives = 71/90 (78.89%), Query Frame = 3
Query: 1608 IEQQKQKLEHKRERKAARTLAIITGCFILCWLPFFIQALYLPFCGRQCVPNDIFSSFFLWLGYCNSLLNPIIYTIFSPEFRNAFNKILFG 1877
            + +++Q LE KRERKAA+TLAIITG F++CWLPFF+ AL +  C ++C  +   +S FLWLGY NS LNP+IYTIF+PEFR AF +ILFG
Sbjct:  462 LAKRRQLLEAKRERKAAQTLAIITGAFVICWLPFFVMALTMSLC-KECEIHTAVASLFLWLGYFNSTLNPVIYTIFNPEFRRAFKRILFG 550          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Fly
Match: 5-HT1B (gene:FBgn0263116 transcript:FBtr0086599)

HSP 1 Score: 164.851 bits (416), Expect = 4.231e-43
Identity = 105/205 (51.22%), Postives = 142/205 (69.27%), Query Frame = 3
Query:  138 WIHVYL--TSAVLGSLILCTIIGNVFVVAAIILEKNLQSVSNYLILSLAVADXXXXXXXXXXXXXXEISKQWFLGIELCDFWVCFDVLCCSASILHLVAIAFDRYWAVTNIDYIRMRTAKRXXXXXXXXXXXXXXXXXPSRFYSSRTWENV-YKSVVIDGLCNINDEYFYTIFSTVGAFYMPMFLLIGIYLKIYQTARARIRKHG 743
            W+ V +   + VLG +IL TIIGNVFV+AAIILE+NLQ+V+NYL+ SLAVADL VA LVM +  + EIS  W LG ELCD W   DVLCC+ASILHLVAIA DRYW VTNIDY  +RT +R+ +MI  VWF ++I+S+  +F     W++  Y   + +  C ++ +  Y IF+T   FY+P+ +++ +Y KIY  AR RI++  
Sbjct:   85 WLLVKMIAMAVVLGLMILVTIIGNVFVIAAIILERNLQNVANYLVASLAVADLFVACLVMPLGAVYEISNGWILGPELCDIWTSCDVLCCTASILHLVAIAADRYWTVTNIDYNNLRTPRRVFLMIFCVWFAALIVSLAPQF----GWKDPDYMKRIEEQHCMVSQDVGYQIFATCCTFYVPLLVILFLYWKIYIIARKRIQRRA 285          

HSP 2 Score: 125.561 bits (314), Expect = 7.265e-30
Identity = 55/90 (61.11%), Postives = 71/90 (78.89%), Query Frame = 3
Query: 1608 IEQQKQKLEHKRERKAARTLAIITGCFILCWLPFFIQALYLPFCGRQCVPNDIFSSFFLWLGYCNSLLNPIIYTIFSPEFRNAFNKILFG 1877
            + +++Q LE KRERKAA+TLAIITG F++CWLPFF+ AL +  C ++C  +   +S FLWLGY NS LNP+IYTIF+PEFR AF +ILFG
Sbjct:  517 LAKRRQLLEAKRERKAAQTLAIITGAFVICWLPFFVMALTMSLC-KECEIHTAVASLFLWLGYFNSTLNPVIYTIFNPEFRRAFKRILFG 605          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Fly
Match: 5-HT1B (gene:FBgn0263116 transcript:FBtr0330056)

HSP 1 Score: 165.236 bits (417), Expect = 4.710e-43
Identity = 105/205 (51.22%), Postives = 142/205 (69.27%), Query Frame = 3
Query:  138 WIHVYL--TSAVLGSLILCTIIGNVFVVAAIILEKNLQSVSNYLILSLAVADXXXXXXXXXXXXXXEISKQWFLGIELCDFWVCFDVLCCSASILHLVAIAFDRYWAVTNIDYIRMRTAKRXXXXXXXXXXXXXXXXXPSRFYSSRTWENV-YKSVVIDGLCNINDEYFYTIFSTVGAFYMPMFLLIGIYLKIYQTARARIRKHG 743
            W+ V +   + VLG +IL TIIGNVFV+AAIILE+NLQ+V+NYL+ SLAVADL VA LVM +  + EIS  W LG ELCD W   DVLCC+ASILHLVAIA DRYW VTNIDY  +RT +R+ +MI  VWF ++I+S+  +F     W++  Y   + +  C ++ +  Y IF+T   FY+P+ +++ +Y KIY  AR RI++  
Sbjct:   85 WLLVKMIAMAVVLGLMILVTIIGNVFVIAAIILERNLQNVANYLVASLAVADLFVACLVMPLGAVYEISNGWILGPELCDIWTSCDVLCCTASILHLVAIAADRYWTVTNIDYNNLRTPRRVFLMIFCVWFAALIVSLAPQF----GWKDPDYMKRIEEQHCMVSQDVGYQIFATCCTFYVPLLVILFLYWKIYIIARKRIQRRA 285          

HSP 2 Score: 125.561 bits (314), Expect = 8.105e-30
Identity = 55/90 (61.11%), Postives = 71/90 (78.89%), Query Frame = 3
Query: 1608 IEQQKQKLEHKRERKAARTLAIITGCFILCWLPFFIQALYLPFCGRQCVPNDIFSSFFLWLGYCNSLLNPIIYTIFSPEFRNAFNKILFG 1877
            + +++Q LE KRERKAA+TLAIITG F++CWLPFF+ AL +  C ++C  +   +S FLWLGY NS LNP+IYTIF+PEFR AF +ILFG
Sbjct:  517 LAKRRQLLEAKRERKAAQTLAIITGAFVICWLPFFVMALTMSLC-KECEIHTAVASLFLWLGYFNSTLNPVIYTIFNPEFRRAFKRILFG 605          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Zebrafish
Match: htr1ab (5-hydroxytryptamine (serotonin) receptor 1A b [Source:ZFIN;Acc:ZDB-GENE-090409-2])

HSP 1 Score: 152.525 bits (384), Expect = 6.570e-40
Identity = 92/195 (47.18%), Postives = 136/195 (69.74%), Query Frame = 3
Query:  156 TSAVLGSLILCTIIGNVFVVAAIILEKNLQSVSNYLILSLAVADXXXXXXXXXXXXXXEISKQWFLGIELCDFWVCFDVLCCSASILHLVAIAFDRYWAVTN-IDYIRMRTAKRXXXXXXXXXXXXXXXXXPSRFYSSRTWENVYKSVVIDGLCNINDEYFYTIFSTVGAFYMPMFLLIGIYLKIYQTARARIRK 737
            TS ++G+LILC+I GN  VVAAI LE++LQ+V+NYLI SLAV DLMV+ LV+ ++ L ++  +W LG   CD ++  D+LCC++SILHL AIA DRYWA+T+ IDY++ RT KR  ++I + WF+   ISIP         ++  + +     C I+ + +YTI+ST  AFY+P+ L++ +Y +I++ AR RIRK
Sbjct:   38 TSLLIGALILCSIFGNACVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLDKWTLGQVTCDIFISLDILCCTSSILHLCAIALDRYWAITDPIDYMKKRTLKRAALLITVTWFVGFSISIPPMLIMKSQPKSRAEDMANPEACMISHDPWYTIYSTFCAFYIPLILMLVLYGRIFKAARFRIRK 232          

HSP 2 Score: 98.5969 bits (244), Expect = 1.310e-21
Identity = 69/186 (37.10%), Postives = 96/186 (51.61%), Query Frame = 3
Query: 1347 IKKTKRKLHPQN----SLSPNIHYKITGIL-------VPDRVNLHVNHNSINIKNHLNMQNFENSTISKSQLPTHGSRTDTYPKTFVTNSDFTSKKSFIEQQKQKLEHKRERKAARTLAIITGCFILCWLPFFIQALYLPFCGRQCVPNDIFSSFFLWLGYCNSLLNPIIYTIFSPEFRNAFNKIL 1871
            I+KT RK   +     ++SP +  +  G L       V  +    VN    + ++  +++  E  + SK+ LP         P T  +   F +K     + K+KL   RERK  +TL II G FILCWLPFFI+AL +PFC   CV          WLGY NSLLNPIIY  F+ +F++AF KI+
Sbjct:  230 IRKTVRKPEKKRVKCLTVSPALFKRANGELSKNWKSAVEPKPAACVNGAIKHAEDGESLEIIEVHSNSKNNLP--------LPNTPNSVPLFENKHEKNTEAKRKLALARERKTVKTLGIIMGTFILCWLPFFIKALVMPFCP-TCVMPLWLQDVINWLGYSNSLLNPIIYAYFNKDFQSAFKKII 406          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Zebrafish
Match: htr1aa (5-hydroxytryptamine (serotonin) receptor 1A a [Source:ZFIN;Acc:ZDB-GENE-071203-1])

HSP 1 Score: 149.443 bits (376), Expect = 4.755e-39
Identity = 93/196 (47.45%), Postives = 132/196 (67.35%), Query Frame = 3
Query:  153 LTSAVLGSLILCTIIGNVFVVAAIILEKNLQSVSNYLILSLAVADXXXXXXXXXXXXXXEISKQWFLGIELCDFWVCFDVLCCSASILHLVAIAFDRYWAVTN-IDYIRMRTAKRXXXXXXXXXXXXXXXXXPSRFYSSRTWENVYKSVVIDGLCNINDEYFYTIFSTVGAFYMPMFLLIGIYLKIYQTARARIRK 737
            + S  L +LIL  I+GN  V+AAI LE++LQ+V+NYLI SLAV DLMV+ LV+ ++ L ++  +W LG E+CD ++  DVLCC++SILHL AIA DRYWA+T+ IDY+  RT +R  I+I + W +   ISIP        W         D  C I+ ++ YTI+ST GAFY+P+ L++ +Y +I++ AR RIRK
Sbjct:   30 IGSLFLAALILFAILGNACVIAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQEMCDIFISLDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAILISLTWLIGFSISIPPML----GWRKPEDRADPDA-CTISQDHGYTIYSTFGAFYIPLILMLVLYGRIFRAARFRIRK 220          

HSP 2 Score: 98.9821 bits (245), Expect = 8.873e-22
Identity = 47/86 (54.65%), Postives = 58/86 (67.44%), Query Frame = 3
Query: 1614 QQKQKLEHKRERKAARTLAIITGCFILCWLPFFIQALYLPFCGRQCVPNDIFSSFFLWLGYCNSLLNPIIYTIFSPEFRNAFNKIL 1871
            + K+K+   RERK  +TL II G FI CWLPFFI AL LPFC + C   +   +   WLGY NSLLNP+IY  F+ +F+NAF KIL
Sbjct:  307 EAKRKVALARERKTVKTLGIIMGTFIFCWLPFFIVALVLPFC-QDCFMPEWLGAVINWLGYSNSLLNPVIYAYFNKDFQNAFKKIL 391          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Zebrafish
Match: htr1ab (5-hydroxytryptamine (serotonin) receptor 1A b [Source:ZFIN;Acc:ZDB-GENE-090409-2])

HSP 1 Score: 148.288 bits (373), Expect = 1.396e-38
Identity = 94/195 (48.21%), Postives = 135/195 (69.23%), Query Frame = 3
Query:  156 TSAVLGSLILCTIIGNVFVVAAIILEKNLQSVSNYLILSLAVADXXXXXXXXXXXXXXEISKQWFLGIELCDFWVCFDVLCCSASILHLVAIAFDRYWAVTN-IDYIRMRTAKRXXXXXXXXXXXXXXXXXPSRFYSSRTWENVYKSVVIDGLCNINDEYFYTIFSTVGAFYMPMFLLIGIYLKIYQTARARIRK 737
            TS ++G+LILC+I GN  VVAAI LE++LQ+V+NYLI SLAV DLMV+ LV+ ++ L ++  +W LG   CD ++  D+LCC++SILHL AIA DRYWA+T+ IDY++ RT KR  ++I + WF+   ISIP           + KS      C I+ + +YTI+ST  AFY+P+ L++ +Y +I++ AR RIRK
Sbjct:   38 TSLLIGALILCSIFGNACVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLDKWTLGQVTCDIFISLDILCCTSSILHLCAIALDRYWAITDPIDYMKKRTLKRAALLITVTWFVGFSISIPPML--------IMKSQ--PKTCMISHDPWYTIYSTFCAFYIPLILMLVLYGRIFKAARFRIRK 222          

HSP 2 Score: 98.5969 bits (244), Expect = 1.378e-21
Identity = 69/186 (37.10%), Postives = 96/186 (51.61%), Query Frame = 3
Query: 1347 IKKTKRKLHPQN----SLSPNIHYKITGIL-------VPDRVNLHVNHNSINIKNHLNMQNFENSTISKSQLPTHGSRTDTYPKTFVTNSDFTSKKSFIEQQKQKLEHKRERKAARTLAIITGCFILCWLPFFIQALYLPFCGRQCVPNDIFSSFFLWLGYCNSLLNPIIYTIFSPEFRNAFNKIL 1871
            I+KT RK   +     ++SP +  +  G L       V  +    VN    + ++  +++  E  + SK+ LP         P T  +   F +K     + K+KL   RERK  +TL II G FILCWLPFFI+AL +PFC   CV          WLGY NSLLNPIIY  F+ +F++AF KI+
Sbjct:  220 IRKTVRKPEKKRVKCLTVSPALFKRANGELSKNWKSAVEPKPAACVNGAIKHAEDGESLEIIEVHSNSKNNLP--------LPNTPNSVPLFENKHEKNTEAKRKLALARERKTVKTLGIIMGTFILCWLPFFIKALVMPFCP-TCVMPLWLQDVINWLGYSNSLLNPIIYAYFNKDFQSAFKKII 396          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Zebrafish
Match: htr1ab (5-hydroxytryptamine (serotonin) receptor 1A b [Source:ZFIN;Acc:ZDB-GENE-090409-2])

HSP 1 Score: 148.288 bits (373), Expect = 1.396e-38
Identity = 94/195 (48.21%), Postives = 135/195 (69.23%), Query Frame = 3
Query:  156 TSAVLGSLILCTIIGNVFVVAAIILEKNLQSVSNYLILSLAVADXXXXXXXXXXXXXXEISKQWFLGIELCDFWVCFDVLCCSASILHLVAIAFDRYWAVTN-IDYIRMRTAKRXXXXXXXXXXXXXXXXXPSRFYSSRTWENVYKSVVIDGLCNINDEYFYTIFSTVGAFYMPMFLLIGIYLKIYQTARARIRK 737
            TS ++G+LILC+I GN  VVAAI LE++LQ+V+NYLI SLAV DLMV+ LV+ ++ L ++  +W LG   CD ++  D+LCC++SILHL AIA DRYWA+T+ IDY++ RT KR  ++I + WF+   ISIP           + KS      C I+ + +YTI+ST  AFY+P+ L++ +Y +I++ AR RIRK
Sbjct:   38 TSLLIGALILCSIFGNACVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLDKWTLGQVTCDIFISLDILCCTSSILHLCAIALDRYWAITDPIDYMKKRTLKRAALLITVTWFVGFSISIPPML--------IMKSQ--PKTCMISHDPWYTIYSTFCAFYIPLILMLVLYGRIFKAARFRIRK 222          

HSP 2 Score: 98.5969 bits (244), Expect = 1.378e-21
Identity = 69/186 (37.10%), Postives = 96/186 (51.61%), Query Frame = 3
Query: 1347 IKKTKRKLHPQN----SLSPNIHYKITGIL-------VPDRVNLHVNHNSINIKNHLNMQNFENSTISKSQLPTHGSRTDTYPKTFVTNSDFTSKKSFIEQQKQKLEHKRERKAARTLAIITGCFILCWLPFFIQALYLPFCGRQCVPNDIFSSFFLWLGYCNSLLNPIIYTIFSPEFRNAFNKIL 1871
            I+KT RK   +     ++SP +  +  G L       V  +    VN    + ++  +++  E  + SK+ LP         P T  +   F +K     + K+KL   RERK  +TL II G FILCWLPFFI+AL +PFC   CV          WLGY NSLLNPIIY  F+ +F++AF KI+
Sbjct:  220 IRKTVRKPEKKRVKCLTVSPALFKRANGELSKNWKSAVEPKPAACVNGAIKHAEDGESLEIIEVHSNSKNNLP--------LPNTPNSVPLFENKHEKNTEAKRKLALARERKTVKTLGIIMGTFILCWLPFFIKALVMPFCP-TCVMPLWLQDVINWLGYSNSLLNPIIYAYFNKDFQSAFKKII 396          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Zebrafish
Match: htr1b (5-hydroxytryptamine (serotonin) receptor 1B [Source:ZFIN;Acc:ZDB-GENE-081022-141])

HSP 1 Score: 142.124 bits (357), Expect = 1.565e-36
Identity = 95/227 (41.85%), Postives = 136/227 (59.91%), Query Frame = 3
Query:   72 FEILNITK--NQSLEVARFSPKHGWIHVYLTSAVLGSLILCTIIGNVFVVAAIILEKNLQSVSNYLILSLAVADXXXXXXXXXXXXXXEISKQWFLGIELCDFWVCFDVLCCSASILHLVAIAFDRYWAVTN-IDYIRMRTAKRXXXXXXXXXXXXXXXXXPSRFYSSRTWENVYKSVVIDGLCNIN-DEYFYTIFSTVGAFYMPMFLLIGIYLKIYQTARARIRKH 740
            FE+LN +   N +L       +  +      S+VLG + L TI+ N FV+A I   + LQ+ +N+LI SLAV DL+V+ LVM + +L  ++++W LG  +CD W+  D+ CC+ASILHL  IA DRYWA+T+ ++Y + RT  R   M+   W ++I IS+P  F     W  V    +    C++N D  FYTI+ST GAFY+P  LLI +Y +IY  AR RI K 
Sbjct:   19 FEVLNSSTGTNVTLTPKTDEKQESFAFQVTLSSVLGLITLATILSNAFVIATISQSRKLQTPANFLIASLAVTDLLVSVLVMPICVLYTVTREWTLGQVICDIWLSSDITCCTASILHLCVIALDRYWAITDAVEYAKKRTQARAAGMVATAWIIAISISLPPFF-----WRQVKAGELTT--CSVNTDHIFYTIYSTFGAFYIPTLLLIALYGRIYVEARKRILKQ 238          

HSP 2 Score: 99.7525 bits (247), Expect = 4.770e-22
Identity = 53/121 (43.80%), Postives = 72/121 (59.50%), Query Frame = 3
Query: 1521 SQLPTHGSRTDTYPKTFVTNSD----FTSKKSFIEQQKQKLEHKRERKAARTLAIITGCFILCWLPFFIQALYLPFCGRQCVPNDIFSSFFLWLGYCNSLLNPIIYTIFSPEFRNAFNKIL 1871
            S  P H  R D    +    SD     T   S +E  K+++   RERKA +TL II G +I+CWLPFFI  L +P C   C   ++F  FF WLGY NSL+NPIIYT+ + +F+ AF+K++
Sbjct:  262 STSPLHCGRQDLCSDSGSLGSDNQIRVTVSDSLLE--KKRISAARERKATKTLGIILGAYIVCWLPFFIYTLLIPLCS-SCFSPELF-DFFTWLGYVNSLINPIIYTMSNDDFKKAFHKVI 378          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Xenopus
Match: ENSXETT00000046867.1 (5-hydroxytryptamine (serotonin) receptor 1A, G protein-coupled [Source:NCBI gene;Acc:100488829])

HSP 1 Score: 150.599 bits (379), Expect = 3.766e-39
Identity = 95/195 (48.72%), Postives = 132/195 (67.69%), Query Frame = 3
Query:  153 LTSAVLGSLILCTIIGNVFVVAAIILEKNLQSVSNYLILSLAVADXXXXXXXXXXXXXXEISKQWFLGIELCDFWVCFDVLCCSASILHLVAIAFDRYWAVTN-IDYIRMRTAKRXXXXXXXXXXXXXXXXXPSRFYSSRTWENVYKSVVIDGLCNINDEYFYTIFSTVGAFYMPMFLLIGIYLKIYQTARARIR 734
            +TS  LG+LILC I GN  V+AAI LE+ LQ+V+NYLI SLAV DLMV+ LV+ ++  +++  +W LG   CD ++  DVLCC++SILHL AIA DRYWA+T+ IDY+  RT +R  ++I I W +   ISIP      RT E+          C I+++  YTI+ST GAFY+P+ L++ +Y KI++ AR RIR
Sbjct:   31 VTSLFLGTLILCAIFGNACVIAAIALERCLQTVANYLIGSLAVTDLMVSVLVLPMAAHNQVLNKWTLGQVTCDIFISLDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAVLISITWIVGFSISIPPML-GWRTPEDRSDP----NACKISEDPGYTIYSTFGAFYIPLILMLVLYGKIFKAARFRIR 220          

HSP 2 Score: 97.8265 bits (242), Expect = 3.282e-21
Identity = 58/139 (41.73%), Postives = 74/139 (53.24%), Query Frame = 3
Query: 1455 HNSINIKNHLNMQNFENSTISKSQLPTHGSRTDTYPKTFVTNSDFTSKKSFIEQQKQKLEHKRERKAARTLAIITGCFILCWLPFFIQALYLPFCGRQCVPNDIFSSFFLWLGYCNSLLNPIIYTIFSPEFRNAFNKIL 1871
            H+ +N K+HL+             LP H       P +   N   T         K+K+   RERK  +TL II G FI CWLPFFI AL LPFC    +P+ +F     WLGY NSLLNPIIY  F+ +F++AF KI+
Sbjct:  286 HHYVNSKSHLD-------------LPNHAHDMAVAPCSEKRNDRAT-------DAKRKVALARERKTVKTLGIIMGTFIFCWLPFFIVALVLPFCETCHMPHLLF-DVINWLGYSNSLLNPIIYAYFNKDFQSAFKKII 403          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Xenopus
Match: HTR1D (5-hydroxytryptamine receptor 1D [Source:HGNC Symbol;Acc:HGNC:5289])

HSP 1 Score: 127.872 bits (320), Expect = 1.473e-31
Identity = 101/233 (43.35%), Postives = 145/233 (62.23%), Query Frame = 3
Query:   54 KMNV-SLFEILNITKNQSLEVARFSPKHGWIHVYLTSAVLGSLI-LCTIIGNVFVVAAIILEKNLQSVSNYLILSLAVADXXXXXXXXXXXXXXEISKQWFLGIELCDFWVCFDVLCCSASILHLVAIAFDRYWAVTN-IDYIRMRTAKRXXXXXXXXXXXXXXXXXPSRFY-SSRTWENVYKSVVIDGLCNIN-DEYFYTIFSTVGAFYMPMFLLIGIYLKIYQTARARIRK 737
            KM V S  E   +   Q L   R   +   + + +T AVL S+I L T++ NVFV+  I++ + L + +NYLI SLA  DL+V+ LVM +S+   ++  W  G  +CD W+  D+ CC+ASILHL  IA DRYWA+T+ ++Y + RTA+R  +MI++VW +SI ISIP  F+  ++  E +        +C IN D+  YTI+ST GAFY+P  LLI +Y KIY  AR+RI K
Sbjct:    1 KMLVNSTIEEFRMASFQRLLHGRGQEESTLLGLKITLAVLLSIITLATLLSNVFVIITIVMTRKLHTPANYLIGSLAFTDLLVSILVMPISIAYTVTHTWTFGQIVCDIWLLSDITCCTASILHLCVIALDRYWAITDALEYTKHRTARRAAVMILVVWIISICISIPPLFWRQAKAHEEL-------TVCTINTDQISYTIYSTCGAFYIPTVLLILLYGKIYIAARSRILK 226          

HSP 2 Score: 103.219 bits (256), Expect = 4.405e-23
Identity = 42/85 (49.41%), Postives = 61/85 (71.76%), Query Frame = 3
Query: 1617 QKQKLEHKRERKAARTLAIITGCFILCWLPFFIQALYLPFCGRQCVPNDIFSSFFLWLGYCNSLLNPIIYTIFSPEFRNAFNKIL 1871
            ++++L   RE+KA +TL II G FI+CWLPFF+ +L LP C   C  + +   FF WLGY NSL+NP+IYT+F+ +F+ AF K++
Sbjct:  283 ERKRLSAAREKKATKTLGIILGAFIVCWLPFFVVSLVLPICRDACWFDPLLFDFFTWLGYLNSLINPVIYTVFNEDFKKAFQKLI 367          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Xenopus
Match: HTR1B (5-hydroxytryptamine receptor 1B [Source:HGNC Symbol;Acc:HGNC:5287])

HSP 1 Score: 127.102 bits (318), Expect = 2.383e-31
Identity = 79/184 (42.93%), Postives = 117/184 (63.59%), Query Frame = 3
Query:  198 GNVFVVAAIILEKNLQSVSNYLILSLAVADXXXXXXXXXXXXXXEISKQWFLGIELCDFWVCFDVLCCSASILHLVAIAFDRYWAVTN-IDYIRMRTAKRXXXXXXXXXXXXXXXXXPSRFYSSRTWENVYKSVVIDGLCNIN-DEYFYTIFSTVGAFYMPMFLLIGIYLKIYQTARARIRKHG 743
             N FV+  +   + L + +NYLI SLA  DL+V+ LV+ ++++  ++ +W LG  +CD W+  D+ CC+ASILHL  IA DRYWA+T+ ++Y + RT KR ++MI +VW  SI IS+P  F+     E +        +C +N D   YT++STVGAFY+P  LLI +Y +IY  AR+RI K  
Sbjct:   35 SNAFVITTVYQTRKLHTPANYLIASLAFTDLLVSILVLPIAIVYTVTGKWTLGQIICDMWLSSDITCCTASILHLCVIALDRYWAITDAVEYTKKRTPKRAVVMIALVWVFSISISMPPLFWRQSKAEEI-------AVCAVNTDHILYTVYSTVGAFYIPTLLLIALYGRIYVEARSRILKQS 211          

HSP 2 Score: 96.6709 bits (239), Expect = 4.923e-21
Identity = 42/85 (49.41%), Postives = 60/85 (70.59%), Query Frame = 3
Query: 1617 QKQKLEHKRERKAARTLAIITGCFILCWLPFFIQALYLPFCGRQCVPNDIFSSFFLWLGYCNSLLNPIIYTIFSPEFRNAFNKIL 1871
            +K+K+   RERKA +TL +I G +I+CWLPFFI +L +P C   C  +     FF WLGY NSL+NPIIYT+ + +F+ AF+K++
Sbjct:  267 EKKKIMAARERKATKTLGVILGAYIVCWLPFFIISLVMPICKDACWFHPAIFDFFNWLGYLNSLINPIIYTMSNEDFKQAFHKLI 351          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Xenopus
Match: adra2c (adrenoceptor alpha 2C [Source:NCBI gene;Acc:100145449])

HSP 1 Score: 122.094 bits (305), Expect = 4.109e-29
Identity = 81/198 (40.91%), Postives = 129/198 (65.15%), Query Frame = 3
Query:  147 VYLTSAVLGSLILCTIIGNVFVVAAIILEKNLQSVSNYLILSLAVADXXXXXXXXXXXXXXEISKQWFLGIELCDFWVCFDVLCCSASILHLVAIAFDRYWAVTN-IDYIRMRTAKRXXXXXXXXXXXXXXXXXPSRFYSSR-TWENVYKSVVIDGLCNINDEYFYTIFSTVGAFYMPMFLLIGIYLKIYQTARARIR 734
            V+  +A++G LI+ TI+GNVFVV A++  + L++  N  ++SLA AD++VA+LVM  SL +E+   W+ G   CD ++  DVL C++SI+HL AI+ DRYW+VT  ++Y   RT +RI  +I+ VW +S +IS P      R T ++VY        C +ND+ +Y + S +G+F+ P  ++I +Y++IYQ A+ R R
Sbjct:   31 VWCLAAIVGFLIIFTIVGNVFVVIAVLTSRALKAPQNLFLVSLASADILVAALVMPFSLANELMGYWYFGNVWCDIYLALDVLFCTSSIVHLCAISLDRYWSVTQAVEYNLKRTPRRIKGIIVTVWLISAVISFPPLISMDRDTEDDVYPQ------CKLNDDTWYILSSCIGSFFAPCIIMILVYIRIYQVAKLRTR 222          

HSP 2 Score: 85.1149 bits (209), Expect = 6.581e-17
Identity = 40/89 (44.94%), Postives = 54/89 (60.67%), Query Frame = 3
Query: 1629 LEHKRERKAARTLAIITGCFILCWLPFFIQALYLPFCGRQC-VPNDIFSSFFLWLGYCNSLLNPIIYTIFSPEFRNAFNKILFGRYQKT 1892
            L   RE++    LA++ G F++CW PFF        C   C VP  +F  FF W+GYCNS LNP+IYTIF+ +FR +F KI+    +KT
Sbjct:  343 LSQAREKRFTFVLAVVMGVFVVCWFPFFFSYSLYGICREACEVPETLFK-FFFWIGYCNSSLNPVIYTIFNQDFRRSFKKIICIGRRKT 430          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Xenopus
Match: HTR1E (5-hydroxytryptamine (serotonin) receptor 1E, G protein-coupled [Source:NCBI gene;Acc:100380026])

HSP 1 Score: 118.627 bits (296), Expect = 1.897e-28
Identity = 87/199 (43.72%), Postives = 120/199 (60.30%), Query Frame = 3
Query:  153 LTSAVLGSLILCTIIGNVFVVAAIILEKNLQSVSNYLILSLAVADXXXXXXXXXXXXXXEISKQWFLGIELCDFWVCFDVLCCSASILHLVAIAFDRYWAVTN-IDYIRMRTAKRXXXXXXXXXXXXXXXXXPSRFYSSRTWENVYKSVVIDGLCNI-NDEYFYTIFSTVGAFYMPMFLLIGIYLKIYQTARARIRKHG 743
            L S  L  + + T + N  V+ AI   K L   +NYLI SLAV D +VA LVM +S+   +   W LG  +C+ W+  D+ CC+ SILHL  IA DRYWA+T+ I+Y R RT KR  IMI+ VW +S+ ISIP  F     W N + ++ I   C I +D   YTI+ST GAFY+P+ L++ +Y +IY  A+   +K G
Sbjct:   18 LISLTLAIITILTTVLNSAVILAICTTKKLHQPANYLICSLAVTDFLVAILVMPLSITYIVMDTWTLGYVICEIWLSVDMTCCTCSILHLCVIALDRYWAITDAIEYARKRTVKRAGIMILTVWTISVFISIPPLF-----WRN-HHNINIPSKCIIQHDHLIYTIYSTCGAFYIPLTLILILYYRIYHAAKNLYQKRG 210          

HSP 2 Score: 83.9593 bits (206), Expect = 8.117e-17
Identity = 39/86 (45.35%), Postives = 57/86 (66.28%), Query Frame = 3
Query: 1614 QQKQKLEHKRERKAARTLAIITGCFILCWLPFFIQALYLPFCGRQCVPNDIFSSFFLWLGYCNSLLNPIIYTIFSPEFRNAFNKIL 1871
             ++Q++   RERKAAR L +I G FIL WLPFFI+ L +    + C  +   + F  WLGY NSL+NP++YT F+ +F+ AF K++
Sbjct:  270 DRQQQISSSRERKAARILGLILGAFILSWLPFFIKELVVGI--QLCTVSPEVADFLTWLGYVNSLVNPLLYTSFNDDFKLAFKKLI 353          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Mouse
Match: Htr1a (5-hydroxytryptamine (serotonin) receptor 1A [Source:MGI Symbol;Acc:MGI:96273])

HSP 1 Score: 154.066 bits (388), Expect = 2.117e-40
Identity = 94/196 (47.96%), Postives = 135/196 (68.88%), Query Frame = 3
Query:  153 LTSAVLGSLILCTIIGNVFVVAAIILEKNLQSVSNYLILSLAVADXXXXXXXXXXXXXXEISKQWFLGIELCDFWVCFDVLCCSASILHLVAIAFDRYWAVTN-IDYIRMRTAKRXXXXXXXXXXXXXXXXXPSRFYSSRTWENVYKSVVIDGLCNINDEYFYTIFSTVGAFYMPMFLLIGIYLKIYQTARARIRK 737
            +TS +LG+LI C ++GN  VVAAI LE++LQ+V+NYLI SLAV DLMV+ LV+ ++ L ++  +W LG   CD ++  DVLCC++SILHL AIA DRYWA+T+ IDY+  RT +R   +I + W +  +ISIP      RT E+          C I+ ++ YTI+ST GAFY+P+ L++ +Y +I++ AR RIRK
Sbjct:   38 ITSLLLGTLIFCAVLGNACVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPP-MLGWRTPEDRSNP----NECTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRK 228          

HSP 2 Score: 106.301 bits (264), Expect = 4.495e-24
Identity = 52/115 (45.22%), Postives = 68/115 (59.13%), Query Frame = 3
Query: 1527 LPTHGSRTDTYPKTFVTNSDFTSKKSFIEQQKQKLEHKRERKAARTLAIITGCFILCWLPFFIQALYLPFCGRQCVPNDIFSSFFLWLGYCNSLLNPIIYTIFSPEFRNAFNKIL 1871
            LP+    T   P      ++ T+      + K+K+   RERK  +TL II G FILCWLPFFI AL LPFC   C   ++  +   WLGY NSLLNP+IY  F+ +F+NAF KI+
Sbjct:  307 LPSESGATSYVPACLERKNERTA------EAKRKMALARERKTVKTLGIIMGTFILCWLPFFIVALVLPFCESSCHMPELLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKII 415          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Mouse
Match: Htr1b (5-hydroxytryptamine (serotonin) receptor 1B [Source:MGI Symbol;Acc:MGI:96274])

HSP 1 Score: 127.487 bits (319), Expect = 1.832e-31
Identity = 84/181 (46.41%), Postives = 117/181 (64.64%), Query Frame = 3
Query:  201 NVFVVAAIILEKNLQSVSNYLILSLAVADXXXXXXXXXXXXXXEISKQWFLGIELCDFWVCFDVLCCSASILHLVAIAFDRYWAVTN-IDYIRMRTAKRXXXXXXXXXXXXXXXXXPSRFYSSRTWENVYKSVVIDGLCNINDEYFYTIFSTVGAFYMPMFLLIGIYLKIYQTARARIRKH 740
            N FV+A +   + L + +NYLI SLAV DL+V+ LVM +S +  ++ +W LG  +CDFW+  D+ CC+ASI+HL  IA DRYWA+T+ ++Y   RT KR  IMI++VW  SI IS+P  F+     E      ++D   N  D   YT++STVGAFY+P  LLI +Y +IY  AR+RI K 
Sbjct:   63 NAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQVVCDFWLSSDITCCTASIMHLCVIALDRYWAITDAVEYSAKRTPKRAAIMIVLVWVFSISISLPPFFWRQAKAEE----EMLDCFVN-TDHVLYTVYSTVGAFYLPTLLLIALYGRIYVEARSRILKQ 238          

HSP 2 Score: 98.5969 bits (244), Expect = 1.310e-21
Identity = 45/85 (52.94%), Postives = 60/85 (70.59%), Query Frame = 3
Query: 1617 QKQKLEHKRERKAARTLAIITGCFILCWLPFFIQALYLPFCGRQCVPNDIFSSFFLWLGYCNSLLNPIIYTIFSPEFRNAFNKIL 1871
            +K+KL   RERKA +TL II G FI+CWLPFFI +L +P C   C  +     FF WLGY NSL+NPIIYT+ + +F+ AF+K++
Sbjct:  296 EKKKLMAARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHMAIFDFFNWLGYLNSLINPIIYTMSNEDFKQAFHKLI 380          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Mouse
Match: Htr1b (5-hydroxytryptamine (serotonin) receptor 1B [Source:MGI Symbol;Acc:MGI:96274])

HSP 1 Score: 127.487 bits (319), Expect = 1.832e-31
Identity = 84/181 (46.41%), Postives = 117/181 (64.64%), Query Frame = 3
Query:  201 NVFVVAAIILEKNLQSVSNYLILSLAVADXXXXXXXXXXXXXXEISKQWFLGIELCDFWVCFDVLCCSASILHLVAIAFDRYWAVTN-IDYIRMRTAKRXXXXXXXXXXXXXXXXXPSRFYSSRTWENVYKSVVIDGLCNINDEYFYTIFSTVGAFYMPMFLLIGIYLKIYQTARARIRKH 740
            N FV+A +   + L + +NYLI SLAV DL+V+ LVM +S +  ++ +W LG  +CDFW+  D+ CC+ASI+HL  IA DRYWA+T+ ++Y   RT KR  IMI++VW  SI IS+P  F+     E      ++D   N  D   YT++STVGAFY+P  LLI +Y +IY  AR+RI K 
Sbjct:   63 NAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQVVCDFWLSSDITCCTASIMHLCVIALDRYWAITDAVEYSAKRTPKRAAIMIVLVWVFSISISLPPFFWRQAKAEE----EMLDCFVN-TDHVLYTVYSTVGAFYLPTLLLIALYGRIYVEARSRILKQ 238          

HSP 2 Score: 98.5969 bits (244), Expect = 1.310e-21
Identity = 45/85 (52.94%), Postives = 60/85 (70.59%), Query Frame = 3
Query: 1617 QKQKLEHKRERKAARTLAIITGCFILCWLPFFIQALYLPFCGRQCVPNDIFSSFFLWLGYCNSLLNPIIYTIFSPEFRNAFNKIL 1871
            +K+KL   RERKA +TL II G FI+CWLPFFI +L +P C   C  +     FF WLGY NSL+NPIIYT+ + +F+ AF+K++
Sbjct:  296 EKKKLMAARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHMAIFDFFNWLGYLNSLINPIIYTMSNEDFKQAFHKLI 380          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Mouse
Match: Htr1f (5-hydroxytryptamine (serotonin) receptor 1F [Source:MGI Symbol;Acc:MGI:99842])

HSP 1 Score: 117.087 bits (292), Expect = 5.858e-28
Identity = 87/195 (44.62%), Postives = 119/195 (61.03%), Query Frame = 3
Query:  153 LTSAVLGSLILCTIIGNVFVVAAIILEKNLQSVSNYLILSLAVADXXXXXXXXXXXXXXEISKQWFLGIELCDFWVCFDVLCCSASILHLVAIAFDRYWAVTN-IDYIRMRTAKRXXXXXXXXXXXXXXXXXPSRFY----SSRTWENVYKSVVIDGLCNINDEYFYTIFSTVGAFYMPMFLLIGIYLKIYQTAR 722
            L S  L  L L T   N  V+AAII+ + L   +NYLI SLAV D +VA LVM  S++  + + W +G  LCD W+  D++CC+ SILHL AIA DRY A+T+ ++Y R RT +   IMI IVW +S+ IS+P  F+    +SR  E V K          +D    TI+ST GAFY+P+ L++ +Y KIY+ AR
Sbjct:   25 LVSLTLSGLALMTTTINSLVIAAIIVTRKLHHPANYLICSLAVTDFLVAVLVMPFSIVYIVRESWIMGQVLCDIWLSVDIICCTCSILHLSAIALDRYRAITDAVEYARKRTPRHAGIMITIVWVISVFISMPPLFWRHQGTSRDDECVIK----------HDHIVSTIYSTFGAFYIPLVLILILYYKIYRAAR 209          

HSP 2 Score: 102.834 bits (255), Expect = 3.718e-23
Identity = 61/159 (38.36%), Postives = 87/159 (54.72%), Query Frame = 3
Query: 1434 RVNLHVNHNSINIKNHLNMQNFENSTISKSQLPT-----HGSRTDTYPKTFVTNSDFTSKKSFIEQQK----QKLEHKRERKAARTLAIITGCFILCWLPFFIQALYLPFCGRQCVPNDIFSSFFLWLGYCNSLLNPIIYTIFSPEFRNAFNKILFGRY 1883
            R   H    S  IK  LN Q F  S     +L +       S +D        +S   S +S ++ +K    QK+   RERKAA TL +I G F++CWLPFF++ L +  C  +C  ++  S+F  WLGY NSL+NP+IYTIF+ +F+ AF K++  RY
Sbjct:  209 RTLYHKRQASRMIKEELNGQVFLESGEKSIKLVSTSYMLEKSLSDPSTDFDRIHSTVKSPRSELKHEKSWRRQKISGTRERKAATTLGLILGAFVICWLPFFVKELVVNVC-EKCKISEEMSNFLAWLGYLNSLINPLIYTIFNEDFKKAFQKLVRCRY 366          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Mouse
Match: Htr1d (5-hydroxytryptamine (serotonin) receptor 1D [Source:MGI Symbol;Acc:MGI:96276])

HSP 1 Score: 116.316 bits (290), Expect = 1.255e-27
Identity = 85/190 (44.74%), Postives = 116/190 (61.05%), Query Frame = 3
Query:  165 VLGSLILCTIIGNVFVVAAIILEKNLQSVSNYLILSLAVADXXXXXXXXXXXXXXEISKQWFLGIELCDFWVCFDVLCCSASILHLVAIAFDRYWAVTN-IDYIRMRTAKRXXXXXXXXXXXXXXXXXPSRFYSSRTWENVYKSVVIDGLCNINDEYFYTIFSTVGAFYMPMFLLIGIYLKIYQTARARI 731
            VL  + L T++ N FV+  I+L K L + +NYLI SLA  DL+V+ LVM +S+    ++ W  G  LCD WV  D+ CC+ASILHL  IA DRYWA+T+ ++Y + RTA     MI  VW +SI ISIP  F+   T        +++       +  YTI+ST GAFY+P  LLI +Y +IY  AR+RI
Sbjct:   41 VLSVITLATVLSNAFVLTTILLTKKLHTPANYLIGSLATTDLLVSILVMPISIAYTTTRTWNFGQILCDIWVSSDITCCTASILHLCVIALDRYWAITDALEYSKRRTAGHAAAMIAAVWIISICISIPPLFWRQATAHEEMSDCLVN-----TSQISYTIYSTCGAFYIPSILLIILYGRIYVAARSRI 225          

HSP 2 Score: 104.76 bits (260), Expect = 9.916e-24
Identity = 44/88 (50.00%), Postives = 61/88 (69.32%), Query Frame = 3
Query: 1617 QKQKLEHKRERKAARTLAIITGCFILCWLPFFIQALYLPFCGRQCVPNDIFSSFFLWLGYCNSLLNPIIYTIFSPEFRNAFNKILFGR 1880
            +++++   RERKA +TL II G FI+CWLPFF+ +L LP C   C  +     FF WLGY NSL+NP+IYT+F+ +FR AF K++  R
Sbjct:  284 ERKRISAARERKATKTLGIILGAFIICWLPFFVVSLVLPICRDSCWIHPALFDFFTWLGYLNSLINPVIYTVFNEDFRQAFQKVVHFR 371          
BLAST of 5-hydroxytryptamine receptor vs. UniProt/SwissProt
Match: sp|Q25414|5HTR_LYMST (5-hydroxytryptamine receptor OS=Lymnaea stagnalis OX=6523 PE=2 SV=1)

HSP 1 Score: 199.134 bits (505), Expect = 5.620e-55
Identity = 118/202 (58.42%), Postives = 155/202 (76.73%), Query Frame = 3
Query:  144 HVYLTSAVLGSLILCTIIGNVFVVAAIILEKNLQSVSNYLILSLAVADXXXXXXXXXXXXXXEISKQWFLGIELCDFWVCFDVLCCSASILHLVAIAFDRYWAVTNIDYIRMRTAKRXXXXXXXXXXXXXXXXXPSRFYSSRTWENVYKSVVIDGLCNINDEYFYTIFSTVGAFYMPMFLLIGIYLKIYQTARARIRKHGFH 749
            H+ LTS +LG  +LC IIGN FV+AA++LE++L +V+NYLILSLAVADLMVA LVM +S++SEISK WFL  E+CD W+  DVLCC+ASILHLVAIA DRYWAVT+IDYIR R+A+RI++MI++VW +++ ISIP  F     W +        G C I+ +  YTIFSTVGAFY+PM +++ IY++I+  AR+RIRK  F 
Sbjct:   94 HLVLTSVILGLFVLCCIIGNCFVIAAVMLERSLHNVANYLILSLAVADLMVAVLVMPLSVVSEISKVWFLHSEVCDMWISVDVLCCTASILHLVAIAMDRYWAVTSIDYIRRRSARRILLMIMVVWIVALFISIPPLF----GWRDPNNDPDKTGTCIISQDKGYTIFSTVGAFYLPMLVMMIIYIRIWLVARSRIRKDKFQ 291          

HSP 2 Score: 134.42 bits (337), Expect = 3.472e-32
Identity = 64/95 (67.37%), Postives = 75/95 (78.95%), Query Frame = 3
Query: 1614 QQKQKLEHKRERKAARTLAIITGCFILCWLPFFIQALYLPFCGRQCVPNDIFSSFFLWLGYCNSLLNPIIYTIFSPEFRNAFNKILFGRYQKTKR 1898
            + ++KLE KRERKAARTLAIITG F++CWLPFFI AL  PF   + +P     SF LWLGY NSLLNPIIYTIFSPEFR+AF KILFG+Y++  R
Sbjct:  416 RTREKLELKRERKAARTLAIITGAFLICWLPFFIIALIGPFVDPEGIP-PFARSFVLWLGYFNSLLNPIIYTIFSPEFRSAFQKILFGKYRRGHR 509          
BLAST of 5-hydroxytryptamine receptor vs. UniProt/SwissProt
Match: sp|P28285|5HT2A_DROME (5-hydroxytryptamine receptor 2A OS=Drosophila melanogaster OX=7227 GN=5-HT1A PE=2 SV=2)

HSP 1 Score: 172.555 bits (436), Expect = 5.679e-44
Identity = 103/194 (53.09%), Postives = 139/194 (71.65%), Query Frame = 3
Query:  141 IHVYLTSAVLGSLILCTIIGNVFVVAAIILEKNLQSVSNYLILSLAVADXXXXXXXXXXXXXXEISKQWFLGIELCDFWVCFDVLCCSASILHLVAIAFDRYWAVTNIDYIRMRTAKRXXXXXXXXXXXXXXXXXPSRFYSSRTWENV-YKSVVIDGLCNINDEYFYTIFSTVGAFYMPMFLLIGIYLKIYQTA 719
            + + +TS +LG +IL TIIGNVFV+AAIILE+NLQ+V+NYL+ SLAVADL VA LVM +  + EIS+ W LG ELCD W   DVLCC+ASILHLVAIA DRYWAVTNIDYI  RT+ R+ +MI  VW  ++I+S+  +F     W++  Y   +    C ++ +  Y +F+T   FY+P+ +++ +Y KIYQTA
Sbjct:  224 LRMAVTSVLLGLMILVTIIGNVFVIAAIILERNLQNVANYLVASLAVADLFVACLVMPLGAVYEISQGWILGPELCDIWTSCDVLCCTASILHLVAIAVDRYWAVTNIDYIHSRTSNRVFMMIFCVWTAAVIVSLAPQF----GWKDPDYLQRIEQQKCMVSQDVSYQVFATCCTFYVPLLVILALYWKIYQTA 413          

HSP 2 Score: 134.42 bits (337), Expect = 1.996e-31
Identity = 58/93 (62.37%), Postives = 73/93 (78.49%), Query Frame = 3
Query: 1608 IEQQKQKLEHKRERKAARTLAIITGCFILCWLPFFIQALYLPFCGRQCVPNDIFSSFFLWLGYCNSLLNPIIYTIFSPEFRNAFNKILFGRYQ 1886
            + ++K+ LE KRERKAA+TLAIITG F++CWLPFF+ AL +P C   C  +D  +S FLWLGY NS LNP+IYTIFSPEFR AF +ILFG ++
Sbjct:  734 VNKRKETLEAKRERKAAKTLAIITGAFVVCWLPFFVMALTMPLCA-ACQISDSVASLFLWLGYFNSTLNPVIYTIFSPEFRQAFKRILFGGHR 825          
BLAST of 5-hydroxytryptamine receptor vs. UniProt/SwissProt
Match: sp|P28286|5HT2B_DROME (5-hydroxytryptamine receptor 2B OS=Drosophila melanogaster OX=7227 GN=5-HT1B PE=2 SV=3)

HSP 1 Score: 164.851 bits (416), Expect = 4.241e-42
Identity = 105/205 (51.22%), Postives = 142/205 (69.27%), Query Frame = 3
Query:  138 WIHVYL--TSAVLGSLILCTIIGNVFVVAAIILEKNLQSVSNYLILSLAVADXXXXXXXXXXXXXXEISKQWFLGIELCDFWVCFDVLCCSASILHLVAIAFDRYWAVTNIDYIRMRTAKRXXXXXXXXXXXXXXXXXPSRFYSSRTWENV-YKSVVIDGLCNINDEYFYTIFSTVGAFYMPMFLLIGIYLKIYQTARARIRKHG 743
            W+ V +   + VLG +IL TIIGNVFV+AAIILE+NLQ+V+NYL+ SLAVADL VA LVM +  + EIS  W LG ELCD W   DVLCC+ASILHLVAIA DRYW VTNIDY  +RT +R+ +MI  VWF ++I+S+  +F     W++  Y   + +  C ++ +  Y IF+T   FY+P+ +++ +Y KIY  AR RI++  
Sbjct:   85 WLLVKMIAMAVVLGLMILVTIIGNVFVIAAIILERNLQNVANYLVASLAVADLFVACLVMPLGAVYEISNGWILGPELCDIWTSCDVLCCTASILHLVAIAADRYWTVTNIDYNNLRTPRRVFLMIFCVWFAALIVSLAPQF----GWKDPDYMKRIEEQHCMVSQDVGYQIFATCCTFYVPLLVILFLYWKIYIIARKRIQRRA 285          

HSP 2 Score: 125.561 bits (314), Expect = 7.283e-29
Identity = 55/90 (61.11%), Postives = 71/90 (78.89%), Query Frame = 3
Query: 1608 IEQQKQKLEHKRERKAARTLAIITGCFILCWLPFFIQALYLPFCGRQCVPNDIFSSFFLWLGYCNSLLNPIIYTIFSPEFRNAFNKILFG 1877
            + +++Q LE KRERKAA+TLAIITG F++CWLPFF+ AL +  C ++C  +   +S FLWLGY NS LNP+IYTIF+PEFR AF +ILFG
Sbjct:  517 LAKRRQLLEAKRERKAAQTLAIITGAFVICWLPFFVMALTMSLC-KECEIHTAVASLFLWLGYFNSTLNPVIYTIFNPEFRRAFKRILFG 605          
BLAST of 5-hydroxytryptamine receptor vs. UniProt/SwissProt
Match: sp|Q25190|5HTR_HELVI (5-hydroxytryptamine receptor OS=Heliothis virescens OX=7102 PE=2 SV=1)

HSP 1 Score: 160.999 bits (406), Expect = 1.187e-41
Identity = 101/214 (47.20%), Postives = 146/214 (68.22%), Query Frame = 3
Query:   84 NITKNQSLEVARFSPKHGWIHVYLTSAVLGSLILCTIIGNVFVVAAIILEKNLQSVSNYLILSLAVADXXXXXXXXXXXXXXEISKQWFLGIELCDFWVCFDVLCCSASILHLVAIAFDRYWAVTNIDYIRMRTAKRXXXXXXXXXXXXXXXXXPSRFYSSRTWE--NVYKSVVIDGLCNINDEYFYTIFSTVGAFYMPMFLLIGIYLKIYQTA 719
            N+T N +   A  +    ++ + +TS VL  +IL TI+GNVFV+AAII+E+NLQ+V+NYL+ SLAVADLMVA LVM +  + E+S+ W LG ELCD W   DVLC SASILHLVAIA DRYWAVT++DYI +R  KRI  MI++VW  ++++S+  +      W+  +    +     C ++ +  Y IF+T+  FY+P+ +++ +Y KI+QTA
Sbjct:   41 NVTINGTSTNATSTDVTSFVLMAVTSVVLALIILATIVGNVFVIAAIIIERNLQNVANYLVASLAVADLMVACLVMPLGAVYEVSQGWILGPELCDMWTSSDVLCSSASILHLVAIATDRYWAVTDVDYIHIRNEKRIFTMIVLVWGAALVVSLAPQL----GWKDPDYLARITQQQKCLVSQDLAYQIFATMSTFYVPLAVILILYWKIFQTA 250          

HSP 2 Score: 137.117 bits (344), Expect = 2.587e-33
Identity = 60/95 (63.16%), Postives = 76/95 (80.00%), Query Frame = 3
Query: 1611 EQQKQKLEHKRERKAARTLAIITGCFILCWLPFFIQALYLPFCGRQCVPNDIFSSFFLWLGYCNSLLNPIIYTIFSPEFRNAFNKILFGRYQKTK 1895
             ++K+ LE KRERKAA+TLAIITG F+ CWLPFFI AL +P C + CV +D  +SFFLWLGY NS LNP+IYTIFSP+FR AF +ILFG +++ +
Sbjct:  369 REKKESLEAKRERKAAKTLAIITGAFVFCWLPFFIMALVMPIC-QTCVISDYLASFFLWLGYFNSTLNPVIYTIFSPDFRQAFARILFGTHRRRR 462          
BLAST of 5-hydroxytryptamine receptor vs. UniProt/SwissProt
Match: sp|O42385|5H1AA_TAKRU (5-hydroxytryptamine receptor 1A-alpha OS=Takifugu rubripes OX=31033 GN=htr1aa PE=3 SV=1)

HSP 1 Score: 156.377 bits (394), Expect = 2.404e-40
Identity = 95/196 (48.47%), Postives = 135/196 (68.88%), Query Frame = 3
Query:  153 LTSAVLGSLILCTIIGNVFVVAAIILEKNLQSVSNYLILSLAVADXXXXXXXXXXXXXXEISKQWFLGIELCDFWVCFDVLCCSASILHLVAIAFDRYWAVTN-IDYIRMRTAKRXXXXXXXXXXXXXXXXXPSRFYSSRTWENVYKSVVIDGLCNINDEYFYTIFSTVGAFYMPMFLLIGIYLKIYQTARARIRK 737
            +TS  LG+LILC+I GN  VVAAI LE++LQ+V+NYLI SLAV DLMV+ LV+ ++ L ++  +W LG ++CD ++  DVLCC++SILHL AIA DRYWA+T+ IDY+  RT +R  ++I + W +   ISIP        W +       D  C I+ +  YTI+ST GAFY+P+ L++ +Y +I++ AR RIRK
Sbjct:   47 ITSLFLGALILCSIFGNSCVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQDICDLFIALDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAVLISVTWLIGFSISIPPML----GWRSAEDRANPDA-CIISQDPGYTIYSTFGAFYIPLILMLVLYGRIFKAARFRIRK 237          

HSP 2 Score: 102.064 bits (253), Expect = 9.961e-22
Identity = 46/90 (51.11%), Postives = 59/90 (65.56%), Query Frame = 3
Query: 1620 KQKLEHKRERKAARTLAIITGCFILCWLPFFIQALYLPFCGRQCVPNDIFSSFFLWLGYCNSLLNPIIYTIFSPEFRNAFNKILFGRYQK 1889
            ++K+   RERK  +TL II G FI CWLPFFI AL LPFC   C   +   +   WLGY NSLLNPIIY  F+ +F++AF KIL  ++ +
Sbjct:  333 RRKIALARERKTVKTLGIIMGTFIFCWLPFFIVALVLPFCAENCYMPEWLGAVINWLGYSNSLLNPIIYAYFNKDFQSAFKKILRCKFHR 422          
BLAST of 5-hydroxytryptamine receptor vs. TrEMBL
Match: A0A193KUQ4 (GCR083 OS=Schmidtea mediterranea OX=79327 GN=gcr083 PE=2 SV=1)

HSP 1 Score: 1110.9 bits (2872), Expect = 0.000e+0
Identity = 615/616 (99.84%), Postives = 615/616 (99.84%), Query Frame = 3
Query:   57 MNVSLFEILNITKNQSLEVARFSPKHGWIHVYLTSAVLGSLILCTIIGNVFVVAAIILEKNLQSVSNYLILSLAVADXXXXXXXXXXXXXXEISKQWFLGIELCDFWVCFDVLCCSASILHLVAIAFDRYWAVTNIDYIRMRTAKRXXXXXXXXXXXXXXXXXPSRFYSSRTWENVYKSVVIDGLCNINDEYFYTIFSTVGAFYMPMFLLIGIYLKIYQTARARIRKHGFHXXXXXXXXXXXXXXXXXPFRWPKKVKFIPVKREMNSTHRYQCSSNFSQTNNYLQMKIDMQSYEISSYYGKNMSKNQVNSYDLDXXXXXXXXXXXXXXXXXXXXXXCEHINMNNQYPNVDSNMLSNSIFKQYQCKHEKDKLHFSILQSPVVLEAEFVTDPAQCLENYDEKIIWNWKETSSLNSSPRITCPNRPRHDCIEYIKKTKRKLHPQNSLSPNIHYKITGILVPDRVNLHVNHNSINIKNHLNMQNFENSTISKSQLPTHGSRTDTYPKTFVTNSDFTSKKSFIEQQKQKLEHKRERKAARTLAIITGCFILCWLPFFIQALYLPFCGRQCVPNDIFSSFFLWLGYCNSLLNPIIYTIFSPEFRNAFNKILFGRYQKTKRSY 1904
            MNVSLFEILNITKNQSLEVARFSPKHGWIHVYLTSAVLGSLILCTIIGNVFVVAAIILEKNLQSVSNYLILSLAVADLMVASLVMSVSLLSEISKQWFLGIELCDFWVCFDVLCCSASILHLVAIAFDRYWAVTNIDYIRMRTAKRIIIMIIIVWFLSIIISIPSRFYSSRTWENVYKSVVIDGLCNINDEYFYTIFSTVGAFYMPMFLLIGIYLKIYQTARARIRKHGFHKSKSKFNNSFFNSIKKFPFRWPKKVKFIPVKREMNSTHRYQCSSNFSQTNNYLQMKIDMQSYEISSYYGKNMSKNQVNSYDLDSVNQSSCDPQSSSSSHKYCNSSCEHINMNNQYPNVDSNMLSNSIFKQYQCKHEKDKLHFSILQSPVVLEAEFVTDPAQCLENYDEKIIWNWKETSSLNSSPRITCPNRPRHDCIEYIKKTKRKLHPQNSLSPNIHYKITGILVPDRVNLHVNHNSINIKNHLNMQ FENSTISKSQLPTHGSRTDTYPKTFVTNSDFTSKKSFIEQQKQKLEHKRERKAARTLAIITGCFILCWLPFFIQALYLPFCGRQCVPNDIFSSFFLWLGYCNSLLNPIIYTIFSPEFRNAFNKILFGRYQKTKRSY
Sbjct:    1 MNVSLFEILNITKNQSLEVARFSPKHGWIHVYLTSAVLGSLILCTIIGNVFVVAAIILEKNLQSVSNYLILSLAVADLMVASLVMSVSLLSEISKQWFLGIELCDFWVCFDVLCCSASILHLVAIAFDRYWAVTNIDYIRMRTAKRIIIMIIIVWFLSIIISIPSRFYSSRTWENVYKSVVIDGLCNINDEYFYTIFSTVGAFYMPMFLLIGIYLKIYQTARARIRKHGFHKSKSKFNNSFFNSIKKFPFRWPKKVKFIPVKREMNSTHRYQCSSNFSQTNNYLQMKIDMQSYEISSYYGKNMSKNQVNSYDLDSVNQSSCDPQSSSSSHKYCNSSCEHINMNNQYPNVDSNMLSNSIFKQYQCKHEKDKLHFSILQSPVVLEAEFVTDPAQCLENYDEKIIWNWKETSSLNSSPRITCPNRPRHDCIEYIKKTKRKLHPQNSLSPNIHYKITGILVPDRVNLHVNHNSINIKNHLNMQTFENSTISKSQLPTHGSRTDTYPKTFVTNSDFTSKKSFIEQQKQKLEHKRERKAARTLAIITGCFILCWLPFFIQALYLPFCGRQCVPNDIFSSFFLWLGYCNSLLNPIIYTIFSPEFRNAFNKILFGRYQKTKRSY 616          
BLAST of 5-hydroxytryptamine receptor vs. TrEMBL
Match: G7YNE6 (5-hydroxytryptamine receptor 1 OS=Clonorchis sinensis OX=79923 GN=CLF_103340 PE=3 SV=1)

HSP 1 Score: 234.572 bits (597), Expect = 3.629e-64
Identity = 135/212 (63.68%), Postives = 165/212 (77.83%), Query Frame = 3
Query:  120 FSPKHGWIHVYLTSAVLGSLILCTIIGNVFVVAAIILEKNLQSVSNYLILSLAVADXXXXXXXXXXXXXXEISKQWFLGIELCDFWVCFDVLCCSASILHLVAIAFDRYWAVTNIDYIRMRTAKRXXXXXXXXXXXXXXXXXPSRFYSSR--TWENVYKSVVIDGLCNINDEYFYTIFSTVGAFYMPMFLLIGIYLKIYQTARARIRKHGFH 749
            F  + GW H +LT  +LGSLILCTI+GNVFVVAAI+LEK+LQ VSNYLILSLAVADLMVA+L M +S +SE+S  W+LG  +CDFW+C DVLCC+ASILHLV IA DRYWAVTN +Y R RTA+RI IMI   WFLS++IS+P+RF  +R   W N   + + + +C+IN EY YTIFSTVGAFY+PM  +IGIY +IY  AR+RIRK  F 
Sbjct:   13 FQTRLGWTHFWLTLVILGSLILCTIVGNVFVVAAILLEKHLQGVSNYLILSLAVADLMVATLPMPISAVSEVSLDWWLGESICDFWICSDVLCCTASILHLVGIALDRYWAVTNAEYFRRRTAQRIGIMIAAFWFLSLVISLPARFDYARITNWINGVSTNMTE-VCSINKEYGYTIFSTVGAFYVPMLFMIGIYARIYTVARSRIRKSAFR 223          

HSP 2 Score: 127.102 bits (318), Expect = 9.928e-27
Identity = 59/94 (62.77%), Postives = 71/94 (75.53%), Query Frame = 3
Query: 1617 QKQKLEHKRERKAARTLAIITGCFILCWLPFFIQALYLPFCGRQCVPNDIFSSFFLWLGYCNSLLNPIIYTIFSPEFRNAFNKILFGRYQKTKR 1898
            +++++E+KRERKA  TLAIITGCF+LCWLPFFI AL  PF   +  P+       LWLGY NSLLNP+IYTIFSP+FR AF KILFGRY +  R
Sbjct:  584 RRERIENKRERKAVMTLAIITGCFMLCWLPFFINALVSPFY-EKWQPSRATGDIILWLGYSNSLLNPVIYTIFSPDFRGAFRKILFGRYYRWSR 676          
BLAST of 5-hydroxytryptamine receptor vs. TrEMBL
Match: A0A4S2LW70 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_005918 PE=3 SV=1)

HSP 1 Score: 233.417 bits (594), Expect = 1.068e-63
Identity = 134/212 (63.21%), Postives = 165/212 (77.83%), Query Frame = 3
Query:  120 FSPKHGWIHVYLTSAVLGSLILCTIIGNVFVVAAIILEKNLQSVSNYLILSLAVADXXXXXXXXXXXXXXEISKQWFLGIELCDFWVCFDVLCCSASILHLVAIAFDRYWAVTNIDYIRMRTAKRXXXXXXXXXXXXXXXXXPSRFYSSR--TWENVYKSVVIDGLCNINDEYFYTIFSTVGAFYMPMFLLIGIYLKIYQTARARIRKHGFH 749
            F  + GW H +LT  +LG+LILCTI+GNVFVVAAI+LEK+LQ VSNYLILSLAVADLMVA+L M +S +SE+S  W+LG  +CDFW+C DVLCC+ASILHLV IA DRYWAVTN +Y R RTA+RI IMI   WFLS++IS+P+RF  +R   W N   + + + +C+IN EY YTIFSTVGAFY+PM  +IGIY +IY  AR+RIRK  F 
Sbjct:   13 FQTRLGWTHFWLTLVILGTLILCTIVGNVFVVAAILLEKHLQGVSNYLILSLAVADLMVATLPMPISAVSEVSLDWWLGESVCDFWICSDVLCCTASILHLVGIALDRYWAVTNAEYFRRRTAQRIGIMIAAFWFLSLVISLPARFDYARITNWINGVSTNMTE-VCSINKEYGYTIFSTVGAFYVPMLFMIGIYARIYTVARSRIRKSAFR 223          

HSP 2 Score: 126.716 bits (317), Expect = 1.156e-26
Identity = 59/94 (62.77%), Postives = 71/94 (75.53%), Query Frame = 3
Query: 1617 QKQKLEHKRERKAARTLAIITGCFILCWLPFFIQALYLPFCGRQCVPNDIFSSFFLWLGYCNSLLNPIIYTIFSPEFRNAFNKILFGRYQKTKR 1898
            +++++E+KRERKA  TLAIITGCF+LCWLPFFI AL  PF   +  P+       LWLGY NSLLNP+IYTIFSP+FR AF KILFGRY +  R
Sbjct:  584 RRERIENKRERKAVMTLAIITGCFMLCWLPFFINALVSPFY-EKWQPSRATGDIILWLGYSNSLLNPVIYTIFSPDFREAFRKILFGRYYRWSR 676          
BLAST of 5-hydroxytryptamine receptor vs. TrEMBL
Match: A0A4E0S346 (5-hydroxytryptamine receptor OS=Fasciola hepatica OX=6192 GN=D915_000745 PE=3 SV=1)

HSP 1 Score: 231.106 bits (588), Expect = 1.670e-62
Identity = 138/232 (59.48%), Postives = 171/232 (73.71%), Query Frame = 3
Query:   78 ILNITKNQSLEVARFSPKHGWIHVYLTSAVLGSLILCTIIGNVFVVAAIILEKNLQSVSNYLILSLAVADXXXXXXXXXXXXXXEISKQWFLGIELCDFWVCFDVLCCSASILHLVAIAFDRYWAVTNIDYIRMRTAKRXXXXXXXXXXXXXXXXXPSRFYSSR--TWENVYKSVVID------GLCNINDEYFYTIFSTVGAFYMPMFLLIGIYLKIYQTARARIRKHGFH 749
            ++N T N + E+  F  + GW+H +LT  +LG+ ILCTI+GNVFVVAAI+LEK+LQ VSNYLILSLAVADLMVA+L M +S ++E+S+ W+LG  LCDFWVC DVLCC+ASI+HLV IA DRYWAVTN +YIR RTAKRI  MI + W LSI IS+P+RF ++R  +W     +V I         C IN EY YTIFSTV AFYMPMF +I IY +IY  A+ARIR+  F 
Sbjct:    1 MMNFT-NATTEIV-FQNRFGWVHFWLTLCLLGAFILCTIVGNVFVVAAILLEKHLQGVSNYLILSLAVADLMVATLPMPISAINEVSRDWWLGNALCDFWVCSDVLCCTASIMHLVGIALDRYWAVTNAEYIRKRTAKRIGFMITVFWLLSIAISLPARFTTTRLTSWIQPVDTVNISFDEYIIPDCGINKEYGYTIFSTVVAFYMPMFFIICIYARIYMVAKARIRRSTFR 230          

HSP 2 Score: 125.561 bits (314), Expect = 3.983e-26
Identity = 59/89 (66.29%), Postives = 70/89 (78.65%), Query Frame = 3
Query: 1617 QKQKLEHKRERKAARTLAIITGCFILCWLPFFIQALYLPFCGRQCVPNDIFSSFFLWLGYCNSLLNPIIYTIFSPEFRNAFNKILFGRY 1883
            ++++LE++RERKA  TLAIITGCF+LCWLPFFI AL  PF   Q   + +     LWLGY NSLLNP+IYTIFSP+FRNAF KILFGRY
Sbjct:  640 KRERLENQRERKAVITLAIITGCFMLCWLPFFIVALIAPFYD-QMKLSKVGQGIVLWLGYSNSLLNPMIYTIFSPDFRNAFRKILFGRY 727          
BLAST of 5-hydroxytryptamine receptor vs. TrEMBL
Match: A0A183AJS0 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS7205 PE=3 SV=1)

HSP 1 Score: 228.794 bits (582), Expect = 8.152e-62
Identity = 134/220 (60.91%), Postives = 165/220 (75.00%), Query Frame = 3
Query:  120 FSPKHGWIHVYLTSAVLGSLILCTIIGNVFVVAAIILEKNLQSVSNYLILSLAVADXXXXXXXXXXXXXXEISKQWFLGIELCDFWVCFDVLCCSASILHLVAIAFDRYWAVTNIDYIRMRTAKRXXXXXXXXXXXXXXXXXPSRFYSSR--TW---------ENVYKSVVIDGLCNINDEYFYTIFSTVGAFYMPMFLLIGIYLKIYQTARARIRKHGF 746
            F  + GW H ++T A+L  LILCTI+GNVFVVAAI+LEK+LQ VSNYLILSLAVADLMVA+L M +S ++E+S+ W+LG  LCDFW+C DVLCC+ASILHLV IA DRYWAVTN +YIR RTAKRI  MI + W LS+ IS+P+RF  +R  +W         E++ +  V D  C IN EY YTIFSTVGAFYMPM  ++GIY +IY  A+ARIR+  F
Sbjct:   11 FQTRFGWAHFWVTLALLIPLILCTIVGNVFVVAAILLEKHLQGVSNYLILSLAVADLMVATLPMPISAINEVSEDWWLGNALCDFWICSDVLCCTASILHLVGIALDRYWAVTNAEYIRKRTAKRIGFMITVFWLLSVAISLPARFNITRLKSWIQHSNLAANESIEQWSVPD--CGINKEYGYTIFSTVGAFYMPMIFMMGIYARIYLVAKARIRRSTF 228          

HSP 2 Score: 127.487 bits (319), Expect = 9.201e-27
Identity = 59/89 (66.29%), Postives = 71/89 (79.78%), Query Frame = 3
Query: 1617 QKQKLEHKRERKAARTLAIITGCFILCWLPFFIQALYLPFCGRQCVPNDIFSSFFLWLGYCNSLLNPIIYTIFSPEFRNAFNKILFGRY 1883
            ++++LE++RERKA  TLAIITGCF+LCWLPFFI A+  PF  R  + + +     LWLGY NSLLNPIIYTIFSP+FRNAF KILFGRY
Sbjct:  610 KRERLENQRERKAVITLAIITGCFMLCWLPFFIVAVIAPFNDRMRI-SKVGHGIVLWLGYSNSLLNPIIYTIFSPDFRNAFRKILFGRY 697          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Cavefish
Match: htr1ab (5-hydroxytryptamine (serotonin) receptor 1A b [Source:ZFIN;Acc:ZDB-GENE-090409-2])

HSP 1 Score: 151.754 bits (382), Expect = 9.542e-40
Identity = 90/195 (46.15%), Postives = 135/195 (69.23%), Query Frame = 3
Query:  156 TSAVLGSLILCTIIGNVFVVAAIILEKNLQSVSNYLILSLAVADXXXXXXXXXXXXXXEISKQWFLGIELCDFWVCFDVLCCSASILHLVAIAFDRYWAVTN-IDYIRMRTAKRXXXXXXXXXXXXXXXXXPSRFYSSRTWENVYKSVVIDGLCNINDEYFYTIFSTVGAFYMPMFLLIGIYLKIYQTARARIRK 737
            TS ++G+LILC++ GN  VVAAI LE++LQ+V+NYLI SLAV DLMV+ LV+ ++ L ++  +W LG   CD ++  D+LCC++SILHL AIA DRYWA+T+ IDY++ RT KR  ++I + W +   ISIP         ++  + +     C I+ + +YTI+ST  AFY+P+ L++ +Y +I++ AR RIRK
Sbjct:   40 TSVLIGALILCSVFGNSCVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMACLYQVLDRWTLGQVTCDIFISLDILCCTSSILHLCAIALDRYWAITDPIDYMKKRTLKRAAVLIGVTWLVGFSISIPPMLIMKSQPKSKAEDIANPEACMISHDPWYTIYSTFCAFYIPLILMLVLYGRIFKAARFRIRK 234          

HSP 2 Score: 95.5153 bits (236), Expect = 1.239e-20
Identity = 48/89 (53.93%), Postives = 61/89 (68.54%), Query Frame = 3
Query: 1614 QQKQKLEHKRERKAARTLAIITGCFILCWLPFFIQALYLPFCGRQCVP---NDIFSSFFLWLGYCNSLLNPIIYTIFSPEFRNAFNKIL 1871
            + K+KL   RERK  +TL II G FILCWLPFFI+AL +PFC    +P    D+ +    WLGY NSLLNPIIY  F+ +F++AF KI+
Sbjct:  324 EAKRKLALARERKTVKTLGIIMGTFILCWLPFFIKALVMPFCPSCQMPVWLMDVIN----WLGYSNSLLNPIIYAYFNKDFQSAFKKII 408          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Cavefish
Match: HTR1B (5-hydroxytryptamine receptor 1B [Source:NCBI gene;Acc:103031645])

HSP 1 Score: 133.65 bits (335), Expect = 1.410e-33
Identity = 102/240 (42.50%), Postives = 135/240 (56.25%), Query Frame = 3
Query:   51 KKMNVSLFEILNITKNQSLEVARFSPKHGWIH-------VYLTSAVLGSLILC-TIIGNVFVVAAIILEKNLQSVSNYLILSLAVADXXXXXXXXXXXXXXEISKQWFLGIELCDFWVCFDVLCCSASILHLVAIAFDRYWAVTN-IDYIRMRTAKRXXXXXXXXXXXXXXXXXPSRFYSSRTWENVYKSVVIDGLCNIN-DEYFYTIFSTVGAFYMPMFLLIGIYLKIYQTARARIRKH 740
            K   V   E LNIT N +  V+  +  HG          V  T A L SL+ C T + N FVVA I   + L + +N LI SLA  DL+V+ LVM VS++  + + W LG  +CD W+  DV CC+ASILHL  IA DRYWA+T+ + Y + RT +R   MI   W +++ IS+P  F+     E+   S      C +N D  FYTI+ST GAFY+P  LLI +Y +IY  AR RI K 
Sbjct:    4 KATAVVYGEPLNITSNHT--VSNQTRAHGDASGGAAPALVQATVATLLSLLTCATALSNAFVVATIARSRKLHTPANVLIGSLAFTDLLVSVLVMPVSIVYTVRRVWTLGRVICDLWLSSDVTCCTASILHLCVIALDRYWAITDAVGYSKRRTTQRAAAMIAAAWVIAVSISLPPFFWQQVRTEDEMTS------CTVNTDHVFYTIYSTFGAFYIPTLLLIALYGRIYAEARKRILKQ 235          

HSP 2 Score: 93.2041 bits (230), Expect = 6.036e-20
Identity = 53/150 (35.33%), Postives = 83/150 (55.33%), Query Frame = 3
Query: 1422 LVPDRVNLHVNHNSINIKNHLNMQNFENSTISKSQLPTHGSRTDTYPKTFVTNSDFTSKKSFIEQQKQKLEHKRERKAARTLAIITGCFILCWLPFFIQALYLPFCGRQCVPNDIFSSFFLWLGYCNSLLNPIIYTIFSPEFRNAFNKIL 1871
            L+ D      +  S+N   H    +  ++T++ S +  H  +        VT SD     + +E  K+++   RERKA +TL +I G +I+CWLPFFI  L +P C       ++F   F WLGY NSL+NPIIYT+ + +F+ AF+K++
Sbjct:  249 LISDSPGSVASTTSLNYGTH--ETSTSDATVATSAVANHQVK--------VTVSD-----ALLE--KKRISAARERKATKTLGVILGAYIMCWLPFFIYTLLVPICTTCTFYPELF-DVFTWLGYLNSLINPIIYTMSNEDFKQAFHKLI 380          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Cavefish
Match: ENSAMXT00000006138.2 (pep primary_assembly:Astyanax_mexicanus-2.0:6:27993956:27999385:-1 gene:ENSAMXG00000005992.2 transcript:ENSAMXT00000006138.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 132.109 bits (331), Expect = 5.360e-33
Identity = 85/183 (46.45%), Postives = 124/183 (67.76%), Query Frame = 3
Query:  153 LTSAVLGSLILCTIIGNVFVVAAIILEKNLQSVSNYLILSLAVADXXXXXXXXXXXXXXEISKQWFLGIELCDFWVCFDVLCCSASILHLVAIAFDRYWAVTN-IDYIRMRTAKRXXXXXXXXXXXXXXXXXPSRFYSSRTWENVYKSVVIDGLCNINDEYFYTIFSTVGAFYMPMFLLIGIY 698
            LTS +LG+LIL +I+GN  V+AAI LE++LQ+++NYLI SLAV DL+V+ LV+ ++ L ++ ++W LG   CD ++  DVLCC++SILHL AIA DRYWA+T+ + Y+  RT  R   +I + W +   ISIP      RT E+    +     C I+ +  YTIFST GAFY+P+ L++ +Y
Sbjct:   35 LTSLLLGALILMSIVGNACVIAAIALERSLQTINNYLIGSLAVTDLLVSVLVLPMAALYQVLQRWTLGQVACDLFIALDVLCCTSSILHLCAIALDRYWAITDPVAYMTRRTLCRAATLISLTWLVGFSISIPP-MLGWRTPEDRANPLE----CTISQDPGYTIFSTFGAFYIPLALMLVLY 212          

HSP 2 Score: 102.449 bits (254), Expect = 5.836e-23
Identity = 47/91 (51.65%), Postives = 58/91 (63.74%), Query Frame = 3
Query: 1617 QKQKLEHKRERKAARTLAIITGCFILCWLPFFIQALYLPFCGRQCVPNDIFSSFFLWLGYCNSLLNPIIYTIFSPEFRNAFNKILFGRYQK 1889
            Q  +    RER+  +TL II G FILCWLPFFI AL LPFCG  C       +   WLGY NSLLNP+IY  F+ +F+NAF K+L  R+ +
Sbjct:  316 QDSRGALARERRTVKTLGIIMGTFILCWLPFFIVALVLPFCGSSCPMPPWLGAVINWLGYANSLLNPVIYAYFNRDFQNAFRKMLRCRFSR 406          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Cavefish
Match: ENSAMXT00000026144.2 (pep primary_assembly:Astyanax_mexicanus-2.0:9:14357937:14360657:1 gene:ENSAMXG00000025418.2 transcript:ENSAMXT00000026144.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 124.79 bits (312), Expect = 1.033e-30
Identity = 87/196 (44.39%), Postives = 130/196 (66.33%), Query Frame = 3
Query:  159 SAVLGSLILCTIIGNVFVVAAIILEKNLQSVSNYLILSLAVADXXXXXXXXXXXXXXEISKQWFLGIELCDFWVCFDVLCCSASILHLVAIAFDRYWAVTN-IDYIRMRTAKRXXXXXXXXXXXXXXXXXPSRFY-SSRTWENVYKSVVIDGLCNIN-DEYFYTIFSTVGAFYMPMFLLIGIYLKIYQTARARIRK 737
            SA+L  + L T++ N FV+A I L + L + +N+LI SLA+ DL+V+ LVM +S++  +SK W LG  +CD W+  D+  C+ASILHL  IA DRYWA+T+ ++Y + RT +R  +MI +VW +SI ISIP  F+  ++  E + +       C +N D+  YT++ST GAFY+P  LL+ +Y +IY  AR+RI K
Sbjct:   29 SALLAVVTLATMLSNAFVIATIFLTRKLHTPANFLIGSLALTDLLVSILVMPISIVYTVSKTWTLGQIMCDIWLSSDITFCTASILHLCVIALDRYWAITDALEYSKRRTTRRAALMIGVVWVISISISIPPLFWRQAKAHEELTE-------CLVNTDQISYTLYSTFGAFYVPTILLVILYGRIYVAARSRIFK 217          

HSP 2 Score: 94.7449 bits (234), Expect = 1.363e-20
Identity = 41/85 (48.24%), Postives = 59/85 (69.41%), Query Frame = 3
Query: 1617 QKQKLEHKRERKAARTLAIITGCFILCWLPFFIQALYLPFCGRQCVPNDIFSSFFLWLGYCNSLLNPIIYTIFSPEFRNAFNKIL 1871
            ++++L   RE+KA +TL II G FI+CWLPFF+  L +  C + C  + +   FF WLGY NSL+NP+IYT F+ EF+ AF K++
Sbjct:  281 ERKRLCAAREKKATKTLGIILGAFIVCWLPFFVVTLVMAIC-KDCWFHPVLFDFFTWLGYLNSLINPVIYTAFNDEFKQAFQKLI 364          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Cavefish
Match: htr1b (5-hydroxytryptamine (serotonin) receptor 1B [Source:ZFIN;Acc:ZDB-GENE-081022-141])

HSP 1 Score: 124.79 bits (312), Expect = 1.086e-30
Identity = 81/182 (44.51%), Postives = 110/182 (60.44%), Query Frame = 3
Query:  201 NVFVVAAIILEKNLQSVSNYLILSLAVADXXXXXXXXXXXXXXEISKQWFLGIELCDFWVCFDVLCCSASILHLVAIAFDRYWAVTN-IDYIRMRTAKRXXXXXXXXXXXXXXXXXPSRFYSSRTWENVYKSVVIDGLCNIN-DEYFYTIFSTVGAFYMPMFLLIGIYLKIYQTARARIRKH 740
            N FV+A I   + L + +N+LI SLAV DL+V+ LVM +S L  ++  W LG   CD W+  D+ CC+ASILHL  IA DRYWA+T+ + Y + RT +R   M+   W +++ IS+P  F     W  V    V    C +N D  FYTI+ST GAFY+P  LL+ +Y +IY  AR RI K 
Sbjct:   55 NAFVIATISRSRKLHTPANFLIGSLAVTDLLVSVLVMPISALYTVTHSWSLGQVACDVWLSSDITCCTASILHLCVIALDRYWAITDAVGYAKRRTIRRAAGMVATAWVIAVSISVPPFF-----WRQVKAGEVTS--CAVNSDHIFYTIYSTFGAFYLPTLLLVALYGRIYVEARRRILKQ 229          

HSP 2 Score: 95.5153 bits (236), Expect = 7.101e-21
Identity = 43/85 (50.59%), Postives = 61/85 (71.76%), Query Frame = 3
Query: 1617 QKQKLEHKRERKAARTLAIITGCFILCWLPFFIQALYLPFCGRQCVPNDIFSSFFLWLGYCNSLLNPIIYTIFSPEFRNAFNKIL 1871
            +K+++   RERKA +TL II G +I+CWLPFFI  L +P C   C+  ++F  FF WLGY NSL+NPIIYT+ + +F+ AF K++
Sbjct:  279 EKKRISAARERKATKTLGIILGAYIICWLPFFIYTLLVPLC-PSCLHPELF-DFFTWLGYLNSLINPIIYTMSNDDFKKAFQKLV 361          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001357.1 (pep scaffold:Pmarinus_7.0:GL478256:17157:19157:1 gene:ENSPMAG00000001226.1 transcript:ENSPMAT00000001357.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 159.073 bits (401), Expect = 1.464e-43
Identity = 97/196 (49.49%), Postives = 133/196 (67.86%), Query Frame = 3
Query:  156 TSAVLGSLILCTIIGNVFVVAAIILEKNLQSVSNYLILSLAVADXXXXXXXXXXXXXXEISKQWFLGIELCDFWVCFDVLCCSASILHLVAIAFDRYWAVTN-IDYIRMRTAKRXXXXXXXXXXXXXXXXXPSRFYSSRTWENVYKSVVIDGLCNINDEYFYTIFSTVGAFYMPMFLLIGIYLKIYQTARARIRKH 740
            TS+ LG+LI C+I GN FV+AAI LE++LQ+V+NYLI SLAV DL+V+ LV+ V+ L ++  +W LG  +CD ++  DVLCC++SILHL AIA DRYWA+T+ +DY+  RT +R  +MI I W +   ISIP        W         D  CNI+    YTI+ST GAFY+P+ L++ +Y KI+  AR RIRK+
Sbjct:    5 TSSALGALIACSIAGNAFVLAAIYLERSLQTVANYLIGSLAVTDLLVSVLVLPVAALYQVLGRWTLGQAVCDAFIALDVLCCTSSILHLCAIALDRYWAITDPVDYVNKRTPRRAALMIAITWVVGFSISIPPML----GWRQAEDRADPDA-CNISQHLGYTIYSTFGAFYIPLVLMLVLYGKIFSAARFRIRKN 195          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009127.1 (pep scaffold:Pmarinus_7.0:GL478629:43196:44446:-1 gene:ENSPMAG00000008256.1 transcript:ENSPMAT00000009127.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 150.214 bits (378), Expect = 3.746e-40
Identity = 94/200 (47.00%), Postives = 135/200 (67.50%), Query Frame = 3
Query:  144 HVYLTSAVLGSLILCTIIGNVFVVAAIILEKNLQSVSNYLILSLAVADXXXXXXXXXXXXXXEISKQWFLGIELCDFWVCFDVLCCSASILHLVAIAFDRYWAVTN-IDYIRMRTAKRXXXXXXXXXXXXXXXXXPSRFYSSRTWENVYKSVVIDGLCNINDEYFYTIFSTVGAFYMPMFLLIGIYLKIYQTARARIRKH 740
            +  ++S  L +LILC I GN  V+AAI LE+ LQ+V+NYLI SLAV DL+V+ LV+ ++ L ++  +W LG  +CD ++  DVLCC++SILHL  IA DRYWA+TN IDY+  RT +R +IMI + W +   ISIP      RT E+          C I+ ++ YTI+ST GAFY+P+ L++ +Y +I++ AR RIRK+
Sbjct:   35 YTVISSLCLTALILCAIFGNSCVIAAIALERTLQNVANYLIGSLAVTDLLVSILVLPMAALYQVLDRWTLGQVVCDIFIALDVLCCTSSILHLCVIALDRYWAITNPIDYVNKRTPRRAVIMISLTWLVGFSISIPP-MLGWRTPEDRAD----PNACKISQDHGYTIYSTFGAFYIPLILMLVLYSRIFRAARFRIRKN 229          

HSP 2 Score: 57.7658 bits (138), Expect = 4.136e-9
Identity = 28/51 (54.90%), Postives = 36/51 (70.59%), Query Frame = 3
Query: 1722 LYLPFCGRQC-VPNDIFSSFFLWLGYCNSLLNPIIYTIFSPEFRNAFNKIL 1871
            L  PFCG +C +P  +F+    WLGY NSLLNPIIY  F+ +F+NAF KI+
Sbjct:  332 LISPFCGERCHLPPGVFA-VINWLGYSNSLLNPIIYAYFNKDFQNAFKKII 381          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Sea Lamprey
Match: HTR1F (5-hydroxytryptamine receptor 1F [Source:HGNC Symbol;Acc:HGNC:5292])

HSP 1 Score: 122.479 bits (306), Expect = 3.123e-30
Identity = 78/175 (44.57%), Postives = 111/175 (63.43%), Query Frame = 3
Query:  201 NVFVVAAIILEKNLQSVSNYLILSLAVADXXXXXXXXXXXXXXEISKQWFLGIELCDFWVCFDVLCCSASILHLVAIAFDRYWAVTN-IDYIRMRTAKRXXXXXXXXXXXXXXXXXPSRFYSSRTWENVYKSVVIDGLCNINDEYFYTIFSTVGAFYMPMFLLIGIYLKIYQTAR 722
            N  V+AAI   + L+  +NYLI SLAVADL+VA+LVM V+    ++ +W LG  LCD W+  DV CC+ASILHL AIA DR+WA+T+  +Y   RT  R  +MI   W L+  IS+P  F+  R  +      +I+     +D   YTI+ST GAFY+P+ LL+ +Y +I++ A+
Sbjct:   65 NALVIAAISATRKLRQPANYLIGSLAVADLLVAALVMPVAAAYVVTGEWALGGALCDLWLSLDVTCCTASILHLCAIALDRFWAITDAAEYAHKRTPGRAALMIAASWLLAACISVPPLFWRRR--DPAKPRCIIE-----HDHVLYTIYSTFGAFYVPLALLLALYCRIFRAAK 232          

HSP 2 Score: 91.2781 bits (225), Expect = 8.264e-20
Identity = 37/84 (44.05%), Postives = 60/84 (71.43%), Query Frame = 3
Query: 1620 KQKLEHKRERKAARTLAIITGCFILCWLPFFIQALYLPFCGRQCVPNDIFSSFFLWLGYCNSLLNPIIYTIFSPEFRNAFNKIL 1871
            ++++   RER+AA+TL +I G F++CWLPFFI+ L +  C + C  +   +    WLGY NSL+NP+IYT+F+ +F++AF K++
Sbjct:  339 QERISGSRERRAAKTLGLILGAFVVCWLPFFIKELVVNLC-KSCAVSPEVADLLTWLGYMNSLINPLIYTMFNEDFKSAFRKLV 421          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008360.1 (pep scaffold:Pmarinus_7.0:GL477173:168532:170490:1 gene:ENSPMAG00000007563.1 transcript:ENSPMAT00000008360.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 100.523 bits (249), Expect = 9.891e-23
Identity = 72/201 (35.82%), Postives = 116/201 (57.71%), Query Frame = 3
Query:  177 LILCTIIGNVFVVAAIILEKNLQSVSNYLILSLAVADXXXXXXXXXXXXXXEISKQWFLGIELCDFWVCFDVLCCSASILHLVAIAFDRYWAVTN-IDYIRMRTAKRXXXXXXXXXXXXXXXXXPSRFYSSRTWENVYK--------------SVVIDGLCNINDEYFYTIFSTVGAFYMPMFLLIGIYLKIYQTARARIR 734
            +IL TI GN  V  A+   K+L++  N  ++SLA AD++VA+LVM  SL +E+   W  G   C+ ++  DVL C++SI+HL AI+ DRYW+VT  + Y   RT +R+   I+IVW ++ +IS P    + R   N+++              S V+   C +N+E +Y + S   +F+ P  +++ +Y +IYQ A+ R R
Sbjct:   43 IILVTIFGNSLVAIAVFTSKSLKAAQNLFLVSLAAADILVATLVMPFSLANELMGYWVFGSFWCEMYLALDVLFCTSSIVHLCAISLDRYWSVTQAVRYNMKRTPRRVKRAIVIVWVIAALISFPPLVGTGRPPANIHRHRHQGSGRNASSSPSSVLP-TCKLNEETWYVLSSCTASFFTPCLIMLLVYARIYQVAKGRAR 242          

HSP 2 Score: 87.4261 bits (215), Expect = 1.935e-18
Identity = 38/95 (40.00%), Postives = 53/95 (55.79%), Query Frame = 3
Query: 1611 EQQKQKLEHKRERKAARTLAIITGCFILCWLPFFIQALYLPFCGRQCVPNDIFSSFFLWLGYCNSLLNPIIYTIFSPEFRNAFNKILFGRYQKTK 1895
            +  ++KL   RE++    LA++ G F+ CW PFF        C   C P +    FF W GYCNS LNP+IYT+F+ +FR AF  IL  R  + +
Sbjct:  377 KMARRKLTAAREKRFTFVLAVVMGVFVACWFPFFFSYSLTKICEASCKPPEYLFKFFFWCGYCNSSLNPLIYTVFNQDFRRAFKNILCRRRPRMR 471          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Sea Lamprey
Match: chrm5b (cholinergic receptor, muscarinic 5b [Source:ZFIN;Acc:ZDB-GENE-041001-169])

HSP 1 Score: 95.9005 bits (237), Expect = 4.075e-21
Identity = 63/189 (33.33%), Postives = 113/189 (59.79%), Query Frame = 3
Query:  183 LCTIIGNVFVVAAIILEKNLQSVSNYLILSLAVADXXXXXXXXXXXXXXEISKQWFLGIELCDFWVCFDVLCCSASILHLVAIAFDRYWAVTN-IDYIRMRTAKRXXXXXXXXXXXXXXXXXPSRFYSSRTWEN-VYKSVVIDGLCNIN--DEYFYTIFSTVGAFYMPMFLLIGIYLKIYQTARARIRK 737
            L T++GN  V+ +  + + L++VSNY +LSLA ADL+V    M++     ++ +W +G  +CD W+  D +  +AS+++L+AI+FDRY+++T  + Y   RT +R  IMI + W +S+++  P+  +    W++ V K  V    C I    E   T  + + AFY+P+ +++ +Y +IY+  R R R+
Sbjct:   42 LITVVGNTLVMLSFRVSRQLKTVSNYFLLSLAAADLIVGLFSMNLYTAYILTGRWAMGAVMCDLWLTLDYVASNASVMNLLAISFDRYFSITRPLKYKAKRTKRRASIMIGLAWAVSLVLWAPAILF----WQHMVGKRTVPQDQCYIQFLSEPIITFGTAIAAFYLPITIMMVLYWRIYRETRRRSRQ 226          

HSP 2 Score: 53.1434 bits (126), Expect = 1.221e-7
Identity = 30/77 (38.96%), Postives = 40/77 (51.95%), Query Frame = 3
Query: 1641 RERKAARTLAIITGCFILCWLPFFIQALYLPFCGRQCVPNDIFSSFFLWLGYCNSLLNPIIYTIFSPEFRNAFNKIL 1871
            R+ KA R L  I   FI+ W P+ I  L   FC   CVP  ++   + WL Y NS +NP+ Y + +  FR  F  IL
Sbjct:  442 RDNKAVRILCAILLAFIVTWTPYNIMVLVSTFCD-DCVPKKLWHLGY-WLCYVNSTVNPMCYALCNMHFRKTFKTIL 516          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Nematostella
Match: EDO35450 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLG6])

HSP 1 Score: 79.337 bits (194), Expect = 2.892e-16
Identity = 67/195 (34.36%), Postives = 114/195 (58.46%), Query Frame = 3
Query:  177 LILCTIIGNVFVVAAIILEKNLQSVSNYLILSLAVADXXXXXXXXXXXXXXEI-SKQWFLGIELCDFWVCFDVLCCSASILHLVAIAFDRYWAVT-NIDYIRMRTAKRXXXXXXXXXXXXXXXXXPSRFYSSRTWENVYKSVVIDGL------CNINDEYFYTIFSTVGAFYMPMFLLIGIYLKIYQTARARIRK 737
            +++  + GN+ V  AI+  + L++V+NY I+SLAV+DL+VA L M   +   + S  W LGI +C+FW+  D++C SASI +L  I+ DR+ A++  + Y  + T +R ++ I +VW  S++I   S    +  W         DGL      C++ D+Y+YT   TVG F++P+ +L+  Y  +++ A  + RK
Sbjct:   19 ILILDVCGNLLVCGAILSYRRLRTVTNYFIISLAVSDLLVAGLSMPFRIHHTLHSMCWDLGISVCEFWIFVDLVCSSASICNLSMISVDRFLALSYPLTYPSIMTKRRGLLAIAMVWGYSLLI---SALSFTLPWSP-------DGLMQDIPACSLKDKYYYTFVITVG-FFLPLVVLVIAYSLVFKVALHQARK 202          

HSP 2 Score: 62.7734 bits (151), Expect = 1.053e-10
Identity = 37/87 (42.53%), Postives = 48/87 (55.17%), Query Frame = 3
Query: 1641 RERKAARTLAIITGCFILCWLPFFIQALYLPFCGRQCVPN----------DIFSSFFLWLGYCNSLLNPIIYTIFSPEFRNAFNKIL 1871
            RE KA +TLAI+ G FI+CWLPFF+    + FC  +C  +           I + F   L   NS +NPIIY+ F+  FR AF  IL
Sbjct:  217 RELKATKTLAIVVGSFIVCWLPFFVIMFTVQFC-PECFQDHRSLPVKAQLAIGTVFVYVLPLLNSAVNPIIYSSFNANFRRAFKDIL 302          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Nematostella
Match: EDO31890 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWM7])

HSP 1 Score: 77.7962 bits (190), Expect = 1.213e-15
Identity = 32/89 (35.96%), Postives = 53/89 (59.55%), Query Frame = 3
Query: 1614 QQKQKLEHKRERKAARTLAIITGCFILCWLPFFIQALYLPFCGRQCVPNDIFSSFFLWLGYCNSLLNPIIYTIFSPEFRNAFNKILFGR 1880
            +++++   +RE K  +TLA++ G F++CW PFF   +    C   C  +    S   WL YC++ +NPIIYT+ +  FR AF ++L+ R
Sbjct:  222 EKERRSVFRRELKITKTLAVVIGAFVVCWAPFFTIIIRFALCSPHCTTDPALISVSKWLHYCSTFINPIIYTLLTRGFRRAFTRVLWCR 310          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Nematostella
Match: EDO47619 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLK3])

HSP 1 Score: 74.3294 bits (181), Expect = 8.568e-15
Identity = 59/198 (29.80%), Postives = 101/198 (51.01%), Query Frame = 3
Query:  153 LTSAVLGSLILCTIIGNVFVVAAIILEKNLQSVSNYLILSLAVADXXXXXXXXXXXXXXEI-SKQWFLGIELCDFWVCFDVLCCSASILHLVAIAFDRYWAVTNIDYIRMRTAKRXXXXXXXXXXXXXXXXXPSRFYSSRTWENVYKSVVIDGLCNINDEYFYTIFSTVGAFYMPMFLLIGIYLKIYQTARARIRKHG 743
            + +  +  LI+ T+IGNV V A+  L + L+++ NY ++SL+ AD++VA L M      ++ S  W  G+EL  FW C D+LC +ASI++L+A++ DR+ A+T   Y     +     + I+  +L  I     R      W      V             Y   +   +F  P+ +++ +YL+IY  AR ++R+ G
Sbjct:    1 VAATFVAMLIVFTLIGNVLVCASFALFRELRTICNYFVVSLSAADILVALLAMPFWCALQVTSNMWMFGLELQLFWSCMDILCGTASIMNLMAVSIDRHIAITMPFYYETVMSPIKAKLTIMFVWLYAITISCLRLVQ---WPGKQGKV-------------YMNIAAFASFLCPLTVMVVMYLRIYLVARYQVRRIG 182          

HSP 2 Score: 49.6766 bits (117), Expect = 1.210e-6
Identity = 27/76 (35.53%), Postives = 42/76 (55.26%), Query Frame = 3
Query: 1635 HKRERKAARTLAIITGCFILCWLPFFIQAL-YLPFCGRQCVPNDIFSSFFLWLGYCNSLLNPIIYTIFSPEFRNAF 1859
            +  + KAA+T+A++ G F+ CW PFF+  + Y    G       +  +   W+ Y NS LNP+IYT  +  +R AF
Sbjct:  185 YMTDVKAAKTIAVVIGVFVACWTPFFVIIICYAHHPGFNVTKTTL--NVVKWMEYLNSCLNPVIYTCLNRNYRRAF 258          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Nematostella
Match: EDO47699 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLJ1])

HSP 1 Score: 73.9442 bits (180), Expect = 1.886e-14
Identity = 64/236 (27.12%), Postives = 119/236 (50.42%), Query Frame = 3
Query:   57 MNVSLFEILNITKNQSLEVARFSPKHGWIHVYLTSAVLGSLILCTIIGNVFVVAAIILEKNLQSVSNYLILSLAVADXXXXXXXXXXXXXXEISK-QWFLGIELCDFWVCFDVLCCSASILHLVAIAFDRYWAVTN-IDYIRMRTAKRXXXXXXXXXXXXXXXXXPSRFYSSRTWENVYKSVVIDGLCNINDEYF-----YTIFSTVGAFYMPMFLLIGIYLKIYQTARARIRKHG 743
            MN S+   LN + N ++         G  ++ + +  +  LI+ T+ GN  V A+    ++L+++ NY I+SL+V+D++VA + M      +IS  +W    +L D+W C D+LC +ASI++L+A++FDR  A+T    Y ++ T +R +++I                  S  W     +  I GL  +    +     Y   +   +F++P+  ++ +Y +IY  AR + R+ G
Sbjct:    1 MNASVGAALNASANSTVGAGEEEIIIGASNI-IAATFVALLIVLTLGGNFIVCASFYTFRDLRTICNYFIISLSVSDILVALIAMPFWFTIQISDNKWRYSRKLKDYWDCMDILCGTASIMNLMAVSFDRQLAITTPFTYPKILTKRRALVII------------------SFVWA---YAATISGLRQLKAPPYWPFPNYLHLNATFSFFLPLSFMVMMYARIYLVARYQARRIG 214          

HSP 2 Score: 62.003 bits (149), Expect = 1.466e-10
Identity = 30/86 (34.88%), Postives = 47/86 (54.65%), Query Frame = 3
Query: 1611 EQQKQKLEHKRERKAARTLAIITGCFILCWLPFFIQALYLPFCGRQCVPNDIFSSFFLWLGYCNSLLNPIIYTIFSPEFRNAFNKI 1868
            + ++    +  + KAA+T+A++ G F  CWLPFF+  L   + G     +    +   WL Y NS LNPIIYT  +  +R AF ++
Sbjct:  209 QARRIGKNYATDIKAAKTIAVVVGVFAACWLPFFVIVLIYAWQGYDAGVSPQLFNLAKWLAYFNSCLNPIIYTCLNRTYRRAFRRL 294          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Nematostella
Match: EDO48690 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIE2])

HSP 1 Score: 67.0106 bits (162), Expect = 1.014e-13
Identity = 32/72 (44.44%), Postives = 44/72 (61.11%), Query Frame = 3
Query: 1656 ARTLAIITGCFILCWLPFFIQALYLPFCGRQCVPNDIFSSFFLWLGYCNSLLNPIIYTIFSPEFRNAFNKIL 1871
            ARTLAI+ G FILCW PFF+  + +  C   C     F     WL Y  S +NPIIYT+ + EFR+ F++++
Sbjct:   16 ARTLAIVIGAFILCWGPFFVLNVVVMICKNDCSYGVAF-EVIKWLQYACSCINPIIYTVRNKEFRHTFHEMI 86          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Medaka
Match: ENSORLT00000005282.2 (pep primary_assembly:ASM223467v1:9:8571029:8576106:1 gene:ENSORLG00000004220.2 transcript:ENSORLT00000005282.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 157.147 bits (396), Expect = 1.501e-41
Identity = 96/196 (48.98%), Postives = 135/196 (68.88%), Query Frame = 3
Query:  153 LTSAVLGSLILCTIIGNVFVVAAIILEKNLQSVSNYLILSLAVADXXXXXXXXXXXXXXEISKQWFLGIELCDFWVCFDVLCCSASILHLVAIAFDRYWAVTN-IDYIRMRTAKRXXXXXXXXXXXXXXXXXPSRFYSSRTWENVYKSVVIDGLCNINDEYFYTIFSTVGAFYMPMFLLIGIYLKIYQTARARIRK 737
            +TS +LG+LILC+I GN  VVAAI LE++LQ+V+NYLI SLAV DLMV+ LV+ ++ L ++  +W LG E+CD ++  DVLCC++SILHL AIA DRYWA+T+ IDY+  RT  R +++I   W +   ISIP        W +       D  C I+ +  YTI+ST GAFY+P+ L++ +Y +I++ AR RIRK
Sbjct:   44 ITSLLLGALILCSIFGNACVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQEICDLFISLDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPMRAVLLICATWLIGFSISIPPML----GWRSAEDRANPDA-CMISQDPGYTIYSTFGAFYIPLILMLVLYGRIFRAARFRIRK 234          

HSP 2 Score: 104.375 bits (259), Expect = 1.725e-23
Identity = 49/90 (54.44%), Postives = 59/90 (65.56%), Query Frame = 3
Query: 1620 KQKLEHKRERKAARTLAIITGCFILCWLPFFIQALYLPFCGRQCVPNDIFSSFFLWLGYCNSLLNPIIYTIFSPEFRNAFNKILFGRYQK 1889
            K+KL   RERK  +TL II G FI CWLPFFI AL LPFC   C   D   +   WLGY NSLLNPIIY  F+ +F+NAF KI+  ++ +
Sbjct:  332 KRKLALSRERKTVKTLGIIMGTFIFCWLPFFIVALVLPFCPESCFMPDWLGAVINWLGYSNSLLNPIIYAYFNKDFQNAFKKIIKCKFHR 421          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Medaka
Match: htr1ab (5-hydroxytryptamine (serotonin) receptor 1A b [Source:ZFIN;Acc:ZDB-GENE-090409-2])

HSP 1 Score: 153.68 bits (387), Expect = 1.424e-40
Identity = 91/196 (46.43%), Postives = 133/196 (67.86%), Query Frame = 3
Query:  153 LTSAVLGSLILCTIIGNVFVVAAIILEKNLQSVSNYLILSLAVADXXXXXXXXXXXXXXEISKQWFLGIELCDFWVCFDVLCCSASILHLVAIAFDRYWAVTN-IDYIRMRTAKRXXXXXXXXXXXXXXXXXPSRFYSSRTWENVYKSVVIDGLCNINDEYFYTIFSTVGAFYMPMFLLIGIYLKIYQTARARIRK 737
            +TS +LG+LILC I GN  VVAAI+LE++LQ+V+NYLI SLAV DLMV+ LV+ ++ L ++   W LG   CD ++  DVLCC++SILHL AIA DRYWA+T  IDY++ RT +R  ++I + W +   IS+P          ++ +       C I  + +YTI+ST GAFY+P+ L++ +Y +I++ AR RIR+
Sbjct:   20 VTSFLLGALILCAIFGNACVVAAIVLERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNSWTLGQVPCDIFISLDVLCCTSSILHLCAIALDRYWAITEPIDYMKKRTPRRAAVLISVTWLVGFSISVPPMLVMRSQPGSMAEDRANPKQCKIRQDPWYTIYSTFGAFYIPLTLMLVLYGRIFKAARFRIRR 215          

HSP 2 Score: 102.834 bits (255), Expect = 4.164e-23
Identity = 57/141 (40.43%), Postives = 76/141 (53.90%), Query Frame = 3
Query: 1449 VNHNSINIKNHLNMQNFENSTISKSQLPTHGSRTDTYPKTFVTNSDFTSKKSFIEQQKQKLEHKRERKAARTLAIITGCFILCWLPFFIQALYLPFCGRQCVPNDIFSSFFLWLGYCNSLLNPIIYTIFSPEFRNAFNKIL 1871
            VN    + ++  +++  E  + S+  LP         P T  T   F S+     + K+K+   RERK  +TL II G FILCWLPFFI AL +PFC   C           WLGY NSLLNPIIY  F+ +F++AF KI+
Sbjct:  264 VNGAVKHAEDGESLEIIEVHSNSRGNLP--------LPNTPSTVPLFESRHDKATEAKRKIALARERKTVKTLGIIMGTFILCWLPFFIVALVMPFCQESCYMPRWLEDVINWLGYSNSLLNPIIYAYFNKDFQSAFKKII 396          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Medaka
Match: HTR1B (5-hydroxytryptamine receptor 1B [Source:HGNC Symbol;Acc:HGNC:5287])

HSP 1 Score: 130.568 bits (327), Expect = 6.762e-33
Identity = 86/197 (43.65%), Postives = 117/197 (59.39%), Query Frame = 3
Query:  159 SAVLGSLILCTIIGNVFVVAAIILEKNLQSVSNYLILSLAVADXXXXXXXXXXXXXXEISKQWFLGIELCDFWVCFDVLCCSASILHLVAIAFDRYWAVTN-IDYIRMRTAKRXXXXXXXXXXXXXXXXXPSRFYSSRTWENVYKSVVIDGLCNIN-DEYFYTIFSTVGAFYMPMFLLIGIYLKIYQTARARIRKHG 743
            +  L  +   T + N FV+A I   + L + +N+LI SLAV DL+V+ LVM +S L  + + W LG  +CD W+  D+ CC+ASILHL  IA DRYWA+T+ ++Y + RT  R   MI   W ++I IS+P  F+     E V         CN+N D  FYTI+ST GAFY+P  LLI +Y +IY  AR RI K  
Sbjct:   18 AVTLALITFATTLSNAFVIATIYQSRKLHTPANFLIASLAVTDLLVSILVMPISALYTVCQTWTLGQVVCDIWLSSDITCCTASILHLCVIALDRYWAITDAVEYSKKRTPARAAGMIATAWVIAISISLPPFFWRQVKAEEVTS-------CNVNTDHIFYTIYSTFGAFYIPTLLLIALYGRIYVEARKRILKQS 207          

HSP 2 Score: 93.2041 bits (230), Expect = 3.691e-20
Identity = 47/110 (42.73%), Postives = 68/110 (61.82%), Query Frame = 3
Query: 1542 SRTDTYPKTFVTNSDFTSKKSFIEQQKQKLEHKRERKAARTLAIITGCFILCWLPFFIQALYLPFCGRQCVPNDIFSSFFLWLGYCNSLLNPIIYTIFSPEFRNAFNKIL 1871
            S  DT     V+    T   + +E  K+++   RE+KA +TL II G +I+CWLPFFI  L +P C   C   ++F   F WLGY NSL+NPIIYT+ + +F+ AF+K++
Sbjct:  242 SSCDTTSSANVSQVKVTVSDALLE--KKRISAAREKKATKTLGIILGAYIICWLPFFIYTLLVPLCD-SCFHPELF-DIFTWLGYLNSLINPIIYTMSNEDFKQAFHKLI 347          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Medaka
Match: HTR1B (5-hydroxytryptamine receptor 1B [Source:HGNC Symbol;Acc:HGNC:5287])

HSP 1 Score: 129.798 bits (325), Expect = 5.335e-32
Identity = 90/204 (44.12%), Postives = 124/204 (60.78%), Query Frame = 3
Query:  138 WIHVYLTSAVLGSLI-LCTIIGNVFVVAAIILEKNLQSVSNYLILSLAVADXXXXXXXXXXXXXXEISKQWFLGIELCDFWVCFDVLCCSASILHLVAIAFDRYWAVTN-IDYIRMRTAKRXXXXXXXXXXXXXXXXXPSRFYSSRTWENVYKSVVIDGLCNIN-DEYFYTIFSTVGAFYMPMFLLIGIYLKIYQTARARIRKH 740
            W  + L  AV+ SLI L T + N FV+A I   K LQ+ +N+LI SLA+ DL+V+ LVM + +L  +   W LG  +CD W+  D+ CC+ASILHL  IA DRYWA+T+ ++Y + RT  R   M+   W ++I IS+P  F+     E +         C++N D  FYTI+ST GAFY+P  LLI +Y +IY  AR RI K 
Sbjct:   91 WYQISL--AVILSLITLATTLSNAFVIATISQSKKLQTPANFLIASLAITDLLVSILVMPICVLYTVIHTWTLGQIVCDIWLSSDITCCTASILHLCVIALDRYWAITDAVEYSKKRTPARAAGMVATAWVIAISISLPPLFWRQVKAEELTS-------CSVNTDHIFYTIYSTFGAFYIPTLLLIVLYGRIYVEARKRILKQ 285          

HSP 2 Score: 91.2781 bits (225), Expect = 3.668e-19
Identity = 42/85 (49.41%), Postives = 59/85 (69.41%), Query Frame = 3
Query: 1617 QKQKLEHKRERKAARTLAIITGCFILCWLPFFIQALYLPFCGRQCVPNDIFSSFFLWLGYCNSLLNPIIYTIFSPEFRNAFNKIL 1871
            +K+++   RERKA +TL II G +I+CWLPFFI  L +  C   C   ++F  FF WLGY NSL+NPIIYT+ + +F+ AF K++
Sbjct:  344 EKKRISAARERKATKTLGIILGAYIVCWLPFFIYTLLVATC-VACFNQELF-DFFTWLGYLNSLINPIIYTMSNEDFKKAFQKLV 426          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Medaka
Match: ENSORLT00000018283.2 (pep primary_assembly:ASM223467v1:22:9799933:9805173:-1 gene:ENSORLG00000014581.2 transcript:ENSORLT00000018283.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 124.405 bits (311), Expect = 1.600e-30
Identity = 84/194 (43.30%), Postives = 123/194 (63.40%), Query Frame = 3
Query:  159 SAVLGSLILCTIIGNVFVVAAIILEKNLQSVSNYLILSLAVADXXXXXXXXXXXXXXEISKQWFLGIELCDFWVCFDVLCCSASILHLVAIAFDRYWAVTN-IDYIRMRTAKRXXXXXXXXXXXXXXXXXPSRFYSSRTWENVYKSVVIDGLCNINDEYFYTIFSTVGAFYMPMFLLIGIYLKIYQTARARIRK 737
            S +L  + L T++ N FV+  I L + L + +N+LI SLAV DL+V+ LVM +S+L  +SK W LG  +CD W+  D+  C+ASILHL  IA DRYWA+T+ ++Y + RT +R  +M+ +VW +SI IS+P  F+            V++      D+  YT++ST GAFY+P  LLI +Y +IY  AR+RI K
Sbjct:   38 SVLLALVTLATVLSNAFVITTIFLTRKLHTPANFLIGSLAVTDLLVSILVMPISILYTVSKTWSLGQIVCDIWLSSDITFCTASILHLCVIALDRYWAITDALEYPKRRTMRRAAMMVGVVWVISISISMPPLFWRQAKAHEELTECVVN-----TDQISYTLYSTFGAFYVPTVLLIILYGRIYMAARSRILK 226          

HSP 2 Score: 96.2857 bits (238), Expect = 4.707e-21
Identity = 43/85 (50.59%), Postives = 59/85 (69.41%), Query Frame = 3
Query: 1617 QKQKLEHKRERKAARTLAIITGCFILCWLPFFIQALYLPFCGRQCVPNDIFSSFFLWLGYCNSLLNPIIYTIFSPEFRNAFNKIL 1871
            ++++L   RERKA +TL II G FI+CWLPFF+  L L  C ++C  + I    F WLGY NSL+NP+IYT F+ EF+ AF K++
Sbjct:  289 ERKRLCAARERKATKTLGIILGAFIVCWLPFFVGTLVLAIC-KECWFHPILFDLFTWLGYLNSLINPVIYTAFNDEFKQAFQKLI 372          
BLAST of 5-hydroxytryptamine receptor vs. Planmine SMEST
Match: SMESG000004643.1 (SMESG000004643.1)

HSP 1 Score: 1112.44 bits (2876), Expect = 0.000e+0
Identity = 616/616 (100.00%), Postives = 616/616 (100.00%), Query Frame = 3
Query:   57 MNVSLFEILNITKNQSLEVARFSPKHGWIHVYLTSAVLGSLILCTIIGNVFVVAAIILEKNLQSVSNYLILSLAVADXXXXXXXXXXXXXXEISKQWFLGIELCDFWVCFDVLCCSASILHLVAIAFDRYWAVTNIDYIRMRTAKRXXXXXXXXXXXXXXXXXPSRFYSSRTWENVYKSVVIDGLCNINDEYFYTIFSTVGAFYMPMFLLIGIYLKIYQTARARIRKHGFHXXXXXXXXXXXXXXXXXPFRWPKKVKFIPVKREMNSTHRYQCSSNFSQTNNYLQMKIDMQSYEISSYYGKNMSKNQVNSYDLDXXXXXXXXXXXXXXXXXXXXXXCEHINMNNQYPNVDSNMLSNSIFKQYQCKHEKDKLHFSILQSPVVLEAEFVTDPAQCLENYDEKIIWNWKETSSLNSSPRITCPNRPRHDCIEYIKKTKRKLHPQNSLSPNIHYKITGILVPDRVNLHVNHNSINIKNHLNMQNFENSTISKSQLPTHGSRTDTYPKTFVTNSDFTSKKSFIEQQKQKLEHKRERKAARTLAIITGCFILCWLPFFIQALYLPFCGRQCVPNDIFSSFFLWLGYCNSLLNPIIYTIFSPEFRNAFNKILFGRYQKTKRSY 1904
            MNVSLFEILNITKNQSLEVARFSPKHGWIHVYLTSAVLGSLILCTIIGNVFVVAAIILEKNLQSVSNYLILSLAVADLMVASLVMSVSLLSEISKQWFLGIELCDFWVCFDVLCCSASILHLVAIAFDRYWAVTNIDYIRMRTAKRIIIMIIIVWFLSIIISIPSRFYSSRTWENVYKSVVIDGLCNINDEYFYTIFSTVGAFYMPMFLLIGIYLKIYQTARARIRKHGFHKSKSKFNNSFFNSIKKFPFRWPKKVKFIPVKREMNSTHRYQCSSNFSQTNNYLQMKIDMQSYEISSYYGKNMSKNQVNSYDLDSVNQSSCDPQSSSSSHKYCNSSCEHINMNNQYPNVDSNMLSNSIFKQYQCKHEKDKLHFSILQSPVVLEAEFVTDPAQCLENYDEKIIWNWKETSSLNSSPRITCPNRPRHDCIEYIKKTKRKLHPQNSLSPNIHYKITGILVPDRVNLHVNHNSINIKNHLNMQNFENSTISKSQLPTHGSRTDTYPKTFVTNSDFTSKKSFIEQQKQKLEHKRERKAARTLAIITGCFILCWLPFFIQALYLPFCGRQCVPNDIFSSFFLWLGYCNSLLNPIIYTIFSPEFRNAFNKILFGRYQKTKRSY
Sbjct:    1 MNVSLFEILNITKNQSLEVARFSPKHGWIHVYLTSAVLGSLILCTIIGNVFVVAAIILEKNLQSVSNYLILSLAVADLMVASLVMSVSLLSEISKQWFLGIELCDFWVCFDVLCCSASILHLVAIAFDRYWAVTNIDYIRMRTAKRIIIMIIIVWFLSIIISIPSRFYSSRTWENVYKSVVIDGLCNINDEYFYTIFSTVGAFYMPMFLLIGIYLKIYQTARARIRKHGFHKSKSKFNNSFFNSIKKFPFRWPKKVKFIPVKREMNSTHRYQCSSNFSQTNNYLQMKIDMQSYEISSYYGKNMSKNQVNSYDLDSVNQSSCDPQSSSSSHKYCNSSCEHINMNNQYPNVDSNMLSNSIFKQYQCKHEKDKLHFSILQSPVVLEAEFVTDPAQCLENYDEKIIWNWKETSSLNSSPRITCPNRPRHDCIEYIKKTKRKLHPQNSLSPNIHYKITGILVPDRVNLHVNHNSINIKNHLNMQNFENSTISKSQLPTHGSRTDTYPKTFVTNSDFTSKKSFIEQQKQKLEHKRERKAARTLAIITGCFILCWLPFFIQALYLPFCGRQCVPNDIFSSFFLWLGYCNSLLNPIIYTIFSPEFRNAFNKILFGRYQKTKRSY 616          
BLAST of 5-hydroxytryptamine receptor vs. Planmine SMEST
Match: SMESG000008878.1 (SMESG000008878.1)

HSP 1 Score: 258.455 bits (659), Expect = 2.489e-78
Identity = 145/212 (68.40%), Postives = 174/212 (82.08%), Query Frame = 3
Query:  111 VARFSPKHGWIHVYLTSAVLGSLILCTIIGNVFVVAAIILEKNLQSVSNYLILSLAVADXXXXXXXXXXXXXXEISKQWFLGIELCDFWVCFDVLCCSASILHLVAIAFDRYWAVTNIDYIRMRTAKRXXXXXXXXXXXXXXXXXPSRFYSSRTWENVYKSVVIDGLCNINDEYFYTIFSTVGAFYMPMFLLIGIYLKIYQTARARIRKHGF 746
            V+ F PK+GW H+Y+TS VL  LILCT+IGN FV+AAI+LEKNL +VSNYLI+SLAVADLMVASLVMS+S+  EIS+ WFLG+E+CD WVCFDVLCCSASILHLVAIA DRY AVT  DY+R RTAKRI IMI I+W LSI+IS+P+RF+ +R +    + VV DG C INDE  +T+FST GAFY+PMF +IGIY +IYQ ARARIR+  F
Sbjct:   18 VSTFRPKYGWTHIYITSGVLVVLILCTVIGNSFVIAAILLEKNLLNVSNYLIISLAVADLMVASLVMSLSVFHEISEAWFLGLEICDLWVCFDVLCCSASILHLVAIAIDRYMAVTKPDYVRTRTAKRIYIMIAIIWLLSIMISVPTRFHLNRNYTKEMQRVVYDGKCLINDEIGFTVFSTFGAFYLPMFFIIGIYTRIYQVARARIRRQAF 229          

HSP 2 Score: 157.532 bits (397), Expect = 2.768e-41
Identity = 70/101 (69.31%), Postives = 83/101 (82.18%), Query Frame = 3
Query: 1581 SDFTSKKSFIEQQKQKLEHKRERKAARTLAIITGCFILCWLPFFIQALYLPFCGRQCVPNDIFSSFFLWLGYCNSLLNPIIYTIFSPEFRNAFNKILFGRY 1883
            S   S+   +E ++QKLE KRERKA RTLAIITGCFI+CW PFFIQA  +PFCG++C    + SSF LWLGYCNSLLNP+IYTIFSP+FR+AF+KILFGRY
Sbjct:  393 SRMMSQSERMEYKRQKLEQKRERKAVRTLAIITGCFIVCWQPFFIQATIVPFCGKKCQLPPLLSSFVLWLGYCNSLLNPVIYTIFSPDFRDAFHKILFGRY 493          
BLAST of 5-hydroxytryptamine receptor vs. Planmine SMEST
Match: SMESG000008878.1 (SMESG000008878.1)

HSP 1 Score: 258.84 bits (660), Expect = 2.781e-78
Identity = 145/212 (68.40%), Postives = 174/212 (82.08%), Query Frame = 3
Query:  111 VARFSPKHGWIHVYLTSAVLGSLILCTIIGNVFVVAAIILEKNLQSVSNYLILSLAVADXXXXXXXXXXXXXXEISKQWFLGIELCDFWVCFDVLCCSASILHLVAIAFDRYWAVTNIDYIRMRTAKRXXXXXXXXXXXXXXXXXPSRFYSSRTWENVYKSVVIDGLCNINDEYFYTIFSTVGAFYMPMFLLIGIYLKIYQTARARIRKHGF 746
            V+ F PK+GW H+Y+TS VL  LILCT+IGN FV+AAI+LEKNL +VSNYLI+SLAVADLMVASLVMS+S+  EIS+ WFLG+E+CD WVCFDVLCCSASILHLVAIA DRY AVT  DY+R RTAKRI IMI I+W LSI+IS+P+RF+ +R +    + VV DG C INDE  +T+FST GAFY+PMF +IGIY +IYQ ARARIR+  F
Sbjct:   32 VSTFRPKYGWTHIYITSGVLVVLILCTVIGNSFVIAAILLEKNLLNVSNYLIISLAVADLMVASLVMSLSVFHEISEAWFLGLEICDLWVCFDVLCCSASILHLVAIAIDRYMAVTKPDYVRTRTAKRIYIMIAIIWLLSIMISVPTRFHLNRNYTKEMQRVVYDGKCLINDEIGFTVFSTFGAFYLPMFFIIGIYTRIYQVARARIRRQAF 243          

HSP 2 Score: 157.532 bits (397), Expect = 3.480e-41
Identity = 70/101 (69.31%), Postives = 83/101 (82.18%), Query Frame = 3
Query: 1581 SDFTSKKSFIEQQKQKLEHKRERKAARTLAIITGCFILCWLPFFIQALYLPFCGRQCVPNDIFSSFFLWLGYCNSLLNPIIYTIFSPEFRNAFNKILFGRY 1883
            S   S+   +E ++QKLE KRERKA RTLAIITGCFI+CW PFFIQA  +PFCG++C    + SSF LWLGYCNSLLNP+IYTIFSP+FR+AF+KILFGRY
Sbjct:  407 SRMMSQSERMEYKRQKLEQKRERKAVRTLAIITGCFIVCWQPFFIQATIVPFCGKKCQLPPLLSSFVLWLGYCNSLLNPVIYTIFSPDFRDAFHKILFGRY 507          
BLAST of 5-hydroxytryptamine receptor vs. Planmine SMEST
Match: SMESG000019254.1 (SMESG000019254.1)

HSP 1 Score: 222.631 bits (566), Expect = 8.239e-65
Identity = 133/224 (59.38%), Postives = 173/224 (77.23%), Query Frame = 3
Query:   63 VSLFEILNITKNQSLEVARFSPKHGWIHVYLTSAVLGSLILCTIIGNVFVVAAIILEKNLQSVSNYLILSLAVADXXXXXXXXXXXXXXEISKQWFLGIELCDFWVCFDVLCCSASILHLVAIAFDRYWAVTNIDYIRMRTAKRXXXXXXXXXXXXXXXXXPSRFYSSRTWENVYKSVVIDGLCNINDEYFYTIFSTVGAFYMPMFLLIGIYLKIYQTARARIR 734
            V  +E  N+T++Q   +ARFSP+  WI  Y+T+  LG++IL TIIGNVFVVAAI+LE+ L++VSNYLILSLAVADLMVA LVM +S + E+S  W+LGIELCD W CFDVL C+ASILHLV IA DRYWAVT+I+Y+  RT+ RII+MII VW +S+IIS+PSRF++ R     +  V+++G C IN+   YT+FS +GAFY+PM  +  IYL+IY  AR+RIR
Sbjct:    2 VLFYEYENVTESQ---IARFSPRLSWIQFYITALFLGAIILWTIIGNVFVVAAIVLERTLKNVSNYLILSLAVADLMVAILVMPISAIKEVSSTWWLGIELCDLWTCFDVLSCTASILHLVVIAIDRYWAVTDINYLHRRTSSRIILMIIGVWLISVIISVPSRFHTHRN-NAEWLRVIVNGSCIINESVSYTVFSNLGAFYLPMAFMSVIYLRIYIFARSRIR 221          

HSP 2 Score: 122.479 bits (306), Expect = 3.221e-29
Identity = 57/93 (61.29%), Postives = 68/93 (73.12%), Query Frame = 3
Query: 1620 KQKLEHKRERKAARTLAIITGCFILCWLPFFIQALYLPFCGRQCVPNDIFSSFFLWLGYCNSLLNPIIYTIFSPEFRNAFNKILFGRYQKTKR 1898
            + K+E KRERKAARTLAIITGCFI+CWLPF I  +   FC  +   + +F S  LWLGY NS LNP+IYT+FSP+FR AF KIL G Y  T+R
Sbjct:  418 RNKVEQKRERKAARTLAIITGCFIICWLPFGINNVAHAFCNTEPCGSALFDSLCLWLGYVNSGLNPVIYTVFSPDFRTAFRKILLGHYH-TRR 509          
BLAST of 5-hydroxytryptamine receptor vs. Planmine SMEST
Match: SMESG000010648.1 (SMESG000010648.1)

HSP 1 Score: 202.986 bits (515), Expect = 2.058e-56
Identity = 121/215 (56.28%), Postives = 160/215 (74.42%), Query Frame = 3
Query:  105 LEVARFSPKHGWIHVYLTSAVLGSLILCTIIGNVFVVAAIILEKNLQSVSNYLILSLAVADXXXXXXXXXXXXXXEISKQWFLGIELCDFWVCFDVLCCSASILHLVAIAFDRYWAVTNIDYIRMRTAKRXXXXXXX--XXXXXXXXXXPSRFYSSRTWENVYKSVVIDGLCNINDEYFYTIFSTVGAFYMPMFLLIGIYLKIYQTARARIRKHG 743
            + V  FSP+  W+HV+    +L  LIL TIIGNVFVVAAIILEKNLQSVSNYLILSLAVADLMVA LVM +S+++EIS  W++G+ LCD W+ FDVLCC+AS+LHLVAIA DRYWAVT I++IR ++  R  I+I+I  VW +SI+ISIPSRF+  R      +    DG+C +N  + Y I + +GAF++PM +++ IY++IY  A+ +IRK  
Sbjct:    5 ITVPIFSPRFSWLHVWTCGPILVMLILWTIIGNVFVVAAIILEKNLQSVSNYLILSLAVADLMVAVLVMPISVINEISSSWWMGMSLCDIWIFFDVLCCTASVLHLVAIAIDRYWAVTQINFIRKKSGARKQILIMIFCVWSVSIVISIPSRFHGHRNQFLTSE----DGVCRMNTNHTYIIVANIGAFFLPMLIMVAIYIRIYVFAKRQIRKRS 215          

HSP 2 Score: 115.161 bits (287), Expect = 1.609e-26
Identity = 58/106 (54.72%), Postives = 71/106 (66.98%), Query Frame = 3
Query: 1614 QQKQKLEHKRERKAARTLAIITGCFILCWLPFFIQALYLPFCGRQCVPND---------IFSSFFLWLGYCNSLLNPIIYTIFSPEFRNAFNKILFGR-YQKTKRS 1901
            + + K+E +RERKAARTLAIITGCF++CWLPF  Q +          PN+         +  SF LWLGY NS LNPIIYT+FSP+FR +F KILFGR Y + KRS
Sbjct:  537 RSRIKIEQRRERKAARTLAIITGCFLICWLPFATQNMINLISDS---PNNTNHTSYKALLIDSFILWLGYTNSCLNPIIYTVFSPDFRRSFRKILFGRYYHRGKRS 639          
The following BLAST results are available for this feature:
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HTR1A1.299e-4047.455-hydroxytryptamine receptor 1A [Source:HGNC Symbo... [more]
HTR1B1.437e-3344.565-hydroxytryptamine receptor 1B [Source:HGNC Symbo... [more]
HTR1D4.965e-2943.755-hydroxytryptamine receptor 1D [Source:HGNC Symbo... [more]
HTR1E7.564e-2846.115-hydroxytryptamine receptor 1E [Source:HGNC Symbo... [more]
HTR1F1.987e-2643.755-hydroxytryptamine receptor 1F [Source:HGNC Symbo... [more]
back to top
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ser-49.012e-3441.79SERotonin/octopamine receptor family; Serotonin re... [more]
ser-49.012e-3441.79SERotonin/octopamine receptor family; Serotonin re... [more]
ser-28.531e-2638.69Tyramine receptor Ser-2 [Source:UniProtKB/Swiss-P... [more]
ser-28.587e-2638.69Tyramine receptor Ser-2 [Source:UniProtKB/Swiss-P... [more]
ser-29.306e-2638.69Tyramine receptor Ser-2 [Source:UniProtKB/Swiss-P... [more]
back to top
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
5-HT1A5.665e-4553.09gene:FBgn0004168 transcript:FBtr0086577[more]
5-HT1A7.016e-4553.09gene:FBgn0004168 transcript:FBtr0474126[more]
5-HT1B1.879e-4351.22gene:FBgn0263116 transcript:FBtr0330055[more]
5-HT1B4.231e-4351.22gene:FBgn0263116 transcript:FBtr0086599[more]
5-HT1B4.710e-4351.22gene:FBgn0263116 transcript:FBtr0330056[more]
back to top
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
htr1ab6.570e-4047.185-hydroxytryptamine (serotonin) receptor 1A b [Sou... [more]
htr1aa4.755e-3947.455-hydroxytryptamine (serotonin) receptor 1A a [Sou... [more]
htr1ab1.396e-3848.215-hydroxytryptamine (serotonin) receptor 1A b [Sou... [more]
htr1ab1.396e-3848.215-hydroxytryptamine (serotonin) receptor 1A b [Sou... [more]
htr1b1.565e-3641.855-hydroxytryptamine (serotonin) receptor 1B [Sourc... [more]
back to top
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000046867.13.766e-3948.725-hydroxytryptamine (serotonin) receptor 1A, G pro... [more]
HTR1D1.473e-3143.355-hydroxytryptamine receptor 1D [Source:HGNC Symbo... [more]
HTR1B2.383e-3142.935-hydroxytryptamine receptor 1B [Source:HGNC Symbo... [more]
adra2c4.109e-2940.91adrenoceptor alpha 2C [Source:NCBI gene;Acc:100145... [more]
HTR1E1.897e-2843.725-hydroxytryptamine (serotonin) receptor 1E, G pro... [more]
back to top
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Htr1a2.117e-4047.965-hydroxytryptamine (serotonin) receptor 1A [Sourc... [more]
Htr1b1.832e-3146.415-hydroxytryptamine (serotonin) receptor 1B [Sourc... [more]
Htr1b1.832e-3146.415-hydroxytryptamine (serotonin) receptor 1B [Sourc... [more]
Htr1f5.858e-2844.625-hydroxytryptamine (serotonin) receptor 1F [Sourc... [more]
Htr1d1.255e-2744.745-hydroxytryptamine (serotonin) receptor 1D [Sourc... [more]
back to top
BLAST of 5-hydroxytryptamine receptor vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q25414|5HTR_LYMST5.620e-5558.425-hydroxytryptamine receptor OS=Lymnaea stagnalis ... [more]
sp|P28285|5HT2A_DROME5.679e-4453.095-hydroxytryptamine receptor 2A OS=Drosophila mela... [more]
sp|P28286|5HT2B_DROME4.241e-4251.225-hydroxytryptamine receptor 2B OS=Drosophila mela... [more]
sp|Q25190|5HTR_HELVI1.187e-4147.205-hydroxytryptamine receptor OS=Heliothis virescen... [more]
sp|O42385|5H1AA_TAKRU2.404e-4048.475-hydroxytryptamine receptor 1A-alpha OS=Takifugu ... [more]
back to top
BLAST of 5-hydroxytryptamine receptor vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A193KUQ40.000e+099.84GCR083 OS=Schmidtea mediterranea OX=79327 GN=gcr08... [more]
G7YNE63.629e-6463.685-hydroxytryptamine receptor 1 OS=Clonorchis sinen... [more]
A0A4S2LW701.068e-6363.21G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A4E0S3461.670e-6259.485-hydroxytryptamine receptor OS=Fasciola hepatica ... [more]
A0A183AJS08.152e-6260.91G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
back to top
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
htr1ab9.542e-4046.155-hydroxytryptamine (serotonin) receptor 1A b [Sou... [more]
HTR1B1.410e-3342.505-hydroxytryptamine receptor 1B [Source:NCBI gene;... [more]
ENSAMXT00000006138.25.360e-3346.45pep primary_assembly:Astyanax_mexicanus-2.0:6:2799... [more]
ENSAMXT00000026144.21.033e-3044.39pep primary_assembly:Astyanax_mexicanus-2.0:9:1435... [more]
htr1b1.086e-3044.515-hydroxytryptamine (serotonin) receptor 1B [Sourc... [more]
back to top
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000001357.11.464e-4349.49pep scaffold:Pmarinus_7.0:GL478256:17157:19157:1 g... [more]
ENSPMAT00000009127.13.746e-4047.00pep scaffold:Pmarinus_7.0:GL478629:43196:44446:-1 ... [more]
HTR1F3.123e-3044.575-hydroxytryptamine receptor 1F [Source:HGNC Symbo... [more]
ENSPMAT00000008360.19.891e-2335.82pep scaffold:Pmarinus_7.0:GL477173:168532:170490:1... [more]
chrm5b4.075e-2133.33cholinergic receptor, muscarinic 5b [Source:ZFIN;A... [more]
back to top
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO354502.892e-1634.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO318901.213e-1535.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO476198.568e-1529.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO476991.886e-1427.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO486901.014e-1344.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000005282.21.501e-4148.98pep primary_assembly:ASM223467v1:9:8571029:8576106... [more]
htr1ab1.424e-4046.435-hydroxytryptamine (serotonin) receptor 1A b [Sou... [more]
HTR1B6.762e-3343.655-hydroxytryptamine receptor 1B [Source:HGNC Symbo... [more]
HTR1B5.335e-3244.125-hydroxytryptamine receptor 1B [Source:HGNC Symbo... [more]
ENSORLT00000018283.21.600e-3043.30pep primary_assembly:ASM223467v1:22:9799933:980517... [more]
back to top
BLAST of 5-hydroxytryptamine receptor vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000004643.10.000e+0100.00SMESG000004643.1[more]
SMESG000008878.12.489e-7868.40SMESG000008878.1[more]
SMESG000008878.12.781e-7868.40SMESG000008878.1[more]
SMESG000019254.18.239e-6559.38SMESG000019254.1[more]
SMESG000010648.12.058e-5656.28SMESG000010648.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011836 ID=SMED30011836|Name=5-hydroxytryptamine receptor|organism=Schmidtea mediterranea sexual|type=transcript|length=1968bp
ATTATGGAATAAAAATGCACATCACAAATTACAATGCTAAAATTTCCTAG
AAAAAAATGAACGTTTCTCTATTTGAAATTCTTAATATAACAAAAAACCA
ATCATTGGAAGTTGCGAGATTCTCTCCTAAACATGGTTGGATTCATGTTT
ATTTGACATCTGCCGTGCTCGGCTCTCTTATTTTATGCACTATAATTGGA
AATGTTTTTGTCGTTGCTGCCATAATTTTAGAAAAGAATCTTCAAAGCGT
ATCAAATTATCTTATTCTCAGCCTTGCCGTTGCAGATCTGATGGTGGCAT
CCTTAGTTATGTCAGTTAGTCTTTTAAGCGAGATTTCTAAACAGTGGTTT
TTAGGAATAGAGCTATGCGATTTTTGGGTTTGTTTTGATGTGCTCTGTTG
TTCGGCTTCGATTCTTCACTTAGTTGCAATAGCATTTGATAGATATTGGG
CCGTCACCAATATAGACTATATCAGAATGAGGACGGCTAAACGAATTATT
ATAATGATTATAATTGTTTGGTTCCTCTCTATTATTATTTCCATTCCTTC
TCGTTTCTATTCAAGTCGGACATGGGAAAATGTCTACAAAAGTGTTGTAA
TTGATGGATTGTGTAACATAAATGATGAATATTTCTATACGATTTTCTCA
ACTGTCGGTGCTTTTTATATGCCAATGTTTCTTTTGATTGGTATTTATTT
AAAGATTTATCAAACAGCTCGAGCAAGAATTCGGAAACATGGCTTCCATA
AATCCAAGTCAAAATTCAACAACAGTTTTTTTAACAGTATTAAAAAATTC
CCATTTCGATGGCCGAAAAAAGTGAAATTTATCCCAGTAAAGAGAGAAAT
GAATAGTACTCATCGTTATCAATGCAGCTCTAACTTTAGTCAAACAAACA
ATTATCTTCAAATGAAAATAGACATGCAATCATACGAAATCTCCTCATAT
TATGGGAAAAATATGTCGAAAAATCAGGTAAACTCATATGATTTAGATTC
AGTGAATCAAAGTTCATGTGATCCTCAATCAAGCTCATCCTCACATAAAT
ATTGCAACTCAAGTTGTGAGCACATAAATATGAACAACCAGTATCCAAAT
GTTGATTCGAATATGTTATCAAATAGCATCTTCAAACAATACCAGTGCAA
ACATGAGAAGGATAAACTCCATTTTTCTATTTTACAATCTCCAGTGGTTT
TGGAGGCTGAGTTTGTTACTGATCCAGCTCAGTGTCTAGAAAACTATGAC
GAAAAAATCATTTGGAATTGGAAGGAAACAAGTAGTCTCAACAGTTCTCC
GAGAATTACTTGCCCTAATCGACCAAGACATGATTGCATAGAATATATAA
AGAAAACCAAAAGAAAACTCCATCCGCAGAACTCACTGAGTCCGAATATT
CATTACAAAATCACAGGAATATTAGTTCCGGATAGAGTAAACTTGCATGT
GAACCATAACTCAATAAACATCAAAAATCATTTAAACATGCAAAATTTTG
AAAATAGCACAATTAGCAAATCTCAATTACCAACTCATGGTTCTCGTACA
GACACATATCCGAAAACTTTTGTAACAAACAGTGATTTTACCTCAAAGAA
ATCCTTTATTGAACAACAGAAACAGAAACTGGAACACAAACGTGAAAGAA
AAGCCGCTCGGACACTGGCAATAATTACAGGTTGTTTCATCCTCTGTTGG
TTGCCATTTTTCATTCAAGCGTTGTACTTGCCGTTTTGCGGACGTCAATG
TGTTCCAAATGATATCTTTAGCTCGTTTTTTCTATGGCTTGGATATTGTA
ATTCTCTTTTGAATCCTATAATTTACACAATCTTTTCTCCAGAATTCAGA
AATGCATTTAATAAAATTCTTTTCGGTCGATATCAAAAAACCAAAAGAAG
TTACTAGTAACAAAACAAAAAAAAATAATTGCAGAAAAATATAGAATTTA
TATTCTTTTAAAAAAAAA
back to top

protein sequence of SMED30011836-orf-1

>SMED30011836-orf-1 ID=SMED30011836-orf-1|Name=SMED30011836-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=617bp
MNVSLFEILNITKNQSLEVARFSPKHGWIHVYLTSAVLGSLILCTIIGNV
FVVAAIILEKNLQSVSNYLILSLAVADLMVASLVMSVSLLSEISKQWFLG
IELCDFWVCFDVLCCSASILHLVAIAFDRYWAVTNIDYIRMRTAKRIIIM
IIIVWFLSIIISIPSRFYSSRTWENVYKSVVIDGLCNINDEYFYTIFSTV
GAFYMPMFLLIGIYLKIYQTARARIRKHGFHKSKSKFNNSFFNSIKKFPF
RWPKKVKFIPVKREMNSTHRYQCSSNFSQTNNYLQMKIDMQSYEISSYYG
KNMSKNQVNSYDLDSVNQSSCDPQSSSSSHKYCNSSCEHINMNNQYPNVD
SNMLSNSIFKQYQCKHEKDKLHFSILQSPVVLEAEFVTDPAQCLENYDEK
IIWNWKETSSLNSSPRITCPNRPRHDCIEYIKKTKRKLHPQNSLSPNIHY
KITGILVPDRVNLHVNHNSINIKNHLNMQNFENSTISKSQLPTHGSRTDT
YPKTFVTNSDFTSKKSFIEQQKQKLEHKRERKAARTLAIITGCFILCWLP
FFIQALYLPFCGRQCVPNDIFSSFFLWLGYCNSLLNPIIYTIFSPEFRNA
FNKILFGRYQKTKRSY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000418head
PLANA:0002056medial muscle cell
PLANA:0003001lateral region of the whole animal
PLANA:0003104enteric muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR000276GPCR_Rhodpsn
IPR017452GPCR_Rhodpsn_7TM
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
GO:0004871signal transducer activity
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
GO:0007165signal transduction
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 515..535
NoneNo IPR availableGENE3DG3DSA:1.20.120.10coord: 468..521
e-value: 1.2E-35
score: 125.4
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 522..604
e-value: 1.2E-35
score: 125.4
NoneNo IPR availablePANTHERPTHR242475-HYDROXYTRYPTAMINE RECEPTORcoord: 30..610
NoneNo IPR availablePANTHERPTHR24247:SF1985-HYDROXYTRYPTAMINE RECEPTOR 2A-RELATEDcoord: 30..610
NoneNo IPR availableCDDcd153317tmA_5-HT1A_invertebratescoord: 528..601
e-value: 6.43379E-37
score: 136.33
NoneNo IPR availableCDDcd153317tmA_5-HT1A_invertebratescoord: 32..227
e-value: 1.07693E-96
score: 294.647
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 26..614
NoneNo IPR availableTMHMMTMhelixcoord: 65..87
NoneNo IPR availableTMHMMTMhelixcoord: 536..558
NoneNo IPR availableTMHMMTMhelixcoord: 36..58
NoneNo IPR availableTMHMMTMhelixcoord: 573..595
NoneNo IPR availableTMHMMTMhelixcoord: 147..169
NoneNo IPR availableTMHMMTMhelixcoord: 107..126
NoneNo IPR availableTMHMMTMhelixcoord: 193..215
IPR000276G protein-coupled receptor, rhodopsin-likePRINTSPR00237GPCRRHODOPSNcoord: 33..57
score: 25.91
coord: 111..133
score: 38.62
coord: 195..218
score: 23.05
coord: 66..87
score: 35.77
coord: 146..167
score: 25.07
coord: 572..598
score: 37.36
coord: 533..557
score: 35.54
IPR000276G protein-coupled receptor, rhodopsin-likeSMARTSM013817TM_GPCR_Srsx_2coord: 42..605
e-value: 0.0024
score: -60.3
IPR000276G protein-coupled receptor, rhodopsin-likePFAMPF000017tm_1coord: 48..590
e-value: 2.4E-70
score: 236.9
IPR000276G protein-coupled receptor, rhodopsin-likePROSITEPS00237G_PROTEIN_RECEP_F1_1coord: 117..133
IPR017452GPCR, rhodopsin-like, 7TMPROSITEPS50262G_PROTEIN_RECEP_F1_2coord: 48..590
score: 37.062