Mitochondrial ribosomal protein S6

Overview
NameMitochondrial ribosomal protein S6
Smed IDSMED30011835
Length (bp)638
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Mitochondrial ribosomal protein S6 (SMED30011835) t-SNE clustered cells

Violin plots show distribution of expression levels for Mitochondrial ribosomal protein S6 (SMED30011835) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Mitochondrial ribosomal protein S6 (SMED30011835) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Mitochondrial ribosomal protein S6 (SMED30011835) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011835

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30011835SMESG000049504.1 SmedASXL_019197SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30011835SMESG000049504.1 dd_Smed_v4_4442_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30011835SMESG000049504.1 dd_Smed_v4_4442_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30011835SMESG000049504.1 dd_Smed_v4_4442_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30011835SMESG000049504.1 dd_Smed_v4_4442_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30011835SMESG000049504.1 dd_Smed_v4_4442_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30011835SMESG000049504.1 dd_Smed_v4_4442_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Mitochondrial ribosomal protein S6 vs. Ensembl Human
Match: MRPS6 (mitochondrial ribosomal protein S6 [Source:HGNC Symbol;Acc:HGNC:14051])

HSP 1 Score: 66.2402 bits (160), Expect = 1.516e-13
Identity = 34/107 (31.78%), Postives = 62/107 (57.94%), Query Frame = 3
Query:   54 MVLYEWVIVLKKMPRAQMAETLKSSFLMIMDNGGVIKDVKNLGLKRLPFKMNRYFEPYVNYDGHYFVVDIEGKPTIGKTIQENLSESKDFLKHNIFK--VQEYIKPC 368
            M  YE  ++LK M R + A TLK +   +MD G +++D++NLG + LP++++ + + +    G YF+VD        +++ E+LS   D ++ NI K  + + +K C
Sbjct:    1 MPRYELALILKAMQRPETAATLKRTIEALMDRGAIVRDLENLGERALPYRISAHSQQHNR--GGYFLVDFYAPTAAVESMVEHLSRDIDVIRGNIVKHPLTQELKEC 105          
BLAST of Mitochondrial ribosomal protein S6 vs. Ensembl Fly
Match: mRpS6 (gene:FBgn0035534 transcript:FBtr0073288)

HSP 1 Score: 65.855 bits (159), Expect = 1.447e-13
Identity = 33/106 (31.13%), Postives = 61/106 (57.55%), Query Frame = 3
Query:   54 MVLYEWVIVLKKMPRAQMAETLKSSFLMIMDNGGVIKDVKNLGLKRLPFKMNRYFEPYVNYDGHYFVVDIEGKPTIGKTIQENLSESKDFLKHNIFKVQE-YIKPC 368
            M  YE  +VL+++PR ++   ++ +   I+D GG+I+ ++NLG + LP K++ +    V+ +G +F +  +  PT    ++E      D ++  IFKV+E   KPC
Sbjct:    1 MPSYELALVLRQLPRPELISVIRRTAESILDKGGIIRKLENLGSRALPHKVSEHG--VVHREGTHFTIAFDTAPTKIADLKEEFGRDIDIIRRYIFKVEEPEQKPC 104          
BLAST of Mitochondrial ribosomal protein S6 vs. Ensembl Fly
Match: mRpS6 (gene:FBgn0035534 transcript:FBtr0306093)

HSP 1 Score: 65.855 bits (159), Expect = 1.447e-13
Identity = 33/106 (31.13%), Postives = 61/106 (57.55%), Query Frame = 3
Query:   54 MVLYEWVIVLKKMPRAQMAETLKSSFLMIMDNGGVIKDVKNLGLKRLPFKMNRYFEPYVNYDGHYFVVDIEGKPTIGKTIQENLSESKDFLKHNIFKVQE-YIKPC 368
            M  YE  +VL+++PR ++   ++ +   I+D GG+I+ ++NLG + LP K++ +    V+ +G +F +  +  PT    ++E      D ++  IFKV+E   KPC
Sbjct:    1 MPSYELALVLRQLPRPELISVIRRTAESILDKGGIIRKLENLGSRALPHKVSEHG--VVHREGTHFTIAFDTAPTKIADLKEEFGRDIDIIRRYIFKVEEPEQKPC 104          
BLAST of Mitochondrial ribosomal protein S6 vs. Ensembl Zebrafish
Match: mrps6 (mitochondrial ribosomal protein S6 [Source:ZFIN;Acc:ZDB-GENE-060825-59])

HSP 1 Score: 55.4546 bits (132), Expect = 7.908e-10
Identity = 28/97 (28.87%), Postives = 51/97 (52.58%), Query Frame = 3
Query:   54 MVLYEWVIVLKKMPRAQMAETLKSSFLMIMDNGGVIKDVKNLGLKRLPFKMNRYFEPYVNYDGHYFVVDIEGKPTIGKTIQENLSESKDFLKHNIFK 344
            M  YE  +VLK M R + A  L+ +   + + G V++ ++NLG ++LP+K++++     +  G YF +D    P I   +  +L    D L+  + K
Sbjct:    1 MPRYELYMVLKAMQRPETAAVLRRTVETLFERGAVVRSLENLGERKLPYKISKHDSRQSH--GGYFSIDFHASPNIVSGLLNHLERDVDVLRPTVVK 95          
BLAST of Mitochondrial ribosomal protein S6 vs. Ensembl Xenopus
Match: mrps6 (mitochondrial ribosomal protein S6 [Source:NCBI gene;Acc:100038272])

HSP 1 Score: 63.1586 bits (152), Expect = 1.864e-12
Identity = 31/96 (32.29%), Postives = 56/96 (58.33%), Query Frame = 3
Query:   54 MVLYEWVIVLKKMPRAQMAETLKSSFLMIMDNGGVIKDVKNLGLKRLPFKMNRYFEPYVNYDGHYFVVDIEGKPTIGKTIQENLSESKDFLKHNIF 341
            M  YE  ++LK M R + A TLK +   + + G V+++++NLG K LP+K++++   +    G YF++D    PTI  ++ ++LS   D ++  I 
Sbjct:    1 MPRYEMALILKAMQRPETAATLKRTIEALFEGGAVVRNLENLGEKALPYKISKHNLRHTR--GGYFLIDFHAPPTIIPSMLDHLSRDIDVIRPTIL 94          
BLAST of Mitochondrial ribosomal protein S6 vs. Ensembl Xenopus
Match: mrps6 (mitochondrial ribosomal protein S6 [Source:NCBI gene;Acc:100038272])

HSP 1 Score: 51.2174 bits (121), Expect = 4.898e-8
Identity = 27/96 (28.12%), Postives = 54/96 (56.25%), Query Frame = 3
Query:   54 MVLYEWVIVLKKMPRAQMAETLKSSFLMIMDNGGVIKDVKNLGLKRLPFKMNRYFEPYVNYDGHYFVVDIEGKPTIGKTIQENLSESKDFLKHNIF 341
            ++LY   I+     + + A TLK +   + + G V+++++NLG K LP+K++++   +    G YF++D    PTI  ++ ++LS   D ++  I 
Sbjct:    1 VLLYPMSII-----KPETAATLKRTIEALFEGGAVVRNLENLGEKALPYKISKHNLRHTR--GGYFLIDFHAPPTIIPSMLDHLSRDIDVIRPTIL 89          
BLAST of Mitochondrial ribosomal protein S6 vs. Ensembl Mouse
Match: Mrps6 (mitochondrial ribosomal protein S6 [Source:MGI Symbol;Acc:MGI:2153111])

HSP 1 Score: 60.8474 bits (146), Expect = 1.017e-11
Identity = 31/107 (28.97%), Postives = 61/107 (57.01%), Query Frame = 3
Query:   54 MVLYEWVIVLKKMPRAQMAETLKSSFLMIMDNGGVIKDVKNLGLKRLPFKMNRYFEPYVNYDGHYFVVDIEGKPTIGKTIQENLSESKDFLKHNIFK--VQEYIKPC 368
            M  YE  ++LK M R + A  LK +   +MD G +++++++LG + LP++++ + + +    G YF+VD     +  + I E+L+   D ++ NI K  + + +K C
Sbjct:    1 MPRYELALILKAMRRPETAAALKRTIESLMDRGAIVRNLESLGERALPYRISSHSQQHSR--GGYFLVDFYAPTSAVENILEHLARDIDVVRPNIVKHPLTQEVKEC 105          
BLAST of Mitochondrial ribosomal protein S6 vs. Ensembl Mouse
Match: Gm49711 (predicted gene, 49711 [Source:MGI Symbol;Acc:MGI:6215179])

HSP 1 Score: 45.0542 bits (105), Expect = 6.389e-6
Identity = 17/56 (30.36%), Postives = 36/56 (64.29%), Query Frame = 3
Query:   54 MVLYEWVIVLKKMPRAQMAETLKSSFLMIMDNGGVIKDVKNLGLKRLPFKMNRYFE 221
            M  YE  ++LK M R + A  LK +   +MD G +++++++LG + LP++++ + +
Sbjct:    1 MPRYELALILKAMRRPETAAALKRTIESLMDRGAIVRNLESLGERALPYRISSHSQ 56          
BLAST of Mitochondrial ribosomal protein S6 vs. UniProt/SwissProt
Match: sp|P82931|RT06_BOVIN (28S ribosomal protein S6, mitochondrial OS=Bos taurus OX=9913 GN=MRPS6 PE=1 SV=4)

HSP 1 Score: 70.0922 bits (170), Expect = 2.801e-14
Identity = 36/107 (33.64%), Postives = 60/107 (56.07%), Query Frame = 3
Query:   54 MVLYEWVIVLKKMPRAQMAETLKSSFLMIMDNGGVIKDVKNLGLKRLPFKMNRYFEPYVNYDGHYFVVDIEGKPTIGKTIQENLSESKDFLKHNIFK--VQEYIKPC 368
            M  YE  ++LK M R + A  LK +   +MD G V++ ++NLG + LP+KM+ + + +    G YF+VD     T   +I E+LS   D ++ N+ K  + + +K C
Sbjct:    1 MPRYELALILKAMQRPETAAALKRTLEALMDRGAVVRSLENLGERTLPYKMSAHSQRHTR--GGYFLVDFYAPTTTVASIMEHLSRDIDVIRPNVVKHPLTQEVKEC 105          
BLAST of Mitochondrial ribosomal protein S6 vs. UniProt/SwissProt
Match: sp|Q5ZIJ2|RT06_CHICK (28S ribosomal protein S6, mitochondrial OS=Gallus gallus OX=9031 GN=MRPS6 PE=2 SV=3)

HSP 1 Score: 68.1662 bits (165), Expect = 1.108e-13
Identity = 34/105 (32.38%), Postives = 64/105 (60.95%), Query Frame = 3
Query:   54 MVLYEWVIVLKKMPRAQMAETLKSSFLMIMDNGGVIKDVKNLGLKRLPFKMNRYFEPYVNYDGHYFVVDIEGKPTIGKTIQENLSESKD-----FLKHNIFKVQE 353
            M  YE  ++LK M R + A  LK +   +M+ G ++++++NLG + LP+K++++   + +  G YF+VD+EG P+I  T+ ++L    D     F+K+ + K +E
Sbjct:    1 MPRYELALILKAMQRPETAAVLKRTVEALMERGAIVRNLENLGERALPYKISKHN--HRHRRGGYFLVDLEGPPSIVSTMMDHLGRDIDIIRRAFIKYPVSKTEE 103          
BLAST of Mitochondrial ribosomal protein S6 vs. UniProt/SwissProt
Match: sp|P82932|RT06_HUMAN (28S ribosomal protein S6, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS6 PE=1 SV=3)

HSP 1 Score: 66.2402 bits (160), Expect = 7.280e-13
Identity = 34/107 (31.78%), Postives = 62/107 (57.94%), Query Frame = 3
Query:   54 MVLYEWVIVLKKMPRAQMAETLKSSFLMIMDNGGVIKDVKNLGLKRLPFKMNRYFEPYVNYDGHYFVVDIEGKPTIGKTIQENLSESKDFLKHNIFK--VQEYIKPC 368
            M  YE  ++LK M R + A TLK +   +MD G +++D++NLG + LP++++ + + +    G YF+VD        +++ E+LS   D ++ NI K  + + +K C
Sbjct:    1 MPRYELALILKAMQRPETAATLKRTIEALMDRGAIVRDLENLGERALPYRISAHSQQHNR--GGYFLVDFYAPTAAVESMVEHLSRDIDVIRGNIVKHPLTQELKEC 105          
BLAST of Mitochondrial ribosomal protein S6 vs. UniProt/SwissProt
Match: sp|Q9VZD5|RT06_DROME (Probable 28S ribosomal protein S6, mitochondrial OS=Drosophila melanogaster OX=7227 GN=mRpS6 PE=2 SV=1)

HSP 1 Score: 65.855 bits (159), Expect = 1.450e-12
Identity = 33/106 (31.13%), Postives = 61/106 (57.55%), Query Frame = 3
Query:   54 MVLYEWVIVLKKMPRAQMAETLKSSFLMIMDNGGVIKDVKNLGLKRLPFKMNRYFEPYVNYDGHYFVVDIEGKPTIGKTIQENLSESKDFLKHNIFKVQE-YIKPC 368
            M  YE  +VL+++PR ++   ++ +   I+D GG+I+ ++NLG + LP K++ +    V+ +G +F +  +  PT    ++E      D ++  IFKV+E   KPC
Sbjct:    1 MPSYELALVLRQLPRPELISVIRRTAESILDKGGIIRKLENLGSRALPHKVSEHG--VVHREGTHFTIAFDTAPTKIADLKEEFGRDIDIIRRYIFKVEEPEQKPC 104          
BLAST of Mitochondrial ribosomal protein S6 vs. UniProt/SwissProt
Match: sp|P58064|RT06_MOUSE (28S ribosomal protein S6, mitochondrial OS=Mus musculus OX=10090 GN=Mrps6 PE=1 SV=3)

HSP 1 Score: 60.8474 bits (146), Expect = 7.117e-11
Identity = 31/107 (28.97%), Postives = 61/107 (57.01%), Query Frame = 3
Query:   54 MVLYEWVIVLKKMPRAQMAETLKSSFLMIMDNGGVIKDVKNLGLKRLPFKMNRYFEPYVNYDGHYFVVDIEGKPTIGKTIQENLSESKDFLKHNIFK--VQEYIKPC 368
            M  YE  ++LK M R + A  LK +   +MD G +++++++LG + LP++++ + + +    G YF+VD     +  + I E+L+   D ++ NI K  + + +K C
Sbjct:    1 MPRYELALILKAMRRPETAAALKRTIESLMDRGAIVRNLESLGERALPYRISSHSQQHSR--GGYFLVDFYAPTSAVENILEHLARDIDVVRPNIVKHPLTQEVKEC 105          
BLAST of Mitochondrial ribosomal protein S6 vs. TrEMBL
Match: A0A5J4NV59 (Small subunit ribosomal protein S6 OS=Paragonimus westermani OX=34504 GN=DEA37_0004576 PE=4 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 3.207e-21
Identity = 49/137 (35.77%), Postives = 77/137 (56.20%), Query Frame = 3
Query:   54 MVLYEWVIVLKKMPRAQMAETLKSSFLMIMDNGGVIKDVKNLGLKRLPFKMNRYFEPYVNYDGHYFVVDIEGKPTIGKTIQENLSESKDFLK-HNIFKVQEYIKPCWEKDAENCHYGENQNPNYEKTERILHGFRWY 461
            M  YE  +++K +  A + E LK   L ++DN  VI +V+NLGL+RLP     + +    Y+GHYF+++ +        I++  ++  D +K     K   +++PC   DA  C +GE +NPNYEKT R  HG+R Y
Sbjct:    1 MARYEMPVIIKTLGTAGVKEALKRQLLCMLDNNAVIFNVENLGLRRLPQVF--HVQQERQYEGHYFLINFDAPTNRINEIRKRANKDTDIIKCFACLKDDAWVRPCSLPDAPVCQFGEIRNPNYEKTARRRHGYRTY 135          
BLAST of Mitochondrial ribosomal protein S6 vs. TrEMBL
Match: A0A419PPA4 (28S ribosomal protein S6 OS=Clonorchis sinensis OX=79923 GN=MRPS6 PE=4 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 8.651e-20
Identity = 47/137 (34.31%), Postives = 77/137 (56.20%), Query Frame = 3
Query:   54 MVLYEWVIVLKKMPRAQMAETLKSSFLMIMDNGGVIKDVKNLGLKRLPFKMNRYFEPYVNYDGHYFVVDIEGKPTIGKTIQENLSESKDFLK-HNIFKVQEYIKPCWEKDAENCHYGENQNPNYEKTERILHGFRWY 461
            M  YE  +++K +    + E LK   L +M+N  V+ +V+NLGL+RLP     + +    Y+GHYF+++ +        I++N ++  D +K     K   +++PC   DA  C +GE +NPN+EKT R  HG+R Y
Sbjct:    1 MARYEMPVIIKALAPMAVREALKRHLLSMMENHAVVFNVENLGLRRLPQVF--HVQQERQYEGHYFLINFDAPSDQIGEIRKNANKDTDIIKCFACLKEDNWVRPCSLPDARVCEFGEIRNPNHEKTARRRHGYRAY 135          
BLAST of Mitochondrial ribosomal protein S6 vs. TrEMBL
Match: A0A433SIE6 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_023560 PE=4 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 1.456e-19
Identity = 42/126 (33.33%), Postives = 76/126 (60.32%), Query Frame = 3
Query:   54 MVLYEWVIVLKKMPRAQMAETLKSSFLMIMDNGGVIKDVKNLGLKRLPFKMNRYFEPYVNYDGHYFVVDIEGKPTIGKTIQENLSESKDFLKHNIFKVQEYIKPCWEKDAENCHYGENQNPNYEKT 431
            M  YE  ++LK + R Q++  +K     I+D GG+I+ ++NLGLK LP+KM+ +   +  Y+G+Y ++  +G   + K I+E +      ++  +F  +E++ PC     E CH+GE QNP++E++
Sbjct:    1 MPTYELSVILKALQRPQLSAAVKRCCNNILDQGGMIRGMENLGLKPLPYKMSSHGSKH--YEGNYVLIKFDGSTHLPKLIEEPMKRDSAVIRQTVFAEREWVPPCL---VEACHFGEIQNPDHERS 121          
BLAST of Mitochondrial ribosomal protein S6 vs. TrEMBL
Match: A0A183T109 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 PE=4 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 1.596e-19
Identity = 50/146 (34.25%), Postives = 82/146 (56.16%), Query Frame = 3
Query:   27 LQIIFCNFVMVLYEWVIVLKKMPRAQMAETLKSSFLMIMDNGGVIKDVKNLGLKRLPFKMNRYFEPYVNYDGHYFVVDIEGKPTIGKTIQENLSESKDFLKHNIFKVQE-YIKPCWEKDAENCHYGENQNPNYEKTERILHGFRWY 461
             +I+F    M   E  I+ K +  A +   LK   L +++N  +I D+KNLG++RLP    R  E    ++GHYF+++I+G     + I+  +++  D +K N+ ++ + +  PC    A  C +GE +NPNYEKT R  HGFR +
Sbjct:   30 FRILF--ITMARLEMPIIFKALGDAGVRTALKRHCLRLLENNHIIFDIKNLGVRRLPQVFRRNGE--RQFEGHYFLLNIDGPEESMQKIKLLVTKDYDVIKCNVCRIDDGWCPPCQVVGAAQCEFGEIRNPNYEKTSRTRHGFRAF 171          
BLAST of Mitochondrial ribosomal protein S6 vs. TrEMBL
Match: A0A3P7CFK9 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS10157 PE=4 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 1.648e-19
Identity = 50/146 (34.25%), Postives = 82/146 (56.16%), Query Frame = 3
Query:   27 LQIIFCNFVMVLYEWVIVLKKMPRAQMAETLKSSFLMIMDNGGVIKDVKNLGLKRLPFKMNRYFEPYVNYDGHYFVVDIEGKPTIGKTIQENLSESKDFLKHNIFKVQE-YIKPCWEKDAENCHYGENQNPNYEKTERILHGFRWY 461
             +I+F    M   E  I+ K +  A +   LK   L +++N  +I D+KNLG++RLP    R  E    ++GHYF+++I+G     + I+  +++  D +K N+ ++ + +  PC    A  C +GE +NPNYEKT R  HGFR +
Sbjct:   30 FRILF--ITMARLEMPIIFKALGDAGVRTALKRHCLRLLENNHIIFDIKNLGVRRLPQVFRRNGE--RQFEGHYFLLNIDGPEESMQKIKLLVTKDYDVIKCNVCRIDDGWCPPCQVVGAAQCEFGEIRNPNYEKTSRTRHGFRAF 171          
BLAST of Mitochondrial ribosomal protein S6 vs. Ensembl Cavefish
Match: mrps6 (mitochondrial ribosomal protein S6 [Source:ZFIN;Acc:ZDB-GENE-060825-59])

HSP 1 Score: 63.1586 bits (152), Expect = 8.207e-13
Identity = 29/104 (27.88%), Postives = 57/104 (54.81%), Query Frame = 3
Query:   54 MVLYEWVIVLKKMPRAQMAETLKSSFLMIMDNGGVIKDVKNLGLKRLPFKMNRYFEPYVNYDGHYFVVDIEGKPTIGKTIQENLSESKDFLKHNIFKVQEYIKP 365
            M  YE  ++LK M R + A  L+ +   ++  G V++ ++NLG +RLP+K++++ + + +  G YF++D    PT+ K +   L    D ++  + K    + P
Sbjct:    1 MPRYELSLILKAMQRPETAAALRRTVETLVQRGAVVRGLENLGERRLPYKISKHDQRHSH--GGYFLIDFHSPPTLVKDLLNQLERDVDVIRPTVLKKDPVVSP 102          
BLAST of Mitochondrial ribosomal protein S6 vs. Ensembl Nematostella
Match: EDO44022 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RWS6])

HSP 1 Score: 49.2914 bits (116), Expect = 4.846e-8
Identity = 23/99 (23.23%), Postives = 55/99 (55.56%), Query Frame = 3
Query:   54 MVLYEWVIVLKKMPRAQMAETLKSSFLMIMDNGGVIKDVKNLGLKRLPFKMNRYFEPYVNYDGHYFVVDIEGKPTIGKTIQENLSESKDFLKHNIFKVQ 350
            M  YE +++ + + +   +  L+ +   I+  GGV++ ++NLG ++LP++M  + E +    G YF++D++      + ++  L    D ++ ++ K+Q
Sbjct:    1 MPRYELIMIARVLTKEGFSNILRQTCQSIISKGGVVRKIENLGQQQLPYRMRAHAEWHTQ--GRYFLLDMDMNADHLELLKNELKMEPDIIRPSVVKLQ 97          
BLAST of Mitochondrial ribosomal protein S6 vs. Ensembl Medaka
Match: mrps6 (mitochondrial ribosomal protein S6 [Source:ZFIN;Acc:ZDB-GENE-060825-59])

HSP 1 Score: 65.0846 bits (157), Expect = 1.740e-13
Identity = 31/102 (30.39%), Postives = 57/102 (55.88%), Query Frame = 3
Query:   54 MVLYEWVIVLKKMPRAQMAETLKSSFLMIMDNGGVIKDVKNLGLKRLPFKMNRYFEPYVNYDGHYFVVDIEGKPTIGKTIQENLSESKDFLKHNIFKVQEYI 359
            M  YE  ++LK M R + A  L+ +   +M+ G V++D++NLG + LP+KM ++ + +    G YF+VD    P+I   + ++L    D ++  + K  E +
Sbjct:    1 MPRYELALILKAMQRPETAAALRRTVETLMERGAVVRDLENLGERLLPYKMTKHNQRHSR--GSYFLVDFYAAPSILNGLLDHLHRDVDVVRPTVLKKDEQV 100          
BLAST of Mitochondrial ribosomal protein S6 vs. Planmine SMEST
Match: SMESG000049504.1 (SMESG000049504.1)

HSP 1 Score: 262.307 bits (669), Expect = 1.009e-90
Identity = 124/124 (100.00%), Postives = 124/124 (100.00%), Query Frame = 3
Query:   90 MPRAQMAETLKSSFLMIMDNGGVIKDVKNLGLKRLPFKMNRYFEPYVNYDGHYFVVDIEGKPTIGKTIQENLSESKDFLKHNIFKVQEYIKPCWEKDAENCHYGENQNPNYEKTERILHGFRWY 461
            MPRAQMAETLKSSFLMIMDNGGVIKDVKNLGLKRLPFKMNRYFEPYVNYDGHYFVVDIEGKPTIGKTIQENLSESKDFLKHNIFKVQEYIKPCWEKDAENCHYGENQNPNYEKTERILHGFRWY
Sbjct:    1 MPRAQMAETLKSSFLMIMDNGGVIKDVKNLGLKRLPFKMNRYFEPYVNYDGHYFVVDIEGKPTIGKTIQENLSESKDFLKHNIFKVQEYIKPCWEKDAENCHYGENQNPNYEKTERILHGFRWY 124          
The following BLAST results are available for this feature:
BLAST of Mitochondrial ribosomal protein S6 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
MRPS61.516e-1331.78mitochondrial ribosomal protein S6 [Source:HGNC Sy... [more]
back to top
BLAST of Mitochondrial ribosomal protein S6 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Mitochondrial ribosomal protein S6 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
mRpS61.447e-1331.13gene:FBgn0035534 transcript:FBtr0073288[more]
mRpS61.447e-1331.13gene:FBgn0035534 transcript:FBtr0306093[more]
back to top
BLAST of Mitochondrial ribosomal protein S6 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mrps67.908e-1028.87mitochondrial ribosomal protein S6 [Source:ZFIN;Ac... [more]
back to top
BLAST of Mitochondrial ribosomal protein S6 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
mrps61.864e-1232.29mitochondrial ribosomal protein S6 [Source:NCBI ge... [more]
mrps64.898e-828.13mitochondrial ribosomal protein S6 [Source:NCBI ge... [more]
back to top
BLAST of Mitochondrial ribosomal protein S6 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Mrps61.017e-1128.97mitochondrial ribosomal protein S6 [Source:MGI Sym... [more]
Gm497116.389e-630.36predicted gene, 49711 [Source:MGI Symbol;Acc:MGI:6... [more]
back to top
BLAST of Mitochondrial ribosomal protein S6 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P82931|RT06_BOVIN2.801e-1433.6428S ribosomal protein S6, mitochondrial OS=Bos tau... [more]
sp|Q5ZIJ2|RT06_CHICK1.108e-1332.3828S ribosomal protein S6, mitochondrial OS=Gallus ... [more]
sp|P82932|RT06_HUMAN7.280e-1331.7828S ribosomal protein S6, mitochondrial OS=Homo sa... [more]
sp|Q9VZD5|RT06_DROME1.450e-1231.13Probable 28S ribosomal protein S6, mitochondrial O... [more]
sp|P58064|RT06_MOUSE7.117e-1128.9728S ribosomal protein S6, mitochondrial OS=Mus mus... [more]
back to top
BLAST of Mitochondrial ribosomal protein S6 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5J4NV593.207e-2135.77Small subunit ribosomal protein S6 OS=Paragonimus ... [more]
A0A419PPA48.651e-2034.3128S ribosomal protein S6 OS=Clonorchis sinensis OX... [more]
A0A433SIE61.456e-1933.33Uncharacterized protein OS=Elysia chlorotica OX=18... [more]
A0A183T1091.596e-1934.25Uncharacterized protein OS=Schistocephalus solidus... [more]
A0A3P7CFK91.648e-1934.25Uncharacterized protein OS=Schistocephalus solidus... [more]
back to top
BLAST of Mitochondrial ribosomal protein S6 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mrps68.207e-1327.88mitochondrial ribosomal protein S6 [Source:ZFIN;Ac... [more]
back to top
BLAST of Mitochondrial ribosomal protein S6 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Mitochondrial ribosomal protein S6 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Mitochondrial ribosomal protein S6 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO440224.846e-823.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Mitochondrial ribosomal protein S6 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mrps61.740e-1330.39mitochondrial ribosomal protein S6 [Source:ZFIN;Ac... [more]
back to top
BLAST of Mitochondrial ribosomal protein S6 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000049504.11.009e-90100.00SMESG000049504.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011835 ID=SMED30011835|Name=Mitochondrial ribosomal protein S6|organism=Schmidtea mediterranea sexual|type=transcript|length=638bp
TATAGTTGAATTTAAAAGTTCGAATATTACAAATTATTTTCTGTAATTTT
GTAATGGTTTTATATGAATGGGTAATTGTTTTAAAGAAAATGCCTCGAGC
ACAGATGGCAGAGACTTTAAAAAGTAGTTTTCTAATGATAATGGATAATG
GCGGAGTCATAAAAGATGTCAAAAATCTGGGATTGAAACGCCTGCCCTTT
AAAATGAACCGATATTTTGAGCCATATGTAAATTATGATGGACATTATTT
TGTTGTAGATATTGAAGGAAAGCCTACAATAGGAAAAACAATACAGGAAA
ATCTTAGTGAAAGCAAAGACTTTTTAAAGCATAACATTTTCAAGGTTCAG
GAATACATAAAACCTTGTTGGGAAAAGGATGCAGAAAATTGCCACTATGG
AGAAAATCAAAATCCGAATTACGAAAAAACCGAGCGTATTTTGCACGGCT
TTCGGTGGTATTAATAGAAATTATTGCCTTAGTTTTCGATATTGTATATA
TATCATTTGATTGTGTAACCGTAATATTCAATTCAGTTATTATGTAATTA
ATTGTTTTCTGATTGAATTTTGGATTTATTGATATTTGGTTCTCGACTAA
AATTAATATTTCTGTTGGAAGTTTAAGTCAGTCTATAT
back to top

protein sequence of SMED30011835-orf-1

>SMED30011835-orf-1 ID=SMED30011835-orf-1|Name=SMED30011835-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=137bp
MVLYEWVIVLKKMPRAQMAETLKSSFLMIMDNGGVIKDVKNLGLKRLPFK
MNRYFEPYVNYDGHYFVVDIEGKPTIGKTIQENLSESKDFLKHNIFKVQE
YIKPCWEKDAENCHYGENQNPNYEKTERILHGFRWY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR035980Ribosomal_S6_sf
IPR014717Transl_elong_EF1B/ribosomal_S6
IPR000529Ribosomal_S6
Vocabulary: biological process
TermDefinition
GO:0006412translation
Vocabulary: molecular function
TermDefinition
GO:0019843rRNA binding
GO:0003735structural constituent of ribosome
Vocabulary: cellular component
TermDefinition
GO:0005840ribosome
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR014717Translation elongation factor EF1B/ribosomal protein S6GENE3DG3DSA:3.30.70.60coord: 1..125
e-value: 8.4E-21
score: 76.0
IPR000529Ribosomal protein S6PFAMPF01250Ribosomal_S6coord: 4..97
e-value: 2.8E-15
score: 56.4
IPR000529Ribosomal protein S6PANTHERPTHR21011MITOCHONDRIAL 28S RIBOSOMAL PROTEIN S6coord: 1..103
NoneNo IPR availableCDDcd15465bS6_mitocoord: 3..98
e-value: 2.82085E-23
score: 84.8917
IPR035980Ribosomal protein S6 superfamilySUPERFAMILYSSF54995Ribosomal protein S6coord: 1..101