Enkurin domain-containing protein

Overview
NameEnkurin domain-containing protein
Smed IDSMED30011832
Length (bp)1241
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011832

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30011832SMESG000081414.1 SmedASXL_001517SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30011832SMESG000081414.1 dd_Smed_v4_12339_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30011832SMESG000081414.1 dd_Smed_v4_12339_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30011832SMESG000081414.1 dd_Smed_v6_12339_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30011832SMESG000081414.1 dd_Smed_v4_12339_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Enkurin domain-containing protein vs. Ensembl Human
Match: ENKD1 (enkurin domain containing 1 [Source:HGNC Symbol;Acc:HGNC:25246])

HSP 1 Score: 119.013 bits (297), Expect = 1.482e-29
Identity = 75/211 (35.55%), Postives = 121/211 (57.35%), Query Frame = 1
Query:  511 FNDSGPLTVGSNKTFLRAHEKTGPPLGLNAYPLTPIRREVNESKISVPKASTAREVQLIRRDIDFVRANAYAAKTSRLKRYSSADSLVINQNVEKEKKTK------KPGEIPSYLIKRRNQWKEEEQLFIQNQPDPEQPPGHRKMSEKERLSTLELLKATEKDMLTELGRLPIRSDTLKLRTKKQEIEQKLNELEEAIKIFSKPKVFVRIE 1125
              + GP +   +  FLRAH + GP  GL    ++        S    P    A+E  L    +DF+R NA AAK +  +   S    V+ Q +E++++ +      + G +P YL++RR+ W+ E +   Q+QPDP  PPGH +M E +RL TL  L  ++  +L EL  LP  +D+L+ ++ + E+++KL ++EEAIKIFS+PKVFV+++
Sbjct:  150 LQEPGPASGTESAHFLRAHSRCGP--GLPPPHVS--------SPQPTPPGPEAKEPGL---GVDFIRHNARAAKRAPRRHSCSLQ--VLAQVLEQQRQAQEHYNATQKGHVPHYLLERRDLWRREAEARKQSQPDPAMPPGHTRMPENQRLETLTKLLQSQSQLLRELVLLPAGADSLRAQSHRAELDRKLVQVEEAIKIFSRPKVFVKMD 345          
BLAST of Enkurin domain-containing protein vs. Ensembl Fly
Match: CG11125 (gene:FBgn0033174 transcript:FBtr0336911)

HSP 1 Score: 69.3218 bits (168), Expect = 1.338e-12
Identity = 68/246 (27.64%), Postives = 117/246 (47.56%), Query Frame = 1
Query:  439 NNNTSHRRAQSAG---PSIVTKLQIDDFNDSGPLTVGSNKTFLRAH---EKTGPPLGLNAYPL----------TPIRREVNESKISVPKASTAREVQLIRRDIDFVRANAYAAKTSRLKRYSSADSL--VINQNVEKEKKTKKPGEI--PSYLIKRRNQWKEEEQLFIQNQPDPEQPPGHRKMSEKERLSTLELLKATEKDMLTELGRLPIRSDTLKLRTKKQEIEQKLNELEEAIKIFSKPKVFV 1116
            +++T   R QS G    S    +Q +D  D   LT    K    A    E++G   G N  P+           P+    N SK S    S    + +   +     A+   A  S   R+++A ++  + +++  +E K     E+  P YL K++ +    +QL      DP+ P GH  +S+++RL+ L   K   + ++ EL  +P+ + TL++R +K EI+++L  +EE I+I+SK KVFV
Sbjct:  137 SSDTDIDRCQSCGTNRSSTSIAIQTEDITDELYLTNALKKCNFDARSILEESGAKYGENYKPMQYENEEDLEQLPLSARSNSSKQSRFNMSEMEAMPMTEAEPANYGASDDEAPLSARSRFTTASNVTTISSKSKRREHKLGSRDEVRLPRYLEKQKREKAVAKQL--AESLDPDCPRGHVLLSDQDRLTHLTNAKKRYEQLVNELNHMPMTAQTLRVRNRKAEIDKELTTVEEDIRIYSKAKVFV 380          
BLAST of Enkurin domain-containing protein vs. Ensembl Fly
Match: CG11125 (gene:FBgn0033174 transcript:FBtr0088974)

HSP 1 Score: 69.3218 bits (168), Expect = 1.338e-12
Identity = 68/246 (27.64%), Postives = 117/246 (47.56%), Query Frame = 1
Query:  439 NNNTSHRRAQSAG---PSIVTKLQIDDFNDSGPLTVGSNKTFLRAH---EKTGPPLGLNAYPL----------TPIRREVNESKISVPKASTAREVQLIRRDIDFVRANAYAAKTSRLKRYSSADSL--VINQNVEKEKKTKKPGEI--PSYLIKRRNQWKEEEQLFIQNQPDPEQPPGHRKMSEKERLSTLELLKATEKDMLTELGRLPIRSDTLKLRTKKQEIEQKLNELEEAIKIFSKPKVFV 1116
            +++T   R QS G    S    +Q +D  D   LT    K    A    E++G   G N  P+           P+    N SK S    S    + +   +     A+   A  S   R+++A ++  + +++  +E K     E+  P YL K++ +    +QL      DP+ P GH  +S+++RL+ L   K   + ++ EL  +P+ + TL++R +K EI+++L  +EE I+I+SK KVFV
Sbjct:  137 SSDTDIDRCQSCGTNRSSTSIAIQTEDITDELYLTNALKKCNFDARSILEESGAKYGENYKPMQYENEEDLEQLPLSARSNSSKQSRFNMSEMEAMPMTEAEPANYGASDDEAPLSARSRFTTASNVTTISSKSKRREHKLGSRDEVRLPRYLEKQKREKAVAKQL--AESLDPDCPRGHVLLSDQDRLTHLTNAKKRYEQLVNELNHMPMTAQTLRVRNRKAEIDKELTTVEEDIRIYSKAKVFV 380          
BLAST of Enkurin domain-containing protein vs. Ensembl Zebrafish
Match: ENKD1 (si:ch211-220d9.3 [Source:ZFIN;Acc:ZDB-GENE-081104-180])

HSP 1 Score: 122.479 bits (306), Expect = 5.606e-31
Identity = 90/302 (29.80%), Postives = 149/302 (49.34%), Query Frame = 1
Query:  220 KDHIVENVKKMREIQRSSKQRQEDSRQHRGPIKSTSRTESCISTPGRKSDNQVQDVSYNSNTKLNETIKSYPNNNNTSHRRAQSAGPSIVTKLQIDDFNDSGPLTVGSNKTFLRAHEKTGPPLGLNAYPLTPIRREVNESKISVPKASTAREVQLIRRDIDFVRANAYAAKTSRLKRYSSADSLVINQNVEKEKKTKKPGEIPSYLIKRRNQWKEEEQLFIQNQPDPEQPPGHRKMSEKERLSTLELLKATEKDMLTELGRLPIRSDTLKLRTKKQEIEQKLNELEEAIKIFSKPKVFVRIE 1125
            +D   ENV+K+RE+QR  ++  E  R+H  P+      ++   +P      + QDV      +L ET                                   PL     + FL+AH   G   G       P+ R  +    +     +  E+ +    +DFV  NA AA  + ++R  S  +L      +K       G++P YL +R+ QW++EE+   +N PDP  P GH +MSE+ER  TL  LK T + +++EL  LP+++DTL +R+++ +++Q+L+E+EEAIKIFS+ KV+V+++
Sbjct:  109 RDFGKENVRKLREVQRRFRE-LEAQREHAKPVP----VKALWISP------KYQDVPSRVMAQLQET----------------------------------SPLKKPEYQNFLKAHSVCG--AGGR-----PVLRRSDSGPTAA--GDSDSEMHVRGHTVDFVSHNARAAAKTSMRRSQSLQNLQ-----DKTPACAVKGKVPPYLEQRKAQWRKEEEEKKRNTPDPSVPAGHTQMSERERQETLHSLKETHRSLVSELLSLPVKADTLSIRSRRADLDQRLSEVEEAIKIFSRDKVYVKVD 351          
BLAST of Enkurin domain-containing protein vs. Ensembl Xenopus
Match: ENKD1 (enkurin domain containing 1 [Source:NCBI gene;Acc:496799])

HSP 1 Score: 108.997 bits (271), Expect = 6.920e-26
Identity = 90/305 (29.51%), Postives = 150/305 (49.18%), Query Frame = 1
Query:  220 KDHIVENVKKMREIQRSSKQ-RQEDSRQHRGPIKSTSRTESCISTPGRKSDNQVQDVSYNSNTKLNETIKSYPNNNNTSHRRAQSAGPSIVTKLQIDDFNDSGPLTVGSNKTFLRAHEKTGPPLGLNAYPLTPIRREVNESKISVPKASTAREVQLIRRDIDFVRANAYAAKTSRLKRYSSADSL--VINQ--NVEKEKKTKKPGEIPSYLIKRRNQWKEEEQLFIQNQPDPEQPPGHRKMSEKERLSTLELLKATEKDMLTELGRLPIRSDTLKLRTKKQEIEQKLNELEEAIKIFSKPKVFVR 1119
            KDH+ ENVK+MREIQR  ++  QE+ +    P+K+  +++  ++    K   ++Q+    S  K +  +K+Y                           +  G       +TF              + P TP   +  E+K         +E+++    IDFV  NA  AK ++L+   S  +L  V+ Q    ++E  +K+ G IP YL+  +  W + ++   +N PD   PPGH  M E E+  TL  LK  ++ ++ EL  LP+ SDTL ++ ++ E+E+K+ E+EEAIKIFS+ KVF++
Sbjct:  107 KDHVKENVKRMREIQRKCREIEQENGKGTPKPVKALWKSQKYVNVES-KVKTKLQENPSPSEPKFSNFLKAY---------------------------SGCGSGMQPMRRTF--------------SVPGTPSNIDEQENK--------NKEIKVNGSGIDFVTHNAKNAKRAQLRPSRSLHNLNNVLEQKKQEQEEYDSKQKGYIPQYLLDYKEMWLKMKEESKKNTPDFSTPPGHTLMPEAEKHETLNNLKQNQEKLVKELQMLPLGSDTLSIQKRRTELEKKMVEVEEAIKIFSRTKVFIK 361          
BLAST of Enkurin domain-containing protein vs. Ensembl Mouse
Match: Enkd1 (enkurin domain containing 1 [Source:MGI Symbol;Acc:MGI:2142593])

HSP 1 Score: 116.316 bits (290), Expect = 7.874e-29
Identity = 95/310 (30.65%), Postives = 149/310 (48.06%), Query Frame = 1
Query:  217 PKDHIVENVKKMREIQRSSKQRQEDSRQHR--GPIKSTSRTESCISTPGRKSDNQVQDVSYNSNTKLNETIKSYPNNNNTSHRRAQSAGPSIVTKLQIDDFNDSGPLTVGSNKTFLRAHEKTGPPLGLNAYPLTPIRREVNESKISVPKASTAREVQLIRRDIDFVRANAYAAKTSRLKRYSSADSLVINQNVEKEKK-----TKKPGEIPSYLIKRRNQWKEEEQLFIQNQPDPEQPPGHRKMSEKERLSTLELLKATEKDMLTELGRLPIRSDTLKLRTKKQEIEQKLNELEEAIKIFSKPKVFVRIE 1125
            PKDH  EN+++++EIQR   Q QE SR+     P+K+  R+                                 P  +N   R           K ++ +    GP +V     FLRAH + GP L        P R    +  +  P+A            +DF+  NA AAK +  +   S   L   Q  +++ +     T+K G +P YL++RR+ W++E +   ++QPDP  PPGH  M E +RL TL  L  ++  +L EL  LP  +D+L+ +  + E+++KL ++EEAIKIFS+PKVFV+++
Sbjct:   97 PKDHEKENLRRIKEIQRRF-QDQERSREQGQPKPLKALWRS---------------------------------PKYDNVESR----------VKARMKEL---GPTSVTEPAHFLRAHSRCGPGL-------PPSRASSPQLALPGPQAKGPG------LGVDFISRNALAAKRAPRRHSRSLQVLAQVQEQQRQAQERYNATQK-GHVPHYLLERRDLWRKEAEARQRSQPDPSMPPGHTLMPENQRLETLNNLLQSQSQLLRELVLLPAGADSLRAQGHRAELDRKLVQIEEAIKIFSRPKVFVKMD 345          
BLAST of Enkurin domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9H0I2|ENKD1_HUMAN (Enkurin domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ENKD1 PE=1 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 7.119e-29
Identity = 75/211 (35.55%), Postives = 121/211 (57.35%), Query Frame = 1
Query:  511 FNDSGPLTVGSNKTFLRAHEKTGPPLGLNAYPLTPIRREVNESKISVPKASTAREVQLIRRDIDFVRANAYAAKTSRLKRYSSADSLVINQNVEKEKKTK------KPGEIPSYLIKRRNQWKEEEQLFIQNQPDPEQPPGHRKMSEKERLSTLELLKATEKDMLTELGRLPIRSDTLKLRTKKQEIEQKLNELEEAIKIFSKPKVFVRIE 1125
              + GP +   +  FLRAH + GP  GL    ++        S    P    A+E  L    +DF+R NA AAK +  +   S    V+ Q +E++++ +      + G +P YL++RR+ W+ E +   Q+QPDP  PPGH +M E +RL TL  L  ++  +L EL  LP  +D+L+ ++ + E+++KL ++EEAIKIFS+PKVFV+++
Sbjct:  150 LQEPGPASGTESAHFLRAHSRCGP--GLPPPHVS--------SPQPTPPGPEAKEPGL---GVDFIRHNARAAKRAPRRHSCSLQ--VLAQVLEQQRQAQEHYNATQKGHVPHYLLERRDLWRREAEARKQSQPDPAMPPGHTRMPENQRLETLTKLLQSQSQLLRELVLLPAGADSLRAQSHRAELDRKLVQVEEAIKIFSRPKVFVKMD 345          
BLAST of Enkurin domain-containing protein vs. UniProt/SwissProt
Match: sp|Q7TSV9|ENKD1_MOUSE (Enkurin domain-containing protein 1 OS=Mus musculus OX=10090 GN=Enkd1 PE=1 SV=1)

HSP 1 Score: 116.316 bits (290), Expect = 5.508e-28
Identity = 95/310 (30.65%), Postives = 149/310 (48.06%), Query Frame = 1
Query:  217 PKDHIVENVKKMREIQRSSKQRQEDSRQHR--GPIKSTSRTESCISTPGRKSDNQVQDVSYNSNTKLNETIKSYPNNNNTSHRRAQSAGPSIVTKLQIDDFNDSGPLTVGSNKTFLRAHEKTGPPLGLNAYPLTPIRREVNESKISVPKASTAREVQLIRRDIDFVRANAYAAKTSRLKRYSSADSLVINQNVEKEKK-----TKKPGEIPSYLIKRRNQWKEEEQLFIQNQPDPEQPPGHRKMSEKERLSTLELLKATEKDMLTELGRLPIRSDTLKLRTKKQEIEQKLNELEEAIKIFSKPKVFVRIE 1125
            PKDH  EN+++++EIQR   Q QE SR+     P+K+  R+                                 P  +N   R           K ++ +    GP +V     FLRAH + GP L        P R    +  +  P+A            +DF+  NA AAK +  +   S   L   Q  +++ +     T+K G +P YL++RR+ W++E +   ++QPDP  PPGH  M E +RL TL  L  ++  +L EL  LP  +D+L+ +  + E+++KL ++EEAIKIFS+PKVFV+++
Sbjct:   97 PKDHEKENLRRIKEIQRRF-QDQERSREQGQPKPLKALWRS---------------------------------PKYDNVESR----------VKARMKEL---GPTSVTEPAHFLRAHSRCGPGL-------PPSRASSPQLALPGPQAKGPG------LGVDFISRNALAAKRAPRRHSRSLQVLAQVQEQQRQAQERYNATQK-GHVPHYLLERRDLWRKEAEARQRSQPDPSMPPGHTLMPENQRLETLNNLLQSQSQLLRELVLLPAGADSLRAQGHRAELDRKLVQIEEAIKIFSRPKVFVKMD 345          
BLAST of Enkurin domain-containing protein vs. UniProt/SwissProt
Match: sp|Q3T078|ENKD1_BOVIN (Enkurin domain-containing protein 1 OS=Bos taurus OX=9913 GN=ENKD1 PE=2 SV=1)

HSP 1 Score: 107.071 bits (266), Expect = 1.400e-24
Identity = 94/310 (30.32%), Postives = 148/310 (47.74%), Query Frame = 1
Query:  217 PKDHIVENVKKMREIQRSSKQRQEDSRQHRG--PIKSTSRTESCISTPGRKSDNQVQDVSYNSNTKLNETIKSYPNNNNTSHRRAQSAGPSIVTKLQIDDFNDSGPLTVGSNKTFLRAHEKTGPPLGLNAYPLTPIRREVNESKISVPKASTAREVQLIRRDIDFVRANAYAAK-----TSRLKRYSSADSLVINQNVEKEKKTKKPGEIPSYLIKRRNQWKEEEQLFIQNQPDPEQPPGHRKMSEKERLSTLELLKATEKDMLTELGRLPIRSDTLKLRTKKQEIEQKLNELEEAIKIFSKPKVFVRIE 1125
            PKDH  EN++++REIQR  ++ QE SR+     P+K+  R+                   Y+   K+   +K+                             + GP +      FLRAH + GP L        P R  V   ++++P  S     +     +DF+  NA  AK      SR  +  +       Q  E    T+K G +P YL++RR+ W+ E +    +QPDP  PPGH +M E +RL TL  L  ++  +L EL  LP  +D+L+ ++ + E+++KL ++EEAIKIFS+PKVFV+++
Sbjct:   99 PKDHEKENMRRIREIQRRFRE-QEHSREQGQSRPLKALWRSPK-----------------YD---KVESRVKA--------------------------QLQEPGPASGTEPAHFLRAHSRCGPGL-------PPPR--VPSPQLTLPGPS----AKAPGPGVDFITHNARTAKRAPRRHSRSLQVLAQVLEQQQQAQEHYNATQK-GHVPQYLLERRDLWRREAEARQHSQPDPAMPPGHTRMPENQRLETLSSLLQSQSQLLRELVLLPAGADSLRAQSHRAELDRKLVQVEEAIKIFSRPKVFVKMD 347          
BLAST of Enkurin domain-containing protein vs. TrEMBL
Match: A0A2C9KT92 (Enkurin domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106066369 PE=4 SV=1)

HSP 1 Score: 179.874 bits (455), Expect = 3.044e-50
Identity = 115/313 (36.74%), Postives = 178/313 (56.87%), Query Frame = 1
Query:  199 SNRTVSPKDHIVENVKKMREIQRSSKQRQEDSRQHRGPIKSTSRTE--SCISTPGRKSDNQVQDVSYNSNTKLNETIKSYPNNNNTSHRRAQSAGPSIVTKLQIDDFNDSGPLTVGSNKTFLRAHEKTGPPLGLNAYPLTPIRREVNESKISVPKASTAREVQLIRRDIDFVRANAYAAKTSRLKRYSSADSLVINQNVEKEK-KTKKPGEIPSYLIKRRNQWKEEEQLFIQNQPDPEQPPGHRKMSEKERLSTLELLKATEKDMLTELGRLPIRSDTLKLRTKKQEIEQKLNELEEAIKIFSKPKVFVRIEG 1128
            SN     K+ + ENV+++REIQR+ K+RQE+ ++   P+K   ++E  SC+ +  +      QD+         + + S P++ N                                   FLRAH + GPP+ L + P+TP   ++  +K SVP ASTA+ V LIR + DF++ N   AK + L R  S  +L  ++  +++       GE+PSYL KR+ +W+ EE   I N PDP  PPGHR++ E ER  TLELL A  KD++T++ +LPI +DT++++ ++Q +E++L E+EEAIKIFS+PKVFVR+E 
Sbjct:    3 SNFDFKTKNQLNENVRRLREIQRNFKKRQEEKQE---PVKVLWKSEKYSCVESKIK------QDIE--------KPVSSRPSSAN-----------------------------------FLRAHSRAGPPVKLESRPVTP---DIT-NKTSVPPASTAQNVTLIRHNWDFIKVNGINAKKASLNRPHSLTALDDSKKRQEDLLNNYHFGEVPSYLQKRKQEWRHEEDQRIANTPDPSMPPGHRQLPENERKETLELLLAKLKDVVTQIQKLPIGTDTIRVKQQRQSLEKQLTEVEEAIKIFSRPKVFVRVES 259          
BLAST of Enkurin domain-containing protein vs. TrEMBL
Match: A0A2T7PXT7 (Enkurin domain-containing protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_00829 PE=4 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 4.422e-48
Identity = 110/303 (36.30%), Postives = 167/303 (55.12%), Query Frame = 1
Query:  220 KDHIVENVKKMREIQRSSKQRQEDSRQHRGPIKSTSRTESCISTPGRKSDNQVQDVSYNSNTKLNETIKSYPNNNNTSHRRAQSAGPSIVTKLQIDDFNDSGPLTVGSNKTFLRAHEKTGPPLGLNAYPLTPIRREVNESKISVPKASTAREVQLIRRDIDFVRANAYAAKTSRLKRYSSADSL-VINQNVEKEKKTKKPGEIPSYLIKRRNQWKEEEQLFIQNQPDPEQPPGHRKMSEKERLSTLELLKATEKDMLTELGRLPIRSDTLKLRTKKQEIEQKLNELEEAIKIFSKPKVFVRIE 1125
            K+H+ ENV++MR+IQ+  KQ++ +++Q   P+K   ++                D      +++ E ++  P        R  SA                         TFLRAH ++GP + L + P TP   +    K+SVP AS+A +V+LIR + DF++ N  +AK S+++R  S  +L  + +  +      + GE+P YL  R+ QWK  E+  I N PDP  PPGHR + E ER  TL+LLK  E+++L EL  LPI  DT ++R K++EIE KL ELEEA+KIF++PKVFVR++
Sbjct:    2 KNHLSENVRRMRQIQKQCKQKERETQQ---PVKVLWKS----------------DKYSGVQSRIKEELEKPPLPP-----RPHSA-------------------------TFLRAHSRSGPIVKLESRPCTPDFTD----KLSVPPASSANDVKLIRHNFDFIKVNGCSAKHSKIQRPPSLTALDELRKKDDDRMADYEFGEVPKYLKHRKEQWKRNEEERIANTPDPSMPPGHRALPENERRETLDLLKKREQELLKELASLPIGVDTARVRNKRKEIEGKLAELEEAVKIFARPKVFVRVD 251          
BLAST of Enkurin domain-containing protein vs. TrEMBL
Match: A0A0B7A794 (Enkurin domain-containing protein OS=Arion vulgaris OX=1028688 GN=ORF97401 PE=4 SV=1)

HSP 1 Score: 173.326 bits (438), Expect = 1.046e-47
Identity = 109/310 (35.16%), Postives = 178/310 (57.42%), Query Frame = 1
Query:  199 SNRTVSPKDHIVENVKKMREIQRSSKQRQEDSRQHRGPIKSTSRTESCISTPGRKSDNQVQDVSYNSNTKLNETIKSYPNNNNTSHRRAQSAGPSIVTKLQIDDFNDSGPLTVGSNKTFLRAHEKTGPPLGLNAYPLTPIRREVNESKISVPKASTAREVQLIRRDIDFVRANAYAAKTSRLKRYSSADSLVINQNVEKEKKTKKP-GEIPSYLIKRRNQWKEEEQLFIQNQPDPEQPPGHRKMSEKERLSTLELLKATEKDMLTELGRLPIRSDTLKLRTKKQEIEQKLNELEEAIKIFSKPKVFVRIE 1125
            S+  +  K+ ++ENV++MREIQR  KQR+ + ++             C+             V + S        + Y N               + +K++ D  N   P    S   FLRAH + GPP+ L + P +P   ++++ K++VP AS+A +V+LIR + DF++ N   AK + L+R  SA +L  ++  + E  ++   GEIP YL +R+ QW+++E+  I N PDP  P GHR++ E ER  TL+LLK  + D++ ++ RLPI +DT++++ ++Q +E++L E+EEAIKIFS+PKVFVRI+
Sbjct:    3 SHFDLHSKNQLIENVRRMREIQRRCKQREAEGQE-------------CVK------------VLWKS--------QKYSN---------------VESKIKQDAQNPEAPRPRSSQ--FLRAHSRAGPPVKLQSRPCSP---DISD-KMTVPPASSAGDVKLIRNNFDFIKVNGINAKRTTLQRPLSASALDNHKKRQDELLSQHHIGEIPGYLNQRKKQWQKDEEHRIVNTPDPTMPVGHRQLPENERRETLDLLKKKQDDVIGQIQRLPIGADTVRVKLQRQSMEKQLTEIEEAIKIFSRPKVFVRID 258          
BLAST of Enkurin domain-containing protein vs. TrEMBL
Match: K1Q2Z0 (Uncharacterized protein C16orf48 OS=Crassostrea gigas OX=29159 GN=CGI_10020908 PE=4 SV=1)

HSP 1 Score: 172.94 bits (437), Expect = 2.581e-47
Identity = 112/304 (36.84%), Postives = 172/304 (56.58%), Query Frame = 1
Query:  220 KDHIVENVKKMREIQRSSKQRQEDSRQHRGPIKSTSRTESCISTPGRKSDNQVQDVSYNSNT-KLNETIKSYPNNNNTSHRRAQSAGPSIVTKLQIDDFNDSGPLTVGSNKTFLRAHEKTGPPLGLNAYPLTPIRREVNESKISVPKASTAREVQLIRRDIDFVRANAYAAKTSRLKRYSSADSLVINQNVEKEKKTK-KPGEIPSYLIKRRNQWKEEEQLFIQNQPDPEQPPGHRKMSEKERLSTLELLKATEKDMLTELGRLPIRSDTLKLRTKKQEIEQKLNELEEAIKIFSKPKVFVRIE 1125
            +DH+ ENV++MR+IQR +K+R+ ++ Q   P+K+  ++E                  Y+  T K+ E IK  P     S  R +SA                         TFLRAH +TGP +   + P TP   +    K++VP A  + E++  R +IDF+R N  +AK   +KR  S ++L   +  E+E+  K + GE+P YL  R+  WK+ E+  I N PDPE PPGHR + EKER  TL+LL   E ++++EL  LP+R DT ++R++KQE+E K+ E++EA KIF++PKVFV+++
Sbjct:   31 RDHLGENVRRMRQIQRQAKEREANAHQ---PVKALWKSEK-----------------YSGVTSKIKEDIKKPP-----STPRPKSA-------------------------TFLRAHSRTGPSIKNISRPCTP---DPPSEKLTVPPARCSSEIRFNRNNIDFIRVNGVSAKRQTMKRSPSVNALDELKKKEEEEYNKHRKGEVPKYLQVRKEHWKKTEEERIANTPDPEMPPGHRLLLEKERQQTLKLLLTKEDELVSELSALPLRMDTFRIRSQKQELENKIAEIDEAKKIFNRPKVFVKVD 281          
BLAST of Enkurin domain-containing protein vs. TrEMBL
Match: R7UKA9 (Enkurin domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_166725 PE=4 SV=1)

HSP 1 Score: 173.711 bits (439), Expect = 5.840e-47
Identity = 111/312 (35.58%), Postives = 172/312 (55.13%), Query Frame = 1
Query:  223 DHIVENVKKMREIQRSSKQRQEDSRQHRGPIKSTSRTESCISTPGRKSDNQVQDVSYNSNTKLNETIKSYPNNNNTSHRRAQSAGPSIVTKLQIDDFNDSGPLTVGSNKTFLRAHEKTGPPLGLNAYPLTPIRREVNESK--------ISVPKASTAREVQLIRRDIDFVRANAYAAKTSRLKR---YSSADSLVINQNVEKEKKTKKPGEIPSYLIKRRNQWKEEEQLFIQNQPDPEQPPGHRKMSEKERLSTLELLKATEKDMLTELGRLPIRSDTLKLRTKKQEIEQKLNELEEAIKIFSKPKVFVRIE 1125
            DH+ +NV++MR+IQ+ ++ +QE++++   P+K+  ++                                     N S R        ++  ++ D  N   P    S+  FLRAH ++G          TP  R  ++S          SVP+A++ARE++L+R DIDF++AN  A +   + R    S+ D L   Q+  +    +  G++P YL  R+ QWKEEE   I + PDPE P GHRKM + ER  TL+ L+ T+K++LT+LG LPIR+DTL +R +K+EIE KL+E+EEAIKIFS+PKVFV+++
Sbjct:   86 DHLKDNVRRMRQIQKDARHKQEETKK---PVKALWKSSKY---------------------------------ENVSSR--------VMEAIETDSCNAPRP----SSANFLRAHSRSG---------WTPNSRRGSQSAREMASDRPPSVPRATSAREIKLVRNDIDFIKANGKAVRAFSIPRSPSLSALDDLKHKQSSAEVNYQR--GKVPKYLESRKKQWKEEEAERIASIPDPEMPVGHRKMEDHERKDTLQKLRQTQKELLTQLGHLPIRTDTLTVRKRKEEIETKLSEIEEAIKIFSRPKVFVKLD 338          
BLAST of Enkurin domain-containing protein vs. Ensembl Cavefish
Match: si:ch211-220d9.3 (enkurin domain containing 1 [Source:NCBI gene;Acc:103033941])

HSP 1 Score: 117.857 bits (294), Expect = 2.460e-29
Identity = 91/300 (30.33%), Postives = 147/300 (49.00%), Query Frame = 1
Query:  220 KDHIVENVKKMREIQRSSKQRQEDSRQHRGPIKSTSRTESCISTPGRKSDNQVQDVSYNSNTKLNETIKSYPNNNNTSHRRAQSAGPSIVTKLQIDDFNDSGPLTVGSNKTFLRAHEKTGPPLGLNAYPLTPIRREVNESKISVPKASTAREVQLIRRDIDFVRANAYAAKTSRLKRYSSADSLVINQNVEKEKKTKKPGEIPSYLIKRRNQWKEEEQLFIQNQPDPEQPPGHRKMSEKERLSTLELLKATEKDMLTELGRLPIRSDTLKLRTKKQEIEQKLNELEEAIKIFSKPKVFVR 1119
            +D+  ENV+++REIQR  ++ QE  ++   P+      ++  S+P      + QD+      +L E  KS+P                                     + FLRAH   G   G    P  P     + S+      +   E+++    +DFV  NA AA+ + LKR  S   L   Q     K     G +P YL +R+ QW+ E +   +N PDP  P GH +MS++ER  TL  L+   + +++EL  LP+R+DT+ +R+++ E++Q+L+E+EEAIKIFS+ KV+V+
Sbjct:  109 QDYGKENVRRLREIQRRFRE-QEAQKERAKPVP----VKALWSSP------KYQDIPSRVMAQLQE--KSHPKKAEC--------------------------------QNFLRAHSVCG--AGGRPQPSRPQSVSASPSENGQKPQTADPEMEVRGHFVDFVSHNARAARKTALKRSQSLQDLNNKQPPSAVK-----GRVPQYLEERKEQWRREAEERRRNAPDPSAPAGHTQMSDRERRETLNSLRENHRSLVSELLSLPVRADTVSVRSRRAELDQRLSEVEEAIKIFSRDKVYVK 356          
BLAST of Enkurin domain-containing protein vs. Ensembl Cavefish
Match: si:ch211-220d9.3 (enkurin domain containing 1 [Source:NCBI gene;Acc:103033941])

HSP 1 Score: 117.472 bits (293), Expect = 3.966e-29
Identity = 90/300 (30.00%), Postives = 148/300 (49.33%), Query Frame = 1
Query:  220 KDHIVENVKKMREIQRSSKQRQEDSRQHRGPIKSTSRTESCISTPGRKSDNQVQDVSYNSNTKLNETIKSYPNNNNTSHRRAQSAGPSIVTKLQIDDFNDSGPLTVGSNKTFLRAHEKTGPPLGLNAYPLTPIRREVNESKISVPKASTAREVQLIRRDIDFVRANAYAAKTSRLKRYSSADSLVINQNVEKEKKTKKPGEIPSYLIKRRNQWKEEEQLFIQNQPDPEQPPGHRKMSEKERLSTLELLKATEKDMLTELGRLPIRSDTLKLRTKKQEIEQKLNELEEAIKIFSKPKVFVR 1119
            +D+  ENV+++REIQR  ++ QE  ++   P+      ++  S+P      + QD+      +L E  KS+P                                     + FLRAH   G   G    P  P     + S+      +   E+++    +DFV  NA AA+ + LKR  S   L       K+  +   G +P YL +R+ QW+ E +   +N PDP  P GH +MS++ER  TL  L+   + +++EL  LP+R+DT+ +R+++ E++Q+L+E+EEAIKIFS+ KV+V+
Sbjct:  115 QDYGKENVRRLREIQRRFRE-QEAQKERAKPVP----VKALWSSP------KYQDIPSRVMAQLQE--KSHPKKAEC--------------------------------QNFLRAHSVCG--AGGRPQPSRPQSVSASPSENGQKPQTADPEMEVRGHFVDFVSHNARAARKTALKRSQSLQDLN-----NKQPPSAVKGRVPQYLEERKEQWRREAEERRRNAPDPSAPAGHTQMSDRERRETLNSLRENHRSLVSELLSLPVRADTVSVRSRRAELDQRLSEVEEAIKIFSRDKVYVK 362          
BLAST of Enkurin domain-containing protein vs. Ensembl Nematostella
Match: EDO36286 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJ21])

HSP 1 Score: 138.658 bits (348), Expect = 1.426e-37
Identity = 103/315 (32.70%), Postives = 167/315 (53.02%), Query Frame = 1
Query:  208 TVSPKDHIVENVKKMREIQRSSKQRQEDSRQHRGPIKSTSRTESCISTPGRKSDNQVQDVSYNSNTKLNETIKSYPNNNNTSHRRAQSAGPSIVTKLQIDDFNDSGPLTVGSNKTFLRAHEKTGPPL---GLNAYPLTPIRREVNESKISVPKASTAREVQLIRRDIDFVRANAYAAKTSRLKRYSSADSLVINQNVEKEK------KTKKPGEIPSYLIKRRNQWKEEEQLFIQNQPDPEQPPGHRKMSEKERLSTLELLKATEKDMLTELGRLPIRSDTLKLRTKKQEIEQKLNELEEAIKIFSKPKVFVRIE 1125
            +  PK+   ENV  +++IQ+++K++Q+D      PIK+  +                 D   +  +K+ + +K+ P                              P    ++ T+LRAH + GPP+     +  P+ P      E K++VPKA  A+E Q +R++ + V  NA  A +  L R S + ++ + +  +K+K      +TK  G +P YL  R+ QWK+EE+  I N PDP  PPGH  M   ERL TL+ L+  ++++L EL  LP+R DTL++RT+K E+E++L E+E AIKIFS+PKVFV+++
Sbjct:   71 SAQPKNFTKENVNHIKKIQKANKEKQKDLSVVGEPIKAVYKP----------------DKFEHVESKVAKEVKAPP------------------------------PPPRSNSATYLRAHSRNGPPVKDRPSSTEPVIP-----KEQKLTVPKADIAKERQPVRKERNHVAMNARRAASPGLYRRSPS-AMALEELKQKKKAEEELYRTKSYGNVPKYLKTRQQQWKKEEETRIANIPDPSIPPGHTLMQRDERLKTLDALQKNQEELLNELRLLPVRVDTLRVRTRKTELERRLTEIENAIKIFSRPKVFVKLD 333          
BLAST of Enkurin domain-containing protein vs. Ensembl Medaka
Match: si:ch211-220d9.3 (enkurin domain containing 1 [Source:NCBI gene;Acc:101155774])

HSP 1 Score: 105.916 bits (263), Expect = 4.635e-25
Identity = 67/213 (31.46%), Postives = 114/213 (53.52%), Query Frame = 1
Query:  487 VTKLQIDDFNDSGPLTVGSNKTFLRAHEKTGPPLGLNAYPLTPIRREVNESKISVPKASTAREVQLIRRDIDFVRANAYAAKTSRLKRYSSADSLVINQNVEKEKKTKKPGEIPSYLIKRRNQWKEEEQLFIQNQPDPEQPPGHRKMSEKERLSTLELLKATEKDMLTELGRLPIRSDTLKLRTKKQEIEQKLNELEEAIKIFSKPKVFVRIE 1125
            V+   +     S P      + FL+AH       G  A P  P     N        ++  +++++  + I+F+R NA AA  +  +R  S   L      +K   +   G++P YL +R+ QW++EE+   +N PDP  PPGH  M + ER  TL+ LK T + ++ EL  LP+++D L  R+++  ++ +L+E+EEAIKIFS+ KV+++ +
Sbjct:  153 VSSRVLAQLESSTPTVKPQCQNFLKAHSN-----GSYAAPSVPSLAFKNSCN-----SAQDQDLKVQGQAINFIRHNARAAGKTVTRRSQSLTDLR-----DKPVPSAVKGQVPQYLEERKAQWRKEEEERKRNTPDPTIPPGHTLMQDSERQETLKSLKDTHRTLVMELNSLPLKADNLSTRSRRAHLDCRLSEIEEAIKIFSRDKVYIKTD 350          
BLAST of Enkurin domain-containing protein vs. Ensembl Medaka
Match: si:ch211-220d9.3 (enkurin domain containing 1 [Source:NCBI gene;Acc:101155774])

HSP 1 Score: 104.76 bits (260), Expect = 1.488e-24
Identity = 55/143 (38.46%), Postives = 90/143 (62.94%), Query Frame = 1
Query:  697 IDFVRANAYAAKTSRLKRYSSADSLVINQNVEKEKKTKKPGEIPSYLIKRRNQWKEEEQLFIQNQPDPEQPPGHRKMSEKERLSTLELLKATEKDMLTELGRLPIRSDTLKLRTKKQEIEQKLNELEEAIKIFSKPKVFVRIE 1125
            I+F+R NA AA  +  +R  S   L      +K   +   G++P YL +R+ QW++EE+   +N PDP  PPGH  M + ER  TL+ LK T + ++ EL  LP+++D L  R+++  ++ +L+E+EEAIKIFS+ KV+++ +
Sbjct:  233 INFIRHNARAAGKTVTRRSQSLTDLR-----DKPVPSAVKGQVPQYLEERKAQWRKEEEERKRNTPDPTIPPGHTLMQDSERQETLKSLKDTHRTLVMELNSLPLKADNLSTRSRRAHLDCRLSEIEEAIKIFSRDKVYIKTD 370          
BLAST of Enkurin domain-containing protein vs. Planmine SMEST
Match: SMESG000081414.1 (SMESG000081414.1)

HSP 1 Score: 642.884 bits (1657), Expect = 0.000e+0
Identity = 315/317 (99.37%), Postives = 316/317 (99.68%), Query Frame = 1
Query:  184 YFGSFSNRTVSPKDHIVENVKKMREIQRSSKQRQEDSRQHRGPIKSTSRTESCISTPGRKSDNQVQDVSYNSNTKLNETIKSYPNNNNTSHRRAQSAGPSIVTKLQIDDFNDSGPLTVGSNKTFLRAHEKTGPPLGLNAYPLTPIRREVNESKISVPKASTAREVQLIRRDIDFVRANAYAAKTSRLKRYSSADSLVINQNVEKEKKTKKPGEIPSYLIKRRNQWKEEEQLFIQNQPDPEQPPGHRKMSEKERLSTLELLKATEKDMLTELGRLPIRSDTLKLRTKKQEIEQKLNELEEAIKIFSKPKVFVRIEGSS 1134
            YFGSFSNRTVSPKDHIVENVKKMREIQRSSKQRQEDSRQHRGPIKSTSRTESC+STPGRKSDNQVQDVSYNSNTKLNETIKSYPNNNNTSHRRAQSAGPSIVTKLQIDDFNDS PLTVGSNKTFLRAHEKTGPPLGLNAYPLTPIRREVNESKISVPKASTAREVQLIRRDIDFVRANAYAAKTSRLKRYSSADSLVINQNVEKEKKTKKPGEIPSYLIKRRNQWKEEEQLFIQNQPDPEQPPGHRKMSEKERLSTLELLKATEKDMLTELGRLPIRSDTLKLRTKKQEIEQKLNELEEAIKIFSKPKVFVRIEGSS
Sbjct:   52 YFGSFSNRTVSPKDHIVENVKKMREIQRSSKQRQEDSRQHRGPIKSTSRTESCMSTPGRKSDNQVQDVSYNSNTKLNETIKSYPNNNNTSHRRAQSAGPSIVTKLQIDDFNDSCPLTVGSNKTFLRAHEKTGPPLGLNAYPLTPIRREVNESKISVPKASTAREVQLIRRDIDFVRANAYAAKTSRLKRYSSADSLVINQNVEKEKKTKKPGEIPSYLIKRRNQWKEEEQLFIQNQPDPEQPPGHRKMSEKERLSTLELLKATEKDMLTELGRLPIRSDTLKLRTKKQEIEQKLNELEEAIKIFSKPKVFVRIEGSS 368          

HSP 2 Score: 79.7221 bits (195), Expect = 4.008e-16
Identity = 34/34 (100.00%), Postives = 34/34 (100.00%), Query Frame = 2
Query:   80 MATSWVSHVSGPIASHHIYEQNDDIYYEKKPQNK 181
            MATSWVSHVSGPIASHHIYEQNDDIYYEKKPQNK
Sbjct:    1 MATSWVSHVSGPIASHHIYEQNDDIYYEKKPQNK 34          
BLAST of Enkurin domain-containing protein vs. Planmine SMEST
Match: SMESG000020205.1 (SMESG000020205.1)

HSP 1 Score: 102.449 bits (254), Expect = 3.875e-24
Identity = 67/195 (34.36%), Postives = 117/195 (60.00%), Query Frame = 1
Query:  544 NKTFLRAHEKTGPPLGLNAYP-LTPIRREVNES-KISVPKASTAREVQLIRRDIDFVRANAYAAKTSRLKRYSSADSLVINQNVEKEKKTKKPGEIPSYLIKRRNQWKEE-EQLFIQNQPDPEQPPGHRKMSEKERLSTLELLKATEKDMLTELGRLPIRSDTLKLRTKKQEIEQKLNELEEAIKIFSKPKVFVR 1119
            N+TFL+AHE +GPPL  N YP +  I  + +E  ++SVP   +A EV+  RR I+++RANAYA ++ R ++ S   S V  + ++      + GE+P YL   +N+ +E+  + F+ ++         R ++  E+   LE LK   + +  EL  LPI  +T++ RT+K ++E++L+E+ + I I++KP V+V+
Sbjct:  147 NRTFLKAHENSGPPLDTNKYPTIQKINLKNSEKVRVSVPTGKSAIEVKFQRRQINYIRANAYALQSERYRKISK--SAVSTRQIDMS--NYRNGEVPKYLKTFKNKSEEKASRNFVVSK--------ERTLTGLEKQIILEKLKIDLERVYGELNSLPISMETIRSRTRKDQLEKQLDEINKCIDIYNKPNVYVK 329          
The following BLAST results are available for this feature:
BLAST of Enkurin domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENKD11.482e-2935.55enkurin domain containing 1 [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of Enkurin domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Enkurin domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG111251.338e-1227.64gene:FBgn0033174 transcript:FBtr0336911[more]
CG111251.338e-1227.64gene:FBgn0033174 transcript:FBtr0088974[more]
back to top
BLAST of Enkurin domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENKD15.606e-3129.80si:ch211-220d9.3 [Source:ZFIN;Acc:ZDB-GENE-081104-... [more]
back to top
BLAST of Enkurin domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENKD16.920e-2629.51enkurin domain containing 1 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Enkurin domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Enkd17.874e-2930.65enkurin domain containing 1 [Source:MGI Symbol;Acc... [more]
back to top
BLAST of Enkurin domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|Q9H0I2|ENKD1_HUMAN7.119e-2935.55Enkurin domain-containing protein 1 OS=Homo sapien... [more]
sp|Q7TSV9|ENKD1_MOUSE5.508e-2830.65Enkurin domain-containing protein 1 OS=Mus musculu... [more]
sp|Q3T078|ENKD1_BOVIN1.400e-2430.32Enkurin domain-containing protein 1 OS=Bos taurus ... [more]
back to top
BLAST of Enkurin domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2C9KT923.044e-5036.74Enkurin domain-containing protein OS=Biomphalaria ... [more]
A0A2T7PXT74.422e-4836.30Enkurin domain-containing protein OS=Pomacea canal... [more]
A0A0B7A7941.046e-4735.16Enkurin domain-containing protein OS=Arion vulgari... [more]
K1Q2Z02.581e-4736.84Uncharacterized protein C16orf48 OS=Crassostrea gi... [more]
R7UKA95.840e-4735.58Enkurin domain-containing protein OS=Capitella tel... [more]
back to top
BLAST of Enkurin domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
si:ch211-220d9.32.460e-2930.33enkurin domain containing 1 [Source:NCBI gene;Acc:... [more]
si:ch211-220d9.33.966e-2930.00enkurin domain containing 1 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Enkurin domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Enkurin domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Enkurin domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO362861.426e-3732.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Enkurin domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
si:ch211-220d9.34.635e-2531.46enkurin domain containing 1 [Source:NCBI gene;Acc:... [more]
si:ch211-220d9.31.488e-2438.46enkurin domain containing 1 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Enkurin domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000081414.14.008e-1699.37SMESG000081414.1[more]
SMESG000020205.13.875e-2434.36SMESG000020205.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011832 ID=SMED30011832|Name=Enkurin domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1241bp
CGTTTCCATAGTTTAGTAATACGAAAGTTACAAATAAATTTCGGTAAATA
ATTAATTTTATTATTGGAATTTTGAAATAATGGCTACGAGTTGGGTTTCT
CATGTATCTGGACCAATTGCTAGTCATCATATATATGAACAAAATGATGA
CATTTATTATGAAAAGAAACCTCAAAATAAAGATATTTTGGTTCTTTCAG
TAACAGAACAGTGTCACCAAAAGATCACATTGTGGAAAATGTCAAGAAAA
TGCGTGAAATTCAAAGGTCTAGCAAGCAACGACAAGAAGATAGCAGGCAA
CATAGAGGTCCTATTAAATCTACTAGTCGAACTGAGTCGTGTATTAGTAC
ACCAGGGCGGAAATCCGATAATCAAGTTCAAGATGTTTCATATAATTCAA
ACACCAAACTGAATGAGACAATCAAATCATATCCAAATAATAATAATACC
AGTCATCGTCGTGCTCAATCTGCTGGCCCAAGTATTGTCACAAAATTGCA
AATTGATGATTTCAATGATTCTGGTCCTTTGACTGTTGGCAGCAATAAAA
CGTTTCTTCGAGCTCATGAGAAAACTGGCCCACCATTGGGTCTTAATGCC
TATCCATTAACACCTATTCGTAGAGAAGTTAATGAATCCAAAATCAGTGT
ACCAAAAGCTTCAACTGCCAGAGAAGTCCAGCTTATTAGACGTGATATTG
ATTTTGTTCGAGCAAATGCTTATGCTGCTAAAACGTCGAGGCTGAAAAGG
TATTCTAGCGCTGATAGTTTAGTGATCAATCAAAATGTGGAAAAAGAGAA
AAAAACTAAGAAACCAGGAGAAATTCCTTCATACCTTATTAAAAGGCGTA
ATCAATGGAAAGAAGAAGAACAGCTATTTATTCAAAACCAGCCAGATCCT
GAACAACCACCTGGTCATCGAAAAATGTCAGAAAAAGAAAGATTATCTAC
TCTGGAGTTACTTAAAGCTACTGAAAAAGACATGTTAACTGAGCTTGGGC
GACTTCCCATTCGTTCTGATACGCTTAAATTACGTACTAAGAAGCAAGAA
ATCGAACAAAAACTTAACGAATTAGAAGAGGCCATAAAGATATTTTCAAA
ACCTAAGGTATTCGTGCGTATTGAAGGTTCAAGCTGAAATATTGTTACGC
TTTTCATTAAGTCATGATTCAGTACTTTTTTATTAGTTATATGTACATAA
TGATGACAATGAAGATTTCTTTCTATTTGATCTAGCAGATC
back to top

protein sequence of SMED30011832-orf-1

>SMED30011832-orf-1 ID=SMED30011832-orf-1|Name=SMED30011832-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=296bp
MREIQRSSKQRQEDSRQHRGPIKSTSRTESCISTPGRKSDNQVQDVSYNS
NTKLNETIKSYPNNNNTSHRRAQSAGPSIVTKLQIDDFNDSGPLTVGSNK
TFLRAHEKTGPPLGLNAYPLTPIRREVNESKISVPKASTAREVQLIRRDI
DFVRANAYAAKTSRLKRYSSADSLVINQNVEKEKKTKKPGEIPSYLIKRR
NQWKEEEQLFIQNQPDPEQPPGHRKMSEKERLSTLELLKATEKDMLTELG
RLPIRSDTLKLRTKKQEIEQKLNELEEAIKIFSKPKVFVRIEGSS*
back to top

protein sequence of SMED30011832-orf-2

>SMED30011832-orf-2 ID=SMED30011832-orf-2|Name=SMED30011832-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=111bp
MATSWVSHVSGPIASHHIYEQNDDIYYEKKPQNKDILVLSVTEQCHQKIT
LWKMSRKCVKFKGLASNDKKIAGNIEVLLNLLVELSRVLVHQGGNPIIKF
KMFHIIQTPN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR027710ENKD1
IPR027012Enkurin_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005881cytoplasmic microtubule
GO:0015630microtubule cytoskeleton
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 258..281
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..76
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..23
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 24..76
NoneNo IPR availablePANTHERPTHR21490UNCHARACTERIZEDcoord: 1..291
IPR027012Enkurin domainPFAMPF13864Enkurincoord: 190..285
e-value: 2.5E-24
score: 85.6
IPR027012Enkurin domainPROSITEPS51665ENKURINcoord: 198..290
score: 23.136
IPR027710Enkurin domain-containing protein 1PANTHERPTHR21490:SF2ENKURIN DOMAIN-CONTAINING PROTEIN 1coord: 1..291