Melatonin receptor type 1A like

Overview
NameMelatonin receptor type 1A like
Smed IDSMED30011828
Length (bp)1276
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Melatonin receptor type 1A like (SMED30011828) t-SNE clustered cells

Violin plots show distribution of expression levels for Melatonin receptor type 1A like (SMED30011828) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Melatonin receptor type 1A like (SMED30011828) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Melatonin receptor type 1A like (SMED30011828) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011828

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30011828SMESG000043394.1 dd_Smed_v4_19535_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30011828SMESG000043394.1 dd_Smed_v4_19535_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30011828SMESG000043394.1 dd_Smed_v4_19535_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30011828SMESG000043394.1 dd_Smed_v4_19535_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30011828SMESG000043394.1 dd_Smed_v4_19535_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30011828SMESG000005268.1 Contig4522GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30011828SMESG000043394.1 Contig4522GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30011828SMESG000043394.1 dd_Smed_v6_19535_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Melatonin receptor type 1A like vs. Ensembl Human
Match: MTNR1A (melatonin receptor 1A [Source:HGNC Symbol;Acc:HGNC:7463])

HSP 1 Score: 68.5514 bits (166), Expect = 4.131e-12
Identity = 73/295 (24.75%), Postives = 134/295 (45.42%), Query Frame = 1
Query:  283 YLYSQDITYLCINIVLGILFNLCVPFAISVDKKLWXXXXXXXXXXXXVDLMVCCYILPVTLANRILSRNVMGYIGCHVNSFLTFISMGINNFIFMIISFDRYLFIFHKLSHTQLFTISNTLILIALVWLFWIGYGIALSFFKGFGYESDAFVCFILDTNGNIXXXXXXXXXXXXXPISVSTGFYTILLVKLFKTKRNLSIQKEFKRLSDIQRDKNEMRMVVLLIVTVGTFFLCWAPYTFHGFFYRFGGTLSAP-----LHRVIYWGTLTNATLNGWLFGVMNSRFRKSLKQIFQS 1152
            +L S     L   IV+ IL NL V  ++  +KKL  + N  ++++ + DL+V  Y  P+ L +   +   +GY+ C V+ FL  +S+  + F    I+ +RY +I H L + +L++  N+L  + L+WL  +   +         Y+   + C    +  +  T+  +     +  I V   +  I ++ L   +R   ++ + K     Q  +N + M V+ ++    F +CWAP  F G           P     L    Y+    N+ LN  ++G++N  FRK  ++I  S
Sbjct:   25 WLASALACVLIFTIVVDILGNLLVILSVYRNKKLRNAGNIFVVSLAVADLVVAIYPYPLVLMSIFNNGWNLGYLHCQVSGFLMGLSVIGSIFNITGIAINRYCYICHSLKYDKLYSSKNSLCYVLLIWLLTLAAVLPNLRAGTLQYDPRIYSCTFAQSVSSAYTIAVVVFHFLVPMIIVIFCYLRIWILVLQVRQR---VKPDRKPKLKPQDFRNFVTMFVVFVL----FAICWAPLNFIGLAVASDPASMVPRIPEWLFVASYYMAYFNSCLNAIIYGLLNQNFRKEYRRIIVS 312          
BLAST of Melatonin receptor type 1A like vs. Ensembl Human
Match: MTNR1B (melatonin receptor 1B [Source:HGNC Symbol;Acc:HGNC:7464])

HSP 1 Score: 60.8474 bits (146), Expect = 1.769e-9
Identity = 65/284 (22.89%), Postives = 129/284 (45.42%), Query Frame = 1
Query:  310 LCINIVLGILFNLCVPFAISVDKKLWXXXXXXXXXXXXVDLMVCCYILPVTLANRILSRNVMGYIGCHVNSFLTFISMGINNFIFMIISFDRYLFIFHKLSHTQLFTISNTLILIALVWLFWIGYGIALSFFKGFGYESDAFVCFILDTNGNIXXXXXXXXXXXXXPISVSTGFYTILLVKLFKTKRNLSIQKEFKRLSDIQRDKNEMRMVVLLIVTVGTFFLCWAPYTFHGFFYRFGGTLSAP-----LHRVIYWGTLTNATLNGWLFGVMNSRFRKSLKQIF 1146
            L +   + ++ NL V  ++  ++KL  + N  ++++ + DL+V  Y  P+ L         +G   C  ++F+  +S+  + F    I+ +RY +I H +++ +++   +T + I L+WL  +   +   F     Y+   + C  + T  +      + V +FLLPI+V +  Y  + V + + +R      + K  S +    +++R  + + V    F +CWAP    G          AP     L    Y     N+ LN  ++G++N  FR+  K+I 
Sbjct:   47 LIVTTAVDVVGNLLVILSVLRNRKLRNAGNLFLVSLALADLVVAFYPYPLILVAIFYDGWALGEEHCKASAFVMGLSVIGSVFNITAIAINRYCYICHSMAYHRIYRRWHTPLHICLIWLLTVVALLPNFFVGSLEYDPRIYSCTFIQT-ASTQYTAAVVVIHFLLPIAVVSFCYLRIWVLVLQARR------KAKPESRLCLKPSDLRSFLTMFVVFVIFAICWAPLNCIGLAVAINPQEMAPQIPEGLFVTSYLLAYFNSCLNAIVYGLLNQNFRREYKRIL 323          
BLAST of Melatonin receptor type 1A like vs. Ensembl Human
Match: APLNR (apelin receptor [Source:HGNC Symbol;Acc:HGNC:339])

HSP 1 Score: 55.8398 bits (133), Expect = 6.779e-8
Identity = 56/241 (23.24%), Postives = 108/241 (44.81%), Query Frame = 1
Query:  508 CHVNSFLTFISMGINNFIFMIISFDRYLFIFHKLSHTQLFTISNTLILIALVWLFWIGYGIALSFFKGFG-YESDAFVCFILDTNGNIXXXXXXXXXXXXXPISVSTGF---YTILLVKLFKTKRNLSIQKEFKRLSDIQRDKNEMRMVVLLIVTVGTFFLCWAPYTFHGFFYRFGGTLSAP------LHRVIYWGTL---TNATLNGWLFGVMNSRFRKSLKQIF-QSKSRKSETLFSTN 1188
            C ++S+L F++M  + F    +SFDRYL I   +++ +L    +  +  A++W+      + +   +  G  E+   V   +D +              L   S + GF   +TI+L   F   + ++     +R+  +++ +  + ++V+L+V   TF LCW PY      Y  G  L  P      L  +  + T     N+ LN +L+   + RFR++   +    +SR + T  S++
Sbjct:  102 CKLSSYLIFVNMYASVFCLTGLSFDRYLAIVRPVANARLRLRVSGAVATAVLWVLAALLAMPVMVLRTTGDLENTTKVQCYMDYSMVATVSSEWAWEVGLGVSSTTVGFVVPFTIMLTCYFFIAQTIAGHFRKERIEGLRKRRRLLSIIVVLVV---TFALCWMPYHLVKTLYMLGSLLHWPCDFDLFLMNIFPYCTCISYVNSCLNPFLYAFFDPRFRQACTSMLCCGQSRCAGTSHSSS 339          
BLAST of Melatonin receptor type 1A like vs. Ensembl Human
Match: APLNR (apelin receptor [Source:HGNC Symbol;Acc:HGNC:339])

HSP 1 Score: 55.8398 bits (133), Expect = 6.779e-8
Identity = 56/241 (23.24%), Postives = 108/241 (44.81%), Query Frame = 1
Query:  508 CHVNSFLTFISMGINNFIFMIISFDRYLFIFHKLSHTQLFTISNTLILIALVWLFWIGYGIALSFFKGFG-YESDAFVCFILDTNGNIXXXXXXXXXXXXXPISVSTGF---YTILLVKLFKTKRNLSIQKEFKRLSDIQRDKNEMRMVVLLIVTVGTFFLCWAPYTFHGFFYRFGGTLSAP------LHRVIYWGTL---TNATLNGWLFGVMNSRFRKSLKQIF-QSKSRKSETLFSTN 1188
            C ++S+L F++M  + F    +SFDRYL I   +++ +L    +  +  A++W+      + +   +  G  E+   V   +D +              L   S + GF   +TI+L   F   + ++     +R+  +++ +  + ++V+L+V   TF LCW PY      Y  G  L  P      L  +  + T     N+ LN +L+   + RFR++   +    +SR + T  S++
Sbjct:  102 CKLSSYLIFVNMYASVFCLTGLSFDRYLAIVRPVANARLRLRVSGAVATAVLWVLAALLAMPVMVLRTTGDLENTTKVQCYMDYSMVATVSSEWAWEVGLGVSSTTVGFVVPFTIMLTCYFFIAQTIAGHFRKERIEGLRKRRRLLSIIVVLVV---TFALCWMPYHLVKTLYMLGSLLHWPCDFDLFLMNIFPYCTCISYVNSCLNPFLYAFFDPRFRQACTSMLCCGQSRCAGTSHSSS 339          
BLAST of Melatonin receptor type 1A like vs. Ensembl Human
Match: APLNR (apelin receptor [Source:HGNC Symbol;Acc:HGNC:339])

HSP 1 Score: 55.8398 bits (133), Expect = 6.779e-8
Identity = 56/241 (23.24%), Postives = 108/241 (44.81%), Query Frame = 1
Query:  508 CHVNSFLTFISMGINNFIFMIISFDRYLFIFHKLSHTQLFTISNTLILIALVWLFWIGYGIALSFFKGFG-YESDAFVCFILDTNGNIXXXXXXXXXXXXXPISVSTGF---YTILLVKLFKTKRNLSIQKEFKRLSDIQRDKNEMRMVVLLIVTVGTFFLCWAPYTFHGFFYRFGGTLSAP------LHRVIYWGTL---TNATLNGWLFGVMNSRFRKSLKQIF-QSKSRKSETLFSTN 1188
            C ++S+L F++M  + F    +SFDRYL I   +++ +L    +  +  A++W+      + +   +  G  E+   V   +D +              L   S + GF   +TI+L   F   + ++     +R+  +++ +  + ++V+L+V   TF LCW PY      Y  G  L  P      L  +  + T     N+ LN +L+   + RFR++   +    +SR + T  S++
Sbjct:  102 CKLSSYLIFVNMYASVFCLTGLSFDRYLAIVRPVANARLRLRVSGAVATAVLWVLAALLAMPVMVLRTTGDLENTTKVQCYMDYSMVATVSSEWAWEVGLGVSSTTVGFVVPFTIMLTCYFFIAQTIAGHFRKERIEGLRKRRRLLSIIVVLVV---TFALCWMPYHLVKTLYMLGSLLHWPCDFDLFLMNIFPYCTCISYVNSCLNPFLYAFFDPRFRQACTSMLCCGQSRCAGTSHSSS 339          
BLAST of Melatonin receptor type 1A like vs. Ensembl Celegans
Match: npr-35 (NeuroPeptide Receptor family [Source:UniProtKB/TrEMBL;Acc:Q7YXG8])

HSP 1 Score: 60.077 bits (144), Expect = 1.094e-9
Identity = 68/287 (23.69%), Postives = 136/287 (47.39%), Query Frame = 1
Query:  331 GILFNLCVPFAISVDKKLWXXXXXXXXXXXXVDLMVCCYILPVTLANRILSRNVMGYIGCHVNSFLTFISMGINNFIFMIISFDRYLFIFHKLSHTQLFTISNTLILIALVWLF--------WIGYGIALSFFKGFGYESDAFVCFILDTNGNIXXXXXXXXXXXXXPISVSTGFYTILLVKLFKTKRNLSIQKEFKRLSDIQRDKNEMRMVVLLIVTVGTFFLCWAP-YTFHGFFYRFGG------TLSAPLHRVIY-WGTLTNATLNGWLFGVMNSRFRKSLKQI 1143
            G+L N  V  A+   K L I++++LIL++ + DL +    LP TL N I +  + G   C ++++    +   + +  + ++ DRYL I H L +   +    T  +I  VWL         W  Y + +     +GY     +C    T+  +  LF   +  F++P  + +G YT + + +  T R+L++    +       D+ ++R+  +++  +  F  CW P Y    +F+ F         +++ L R I+ W +L +++LN  ++   + ++R++ K I
Sbjct:   43 GVLGNTFVVLAVWAHKNLNITTDYLILSLALADLFILWICLPTTLINSIFTEWLWGQFFCRLSTWANASTSFASVYTLVAVTADRYLAICHTLKYNTSWDREYTKYVIFAVWLVAAIFGIPNWYNYDLIVWQEGSYGYR----LC-TSQTDQKLYFLFVNLLLAFIVPFGLISGLYTRIFITV-STHRSLAVDARAR------EDRVKLRVATMMLTVIIVFACCWLPLYCIFTYFFFFADQRSDLFQITSMLIRPIFQWMSLLSSSLNPIIYIAYSHKYRRAFKSI 317          
BLAST of Melatonin receptor type 1A like vs. Ensembl Fly
Match: TkR99D (gene:FBgn0004622 transcript:FBtr0301656)

HSP 1 Score: 55.4546 bits (132), Expect = 6.267e-8
Identity = 64/240 (26.67%), Postives = 110/240 (45.83%), Query Frame = 1
Query:  496 GYIGCHVNSFLTFISMGINNFIFMIISFDRYLFIFHKLSHTQLFTISNTLILIALVWL--------FWIGYGIALSFFKGFGYESDAFVCFILDTNGNIXXXXXXXXXXXX-------XPISVSTGFYTILLVKLFKTKRNLSIQKEFKRLSDIQRDKNEMRMVVLLIVTVGTFFLCWAPYTFHGFF---YRFGGTLSAP----LHRVIYWGTLTNATLNGWLFGVMNSRFRKSLKQIFQ 1149
            G   C ++ F+  +S+  + F  M IS DRY+ I   L   ++    N L + A++WL          I Y       +G    S+  VC+    +G        +++N L       LPI   T  Y+ + ++L+ +K   +I +   R   ++  +++ R+V ++IV V  F +CW P  FH +F     +     AP    L+  IYW  ++N+  N  ++  MNSRFR   K +F+
Sbjct:  170 GEFYCKLSQFIAMLSICASVFTLMAISIDRYVAIIRPL-QPRMSKRCN-LAIAAVIWLASTLISCPMMIIYRTEEVPVRGL---SNRTVCYPEWPDGPTNHSTMESLYNILIIILTYFLPIVSMTVTYSRVGIELWGSK---TIGECTPR--QVENVRSKRRVVKMMIVVVLIFAICWLP--FHSYFIITSCYPAITEAPFIQELYLAIYWLAMSNSMYNPIIYCWMNSRFRYGFKMVFR 397          
BLAST of Melatonin receptor type 1A like vs. Ensembl Fly
Match: TkR99D (gene:FBgn0004622 transcript:FBtr0085507)

HSP 1 Score: 55.0694 bits (131), Expect = 7.104e-8
Identity = 64/240 (26.67%), Postives = 110/240 (45.83%), Query Frame = 1
Query:  496 GYIGCHVNSFLTFISMGINNFIFMIISFDRYLFIFHKLSHTQLFTISNTLILIALVWL--------FWIGYGIALSFFKGFGYESDAFVCFILDTNGNIXXXXXXXXXXXX-------XPISVSTGFYTILLVKLFKTKRNLSIQKEFKRLSDIQRDKNEMRMVVLLIVTVGTFFLCWAPYTFHGFF---YRFGGTLSAP----LHRVIYWGTLTNATLNGWLFGVMNSRFRKSLKQIFQ 1149
            G   C ++ F+  +S+  + F  M IS DRY+ I   L   ++    N L + A++WL          I Y       +G    S+  VC+    +G        +++N L       LPI   T  Y+ + ++L+ +K   +I +   R   ++  +++ R+V ++IV V  F +CW P  FH +F     +     AP    L+  IYW  ++N+  N  ++  MNSRFR   K +F+
Sbjct:  170 GEFYCKLSQFIAMLSICASVFTLMAISIDRYVAIIRPL-QPRMSKRCN-LAIAAVIWLASTLISCPMMIIYRTEEVPVRGL---SNRTVCYPEWPDGPTNHSTMESLYNILIIILTYFLPIVSMTVTYSRVGIELWGSK---TIGECTPR--QVENVRSKRRVVKMMIVVVLIFAICWLP--FHSYFIITSCYPAITEAPFIQELYLAIYWLAMSNSMYNPIIYCWMNSRFRYGFKMVFR 397          
BLAST of Melatonin receptor type 1A like vs. Ensembl Fly
Match: TkR99D (gene:FBgn0004622 transcript:FBtr0330298)

HSP 1 Score: 55.0694 bits (131), Expect = 8.283e-8
Identity = 64/240 (26.67%), Postives = 110/240 (45.83%), Query Frame = 1
Query:  496 GYIGCHVNSFLTFISMGINNFIFMIISFDRYLFIFHKLSHTQLFTISNTLILIALVWL--------FWIGYGIALSFFKGFGYESDAFVCFILDTNGNIXXXXXXXXXXXX-------XPISVSTGFYTILLVKLFKTKRNLSIQKEFKRLSDIQRDKNEMRMVVLLIVTVGTFFLCWAPYTFHGFF---YRFGGTLSAP----LHRVIYWGTLTNATLNGWLFGVMNSRFRKSLKQIFQ 1149
            G   C ++ F+  +S+  + F  M IS DRY+ I   L   ++    N L + A++WL          I Y       +G    S+  VC+    +G        +++N L       LPI   T  Y+ + ++L+ +K   +I +   R   ++  +++ R+V ++IV V  F +CW P  FH +F     +     AP    L+  IYW  ++N+  N  ++  MNSRFR   K +F+
Sbjct:  170 GEFYCKLSQFIAMLSICASVFTLMAISIDRYVAIIRPL-QPRMSKRCN-LAIAAVIWLASTLISCPMMIIYRTEEVPVRGL---SNRTVCYPEWPDGPTNHSTMESLYNILIIILTYFLPIVSMTVTYSRVGIELWGSK---TIGECTPR--QVENVRSKRRVVKMMIVVVLIFAICWLP--FHSYFIITSCYPAITEAPFIQELYLAIYWLAMSNSMYNPIIYCWMNSRFRYGFKMVFR 397          
BLAST of Melatonin receptor type 1A like vs. Ensembl Zebrafish
Match: mtnr1al (melatonin receptor type 1A like [Source:NCBI gene;Acc:30660])

HSP 1 Score: 85.1149 bits (209), Expect = 7.869e-18
Identity = 76/284 (26.76%), Postives = 136/284 (47.89%), Query Frame = 1
Query:  304 TYLCINIVLGILFNLCVPFAISVDKKLWXXXXXXXXXXXXVDLMVCCYILPVTLANRILSRNVMGYIGCHVNSFLTFISMGINNFIFMIISFDRYLFIFHKLSHTQLFTISNTLILIALVWLFWIGYGIALSFFKGFGYESDAFVCFILDTNGNIXXXXXXXXXXXXXPISVSTGFYTILLVKLFKTKRNLSIQKEFKRLSDIQRDKNEMRMVVLLIVTVGTFFLCWAPYTFHGFFY----RFGGTLSAPLHRVIYWGTLTNATLNGWLFGVMNSRFRKSLKQI 1143
            + L   IV+ +L NL V  ++  ++KL  + N  ++++ I DL+V  Y  P+ L      R + G I C ++ FL  +S+  + F    I+ +RY +I H L + +LF+  NT+  + LVW   +   +   F +   Y+   F C    +  ++     + V +F++PI + T  Y  + + + + +R +      K  S  +   ++ R  + + V    F +CWAP  F G       R G ++   L    Y+    N+ LNG ++GV+N  FRK  K+I
Sbjct:   59 SVLITTIVVDVLGNLLVIVSVFRNRKLRKAGNAFVVSLAIADLLVAIYPYPLVLTAIFHDRWIAGDIHCQISGFLMGLSVIGSIFNITGIAINRYCYICHSLKYDKLFSNKNTVCYVILVWALTVLAIVPNWFVESLQYDPRVFSCTFAQSVSSL-YTIMVVVVHFIVPIGIVTYCYLRIWILVIQVRRRV------KPDSRPKIKPHDFRNFLTMFVVFVLFAVCWAPLNFIGLAVAIHPRLGQSIPEWLFTASYFMAYFNSCLNGVIYGVLNHNFRKEYKRI 335          
BLAST of Melatonin receptor type 1A like vs. Ensembl Zebrafish
Match: mtnr1ab (melatonin receptor 1A b [Source:ZFIN;Acc:ZDB-GENE-080107-4])

HSP 1 Score: 83.1889 bits (204), Expect = 3.920e-17
Identity = 76/289 (26.30%), Postives = 144/289 (49.83%), Query Frame = 1
Query:  304 TYLCINIVLGILFNLCVPFAISVDKKLWXXXXXXXXXXXXVDLMVCCYILPVTLANRILSRNVMGYIGCHVNSFLTFISMGINNFIFMIISFDRYLFIFHKLSHTQLFTISNTLILIALVWLFWIGYGIALSFFKG-FGYESDAFVCFILDTNGNIXXXXXXXXXXXXXPISVSTGFYTILLVKLFKTKRNLSIQKEFKRLSDIQRDKNEMRMVVLLIVTVGTFFLCWAPYTFHGFFYRFGGTLSAPLHR-----VIYWGTLTNATLNGWLFGVMNSRFRKSLKQIFQS 1152
            ++L   IV+ IL NL V F++  +KKL  + N  ++++ + DL+V  Y  P+ L + I +   +G++ C ++ FL  +S+  + F    I+ +RY +I H L + +L++  N+L  + L+W+  +   I  +F+ G   Y+   + C    +  +      +  F+F+LPI + T  Y  + + + + +R   ++ EF+     +   +++R  V + V    F +CWAP  F G          APL         Y+    N+ LN  ++G++N  FR+  K+I  S
Sbjct:   34 SFLIFTIVVDILGNLLVIFSVYRNKKLRNAGNIFVVSLAVADLVVAIYPYPLVLVSIIHNGWNLGFVHCQISGFLMGLSVIGSIFNITGIAINRYCYICHSLKYDKLYSDKNSLCYVLLIWILTV-VAIVPNFYVGSLQYDPRVYSCTFAQSASS-AYTIAVVFFHFILPIMIVTYCYLRIWILVIQVRRR--VKPEFRP----KLTPHDIRNFVTMFVVFVLFAVCWAPLNFIGLAVAINPDQVAPLIPEWFFVSSYFMAYFNSCLNAIVYGLLNQNFRREYKKIIIS 314          
BLAST of Melatonin receptor type 1A like vs. Ensembl Zebrafish
Match: AL929336.1 (melatonin receptor 1A b [Source:NCBI gene;Acc:565718])

HSP 1 Score: 81.2629 bits (199), Expect = 1.791e-16
Identity = 75/289 (25.95%), Postives = 143/289 (49.48%), Query Frame = 1
Query:  304 TYLCINIVLGILFNLCVPFAISVDKKLWXXXXXXXXXXXXVDLMVCCYILPVTLANRILSRNVMGYIGCHVNSFLTFISMGINNFIFMIISFDRYLFIFHKLSHTQLFTISNTLILIALVWLFWIGYGIALSFFKG-FGYESDAFVCFILDTNGNIXXXXXXXXXXXXXPISVSTGFYTILLVKLFKTKRNLSIQKEFKRLSDIQRDKNEMRMVVLLIVTVGTFFLCWAPYTFHGFFYRFGGTLSAPLHR-----VIYWGTLTNATLNGWLFGVMNSRFRKSLKQIFQS 1152
            ++L   IV+ IL NL V F++  +KKL  + N  ++++ + DL+V  Y  P+ L +   +   +G++ C ++ FL  +S+  + F    I+ +RY +I H L + +L++  N+L  + L+W+  +   I  +F+ G   Y+   + C    +  +      +  F+F+LPI + T  Y  + + + + +R   ++ EF+     +   +++R  V + V    F +CWAP  F G          APL         Y+    N+ LN  ++G++N  FR+  K+I  S
Sbjct:   34 SFLIFTIVVDILGNLLVIFSVYRNKKLRNAGNIFVVSLAVADLVVAIYPYPLVLVSIFHNGWNLGFVHCQISGFLMGLSVIGSIFNITGIAINRYCYICHSLKYDKLYSDKNSLCYVLLIWILTV-VAIVPNFYVGSLQYDPRVYSCTFAQSASS-AYTIAVVFFHFILPIMIVTYCYLRIWILVIQVRRR--VKPEFRP----KLTPHDIRNFVTMFVVFVLFAVCWAPLNFIGLAVAINPDQVAPLIPEWFFVSSYFMAYFNSCLNAIVYGLLNQNFRREYKKIIIS 314          
BLAST of Melatonin receptor type 1A like vs. Ensembl Zebrafish
Match: mtnr1aa (melatonin receptor 1A a [Source:NCBI gene;Acc:30667])

HSP 1 Score: 78.9518 bits (193), Expect = 9.023e-16
Identity = 75/290 (25.86%), Postives = 135/290 (46.55%), Query Frame = 1
Query:  307 YLCINIVLGILFNLCVPFAISVDKKLWXXXXXXXXXXXXVDLMVCCYILPVTLANRILSRNVMGYIGCHVNSFLTFISMGINNFIFMIISFDRYLFIFHKLSHTQLFTISNTLILIALVWLFWIGYGIALSFFKGFGYESDAFVCFILDTNGNIXXXXXXXXXXXXXPISVSTGFYTILLVKLFKTKRNLSIQKEFKRLSDIQRDK---NEMRMVVLLIVTVGTFFLCWAPYTFHGFFYRFGGTLSAPLHR-----VIYWGTLTNATLNGWLFGVMNSRFRKSLKQIFQS 1152
            +L   IV+ IL NL V F++  +KKL  + N  ++++ + DL+V  Y  P+ L +       +GY+ C ++ FL  +S+  + F    I+ +RY +I H L + +L++  N++  + L+W   +   +   F     Y+   + C   + + +      +  F+F+LPI + T  Y  + V + + +R         R+    R K   +++R  V + V    F +CWAP  F G           PL         Y+    N+ LN  ++GV+N  FR+  K+I  S
Sbjct:   33 FLIFTIVVDILGNLLVIFSVYRNKKLRNAGNIFVVSLAVADLVVAIYPYPLVLTSIFHRGWNLGYMHCQISGFLMGVSVIGSIFNITGIAINRYCYICHSLKYDKLYSDKNSVCYVLLIWALTVLAIVPNLFVGSLQYDPRVYSC-TFEQSASSAYTIAVVFFHFILPIMIVTYCYLRIWVLVIQVRR---------RVKPDNRPKITPHDVRNFVTMFVVFVLFAVCWAPLNFIGLAVAISPERVVPLIPEWLFVASYFMAYFNSCLNAIVYGVLNQNFRREYKRIVVS 312          
BLAST of Melatonin receptor type 1A like vs. Ensembl Zebrafish
Match: mtnr1aa (melatonin receptor 1A a [Source:NCBI gene;Acc:30667])

HSP 1 Score: 78.9518 bits (193), Expect = 9.023e-16
Identity = 75/290 (25.86%), Postives = 135/290 (46.55%), Query Frame = 1
Query:  307 YLCINIVLGILFNLCVPFAISVDKKLWXXXXXXXXXXXXVDLMVCCYILPVTLANRILSRNVMGYIGCHVNSFLTFISMGINNFIFMIISFDRYLFIFHKLSHTQLFTISNTLILIALVWLFWIGYGIALSFFKGFGYESDAFVCFILDTNGNIXXXXXXXXXXXXXPISVSTGFYTILLVKLFKTKRNLSIQKEFKRLSDIQRDK---NEMRMVVLLIVTVGTFFLCWAPYTFHGFFYRFGGTLSAPLHR-----VIYWGTLTNATLNGWLFGVMNSRFRKSLKQIFQS 1152
            +L   IV+ IL NL V F++  +KKL  + N  ++++ + DL+V  Y  P+ L +       +GY+ C ++ FL  +S+  + F    I+ +RY +I H L + +L++  N++  + L+W   +   +   F     Y+   + C   + + +      +  F+F+LPI + T  Y  + V + + +R         R+    R K   +++R  V + V    F +CWAP  F G           PL         Y+    N+ LN  ++GV+N  FR+  K+I  S
Sbjct:   33 FLIFTIVVDILGNLLVIFSVYRNKKLRNAGNIFVVSLAVADLVVAIYPYPLVLTSIFHRGWNLGYMHCQISGFLMGVSVIGSIFNITGIAINRYCYICHSLKYDKLYSDKNSVCYVLLIWALTVLAIVPNLFVGSLQYDPRVYSC-TFEQSASSAYTIAVVFFHFILPIMIVTYCYLRIWVLVIQVRR---------RVKPDNRPKITPHDVRNFVTMFVVFVLFAVCWAPLNFIGLAVAISPERVVPLIPEWLFVASYFMAYFNSCLNAIVYGVLNQNFRREYKRIVVS 312          
BLAST of Melatonin receptor type 1A like vs. Ensembl Xenopus
Match: yod1 (YOD1 deubiquitinase [Source:Xenbase;Acc:XB-GENE-998960])

HSP 1 Score: 80.8777 bits (198), Expect = 3.288e-16
Identity = 83/295 (28.14%), Postives = 139/295 (47.12%), Query Frame = 1
Query:  286 LYSQDITYLCINIVLGILFNLCVPFAISVDKKLWXXXXXXXXXXXXVDLMVCCYILPVTLANRILSRNVMGYIGCHVNSFLTFISMGINNFIFMIISFDRYLFIFHKLSHTQLFTISNTLILIALVWLFWIGYGIALSFFKG-FGYESDAFVCFILDTNGNIXXXXXXXXXXXXXPISVSTGFYTILLVKLFKTKRNLSIQKEFKRLSDIQRDKNEMRMVVLLIVTVGTFFLCWAPYTFHGFFYRFGGTLSAP-----LHRVIYWGTLTNATLNGWLFGVMNSRFRKSLKQIFQS 1152
            L S     L   IV+ +L N+ V  ++  +KKL  + N  ++++ + DL+V  Y  PV L     +   +G I C ++ FL  +S+  + F    I+ +RY +I H L + +LF   +T   + L W+  I   I  +FF G   Y+   F C    T  +      + V +F++P+SV T  Y  + V + + K    ++ +FK+       +N + M V+ ++    F +CWAP  F G          AP     L  V Y+    N+ LN  ++G++N  FRK  K+I  S
Sbjct:   23 LTSALAVVLIFTIVVDVLGNMLVILSVLRNKKLQNAGNLFVVSLSVADLVVAVYPYPVILIAIFQNGWTLGNIHCQISGFLMGLSVIGSVFNITAIAINRYCYICHSLRYDKLFNQKSTWCYLGLTWILTI-IAIVPNFFVGSLQYDPRIFSCTFAQTVSS-SYTITVVVVHFIVPLSVVTFCYLRIWVLVIQVKHR--VRHDFKQKLTPTDLRNFLTMFVVFVL----FAVCWAPLNFIGLAVAINPLHVAPKIPEWLFVVSYFMAYFNSCLNAVIYGLLNQNFRKEYKRILMS 309          
BLAST of Melatonin receptor type 1A like vs. Ensembl Xenopus
Match: yod1 (YOD1 deubiquitinase [Source:Xenbase;Acc:XB-GENE-998960])

HSP 1 Score: 81.2629 bits (199), Expect = 3.293e-16
Identity = 80/283 (28.27%), Postives = 136/283 (48.06%), Query Frame = 1
Query:  322 IVLGILFNLCVPFAISVDKKLWXXXXXXXXXXXXVDLMVCCYILPVTLANRILSRNVMGYIGCHVNSFLTFISMGINNFIFMIISFDRYLFIFHKLSHTQLFTISNTLILIALVWLFWIGYGIALSFFKG-FGYESDAFVCFILDTNGNIXXXXXXXXXXXXXPISVSTGFYTILLVKLFKTKRNLSIQKEFKRLSDIQRDKNEMRMVVLLIVTVGTFFLCWAPYTFHGFFYRFGGTLSAP-----LHRVIYWGTLTNATLNGWLFGVMNSRFRKSLKQIFQS 1152
            IV+ +L N+ V  ++  +KKL  + N  ++++ + DL+V  Y  PV L     +   +G I C ++ FL  +S+  + F    I+ +RY +I H L + +LF   +T   + L W+  I   I  +FF G   Y+   F C    T  +      + V +F++P+SV T  Y  + V + + K    ++ +FK+       +N + M V+ ++    F +CWAP  F G          AP     L  V Y+    N+ LN  ++G++N  FRK  K+I  S
Sbjct:   43 IVVDVLGNMLVILSVLRNKKLQNAGNLFVVSLSVADLVVAVYPYPVILIAIFQNGWTLGNIHCQISGFLMGLSVIGSVFNITAIAINRYCYICHSLRYDKLFNQKSTWCYLGLTWILTI-IAIVPNFFVGSLQYDPRIFSCTFAQTVSS-SYTITVVVVHFIVPLSVVTFCYLRIWVLVIQVKHR--VRHDFKQKLTPTDLRNFLTMFVVFVL----FAVCWAPLNFIGLAVAINPLHVAPKIPEWLFVVSYFMAYFNSCLNAVIYGLLNQNFRKEYKRILMS 317          
BLAST of Melatonin receptor type 1A like vs. Ensembl Xenopus
Match: ENSXETT00000016998.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:2:162859891:162958644:-1 gene:ENSXETG00000009082.1 transcript:ENSXETT00000016998.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 77.411 bits (189), Expect = 5.415e-15
Identity = 71/281 (25.27%), Postives = 134/281 (47.69%), Query Frame = 1
Query:  325 VLGILFNLCVPFAISVDKKLWXXXXXXXXXXXXVDLMVCCYILPVTLANRILSRNVMGYIGCHVNSFLTFISMGINNFIFMIISFDRYLFIFHKLSHTQLFTISNTLILIALVWLFWIGYGIALSFFKGFGYESDAFVCFILDTNGNIXXXXXXXXXXXXXPISVSTGFYTILLVKLFKTKRNLSIQKEFKRLSDIQRDKNEMRMVVLLIVTVGTFFLCWAPYTFHGFFYRFGGTLSAP-----LHRVIYWGTLTNATLNGWLFGVMNSRFRKSLKQIFQS 1152
            V+ I+ +L V  ++  ++KL  S N  ++++ + DL+V  Y  P+ L     +   MG + C V+ F+  +S+  + F    I+ +RY +I H   + +LF++ NT++ + L+W   +   +   F     Y+   + C  + T  +      + V +F++PI+V T  Y  + + + + +R   ++ E K        +N + M V+ ++    F  CWAP    G       T  AP     L  + Y+    N+ LN  ++G++N  FRK  K+I  S
Sbjct:   43 VVDIIGSLLVIISVLKNRKLRNSGNAFVVSLALADLVVALYPYPLVLVAIFKNEWAMGEMHCKVSGFVMGLSVIGSIFNITGIAINRYCYICHSFVYDKLFSLWNTILYVCLIWTLTVVATVPNFFVGSLEYDPRIYSCTFVQTVSS-SYTITVVVIHFIVPITVVTFCYLRIWILVIQVRRK--VKSEIKPRMKQSDFRNFLTMFVVFVI----FAFCWAPLNVIGLAVSISPTEVAPKIPEWLFVLSYFMAYFNSCLNAIIYGLLNQNFRKEYKRILMS 316          
BLAST of Melatonin receptor type 1A like vs. Ensembl Xenopus
Match: ENSXETT00000017006.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:2:162859701:162958482:-1 gene:ENSXETG00000009082.1 transcript:ENSXETT00000017006.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 77.411 bits (189), Expect = 6.381e-15
Identity = 71/281 (25.27%), Postives = 134/281 (47.69%), Query Frame = 1
Query:  325 VLGILFNLCVPFAISVDKKLWXXXXXXXXXXXXVDLMVCCYILPVTLANRILSRNVMGYIGCHVNSFLTFISMGINNFIFMIISFDRYLFIFHKLSHTQLFTISNTLILIALVWLFWIGYGIALSFFKGFGYESDAFVCFILDTNGNIXXXXXXXXXXXXXPISVSTGFYTILLVKLFKTKRNLSIQKEFKRLSDIQRDKNEMRMVVLLIVTVGTFFLCWAPYTFHGFFYRFGGTLSAP-----LHRVIYWGTLTNATLNGWLFGVMNSRFRKSLKQIFQS 1152
            V+ I+ +L V  ++  ++KL  S N  ++++ + DL+V  Y  P+ L     +   MG + C V+ F+  +S+  + F    I+ +RY +I H   + +LF++ NT++ + L+W   +   +   F     Y+   + C  + T  +      + V +F++PI+V T  Y  + + + + +R   ++ E K        +N + M V+ ++    F  CWAP    G       T  AP     L  + Y+    N+ LN  ++G++N  FRK  K+I  S
Sbjct:   39 VVDIIGSLLVIISVLKNRKLRNSGNAFVVSLALADLVVALYPYPLVLVAIFKNEWAMGEMHCKVSGFVMGLSVIGSIFNITGIAINRYCYICHSFVYDKLFSLWNTILYVCLIWTLTVVATVPNFFVGSLEYDPRIYSCTFVQTVSS-SYTITVVVIHFIVPITVVTFCYLRIWILVIQVRRK--VKSEIKPRMKQSDFRNFLTMFVVFVI----FAFCWAPLNVIGLAVSISPTEVAPKIPEWLFVLSYFMAYFNSCLNAIIYGLLNQNFRKEYKRILMS 312          
BLAST of Melatonin receptor type 1A like vs. Ensembl Xenopus
Match: ENSXETT00000017012.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:2:162859292:162958644:-1 gene:ENSXETG00000009082.1 transcript:ENSXETT00000017012.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 77.0258 bits (188), Expect = 7.141e-15
Identity = 71/281 (25.27%), Postives = 134/281 (47.69%), Query Frame = 1
Query:  325 VLGILFNLCVPFAISVDKKLWXXXXXXXXXXXXVDLMVCCYILPVTLANRILSRNVMGYIGCHVNSFLTFISMGINNFIFMIISFDRYLFIFHKLSHTQLFTISNTLILIALVWLFWIGYGIALSFFKGFGYESDAFVCFILDTNGNIXXXXXXXXXXXXXPISVSTGFYTILLVKLFKTKRNLSIQKEFKRLSDIQRDKNEMRMVVLLIVTVGTFFLCWAPYTFHGFFYRFGGTLSAP-----LHRVIYWGTLTNATLNGWLFGVMNSRFRKSLKQIFQS 1152
            V+ I+ +L V  ++  ++KL  S N  ++++ + DL+V  Y  P+ L     +   MG + C V+ F+  +S+  + F    I+ +RY +I H   + +LF++ NT++ + L+W   +   +   F     Y+   + C  + T  +      + V +F++PI+V T  Y  + + + + +R   ++ E K        +N + M V+ ++    F  CWAP    G       T  AP     L  + Y+    N+ LN  ++G++N  FRK  K+I  S
Sbjct:   43 VVDIIGSLLVIISVLKNRKLRNSGNAFVVSLALADLVVALYPYPLVLVAIFKNEWAMGEMHCKVSGFVMGLSVIGSIFNITGIAINRYCYICHSFVYDKLFSLWNTILYVCLIWTLTVVATVPNFFVGSLEYDPRIYSCTFVQTVSS-SYTITVVVIHFIVPITVVTFCYLRIWILVIQVRRK--VKSEIKPRMKQSDFRNFLTMFVVFVI----FAFCWAPLNVIGLAVSISPTEVAPKIPEWLFVLSYFMAYFNSCLNAIIYGLLNQNFRKEYKRILMS 316          
BLAST of Melatonin receptor type 1A like vs. Ensembl Mouse
Match: Mtnr1a (melatonin receptor 1A [Source:MGI Symbol;Acc:MGI:102967])

HSP 1 Score: 66.6254 bits (161), Expect = 1.169e-11
Identity = 72/283 (25.44%), Postives = 137/283 (48.41%), Query Frame = 1
Query:  322 IVLGILFNLCVPFAISVDKKLWXXXXXXXXXXXXVDLMVCCYILPVTLANRILSRNVMGYIGCHVNSFLTFISMGINNFIFMIISFDRYLFIFHKLSHTQLFTISNTLILIALVWLFWIGYGIALSFFKG-FGYESDAFVCFILDTNGNIXXXXXXXXXXXXXPISVSTGFYTILLVKLFKTKRNLSIQKEFKRLSDIQRDKNEMRMVVLLIVTVGTFFLCWAPYTFHGFFYRFGGTLSAP-----LHRVIYWGTLTNATLNGWLFGVMNSRFRKSLKQIFQS 1152
            IV+ IL NL V  ++  +KKL  S N  ++++ + DL+V  Y  P+ L + + +   +GY+ C V++FL  +S+  + F    I+ +RY +I H L + ++++  N+L  + L+W+  +   I  +   G   Y+   + C    +  +      + VF+F++P+ +    Y  + V + + +R   ++ + K     Q  +N + M V+ ++    F +CWAP    G           P     L    Y+    N+ LN  ++G++N  FRK  K+I  S
Sbjct:   41 IVVDILGNLLVILSVYRNKKLRNSGNIFVVSLAVADLVVAVYPYPLVLTSILNNGWNLGYLHCQVSAFLMGLSVIGSIFNITGIAMNRYCYICHSLKYDKIYSNKNSLCYVFLIWMLTL-IAIMPNLQTGTLQYDPRIYSCTFTQSVSS-AYTIAVVVFHFIVPMIIVIFCYLRIWVLVLQVRRR--VKPDNKPKLKPQDFRNFVTMFVVFVL----FAICWAPLNLIGLIVASDPATMVPRIPEWLFVASYYLAYFNSCLNAIIYGLLNQNFRKEYKKIIVS 315          
BLAST of Melatonin receptor type 1A like vs. Ensembl Mouse
Match: Hrh2 (histamine receptor H2 [Source:MGI Symbol;Acc:MGI:108482])

HSP 1 Score: 59.6918 bits (143), Expect = 2.509e-9
Identity = 68/287 (23.69%), Postives = 121/287 (42.16%), Query Frame = 1
Query:  322 IVLGILFNLCVPFAISVDKKLWXXXXXXXXXXXXVDLMVCCYILPVTLANRILSRNVMGYIGCHVNSFLTFISMGINNFIFMIISFDRYLFIFHKLSHTQLFTISNTLILIALVWLFWIGYGIALSFFK-GFGYESDAFVCFILDTNGNIXXXXXXXXXXXXXPISVSTGFYTILLVKLFKTKRNLSIQKE-FKRLSDIQRDK----NEMRMVVLLIVTVGTFFLCWAPYTFHGFFY---RFGGTLSAPLHRVIYWGTLTNATLNGWLFGVMNSRFRKSLKQIFQSK 1155
            I + +  N+ V  A+S++++L   +N  I+++   DL++   ++P +   ++  +   G + C++ + L  +    +     +IS DRY  +   L +  L T     I +  +W+      I LSF     G+ S           GN      + V      +     FY  LL+      R   I +E  KR++ I   K     E +  V L   +G F +CW PY F  F Y   R    ++  +  ++ W    N+ LN  L+  +N  FR + +Q+F  K
Sbjct:   29 IFITVAGNVVVCLAVSLNRRLRSLTNCFIVSLAATDLLLGLLVMPFSAIYQLSFKWSFGQVFCNIYTSLDVMLCTASILNLFMISLDRYCAVTDPLRYPVLVTPVRVAISLVFIWVI----SITLSFLSIHLGWNSRNGT-----RGGNDTFKCKVQVNEVYGLVDGMVTFYLPLLIMCVTYYRIFKIAREQAKRINHISSWKAATIREHKATVTLAAVMGAFIVCWFPY-FTAFVYRGLRGDDAVNEVVEGIVLWLGYANSALNPILYATLNRDFRMAYQQLFHCK 305          
BLAST of Melatonin receptor type 1A like vs. Ensembl Mouse
Match: Mtnr1b (melatonin receptor 1B [Source:MGI Symbol;Acc:MGI:2181726])

HSP 1 Score: 59.3066 bits (142), Expect = 2.974e-9
Identity = 66/274 (24.09%), Postives = 128/274 (46.72%), Query Frame = 1
Query:  343 NLCVPFAISVDKKLWXXXXXXXXXXXXVDLMVCCYILPVTLANRILSRNVMGYIGCHVNSFLTFISMGINNFIFMIISFDRYLFIFHKLSHTQLFTISNTLILIALVWLFWIGYGIALSFFKGFGYESDAFVCFILDTNGNIXXXXXXXXXXXXXPISVSTGFYTILLVKLFKTKRNLSIQKEFK-RLSDIQRDKNEMRMVVLLIVTVGTFFLCWAPYTFHGFFYRFGG---TLSAP--LHRVIYWGTLTNATLNGWLFGVMNSRFRKSLKQIF 1146
            NL V  ++  ++KL  + N  ++++ + DL++  Y  P+ L   I    V+G   C  ++F+  +S+  + F    I+ +RY  I H  ++ ++ +   T I I+LVWL  +   +   F     Y+   + C  + T  +      +   +FLLP++V +  Y  + V + + +R    +++ + R SD+   ++ + M  + +V    F +CWAP    G           L  P  L    Y+    N+ LN  ++G++N  FR+  K+I 
Sbjct:   58 NLLVILSVLRNRKLRNAGNLFVVSLALADLVIALYPYPLILVAIIRDGWVLGEAHCKASAFVMGLSVIGSVFNITAIAINRYCCICHSTTYHRVCSHWYTPIYISLVWLLTLVALVPNFFVGSLEYDPRIYSCTFIQT-ASTQYTAAVVAIHFLLPMAVVSFCYLRIWVLVLQARRKAKAERKLRLRPSDL---RSFLTMFAVFVV----FAICWAPLNCIGLAVAINPEAMALQVPEGLFVTSYFLAYFNSCLNAIVYGLLNQNFRREYKRIL 323          
BLAST of Melatonin receptor type 1A like vs. Ensembl Mouse
Match: Mtnr1b (melatonin receptor 1B [Source:MGI Symbol;Acc:MGI:2181726])

HSP 1 Score: 59.3066 bits (142), Expect = 2.974e-9
Identity = 66/274 (24.09%), Postives = 128/274 (46.72%), Query Frame = 1
Query:  343 NLCVPFAISVDKKLWXXXXXXXXXXXXVDLMVCCYILPVTLANRILSRNVMGYIGCHVNSFLTFISMGINNFIFMIISFDRYLFIFHKLSHTQLFTISNTLILIALVWLFWIGYGIALSFFKGFGYESDAFVCFILDTNGNIXXXXXXXXXXXXXPISVSTGFYTILLVKLFKTKRNLSIQKEFK-RLSDIQRDKNEMRMVVLLIVTVGTFFLCWAPYTFHGFFYRFGG---TLSAP--LHRVIYWGTLTNATLNGWLFGVMNSRFRKSLKQIF 1146
            NL V  ++  ++KL  + N  ++++ + DL++  Y  P+ L   I    V+G   C  ++F+  +S+  + F    I+ +RY  I H  ++ ++ +   T I I+LVWL  +   +   F     Y+   + C  + T  +      +   +FLLP++V +  Y  + V + + +R    +++ + R SD+   ++ + M  + +V    F +CWAP    G           L  P  L    Y+    N+ LN  ++G++N  FR+  K+I 
Sbjct:   58 NLLVILSVLRNRKLRNAGNLFVVSLALADLVIALYPYPLILVAIIRDGWVLGEAHCKASAFVMGLSVIGSVFNITAIAINRYCCICHSTTYHRVCSHWYTPIYISLVWLLTLVALVPNFFVGSLEYDPRIYSCTFIQT-ASTQYTAAVVAIHFLLPMAVVSFCYLRIWVLVLQARRKAKAERKLRLRPSDL---RSFLTMFAVFVV----FAICWAPLNCIGLAVAINPEAMALQVPEGLFVTSYFLAYFNSCLNAIVYGLLNQNFRREYKRIL 323          
BLAST of Melatonin receptor type 1A like vs. Ensembl Mouse
Match: Hrh2 (histamine receptor H2 [Source:MGI Symbol;Acc:MGI:108482])

HSP 1 Score: 59.3066 bits (142), Expect = 3.300e-9
Identity = 68/287 (23.69%), Postives = 121/287 (42.16%), Query Frame = 1
Query:  322 IVLGILFNLCVPFAISVDKKLWXXXXXXXXXXXXVDLMVCCYILPVTLANRILSRNVMGYIGCHVNSFLTFISMGINNFIFMIISFDRYLFIFHKLSHTQLFTISNTLILIALVWLFWIGYGIALSFFK-GFGYESDAFVCFILDTNGNIXXXXXXXXXXXXXPISVSTGFYTILLVKLFKTKRNLSIQKE-FKRLSDIQRDK----NEMRMVVLLIVTVGTFFLCWAPYTFHGFFY---RFGGTLSAPLHRVIYWGTLTNATLNGWLFGVMNSRFRKSLKQIFQSK 1155
            I + +  N+ V  A+S++++L   +N  I+++   DL++   ++P +   ++  +   G + C++ + L  +    +     +IS DRY  +   L +  L T     I +  +W+      I LSF     G+ S           GN      + V      +     FY  LL+      R   I +E  KR++ I   K     E +  V L   +G F +CW PY F  F Y   R    ++  +  ++ W    N+ LN  L+  +N  FR + +Q+F  K
Sbjct:   29 IFITVAGNVVVCLAVSLNRRLRSLTNCFIVSLAATDLLLGLLVMPFSAIYQLSFKWSFGQVFCNIYTSLDVMLCTASILNLFMISLDRYCAVTDPLRYPVLVTPVRVAISLVFIWVI----SITLSFLSIHLGWNSRNGT-----RGGNDTFKCKVQVNEVYGLVDGMVTFYLPLLIMCVTYYRIFKIAREQAKRINHISSWKAATIREHKATVTLAAVMGAFIVCWFPY-FTAFVYRGLRGDDAVNEVVEGIVLWLGYANSALNPILYATLNRDFRMAYQQLFHCK 305          
BLAST of Melatonin receptor type 1A like vs. UniProt/SwissProt
Match: sp|P49219|MTR1C_XENLA (Melatonin receptor type 1C OS=Xenopus laevis OX=8355 GN=mtnr1c PE=2 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 1.195e-14
Identity = 79/283 (27.92%), Postives = 137/283 (48.41%), Query Frame = 1
Query:  322 IVLGILFNLCVPFAISVDKKLWXXXXXXXXXXXXVDLMVCCYILPVTLANRILSRNVMGYIGCHVNSFLTFISMGINNFIFMIISFDRYLFIFHKLSHTQLFTISNTLILIALVWLFWIGYGIALSFFKG-FGYESDAFVCFILDTNGNIXXXXXXXXXXXXXPISVSTGFYTILLVKLFKTKRNLSIQKEFKRLSDIQRDKNEMRMVVLLIVTVGTFFLCWAPYTFHGFFYRFGGTLSAP-----LHRVIYWGTLTNATLNGWLFGVMNSRFRKSLKQIFQS 1152
            IV+ +L N+ V  ++  +KKL  + N  ++++ I DL+V  Y  PV L     +   +G I C ++ FL  +S+  + F    I+ +RY +I H L + +L+   +T   + L W+  I   I  +FF G   Y+   F C    T  +      + V +F++P+SV T  Y  + V + + K    ++++FK+    +  + ++R  + + V    F +CWAP  F G          AP     L  + Y+    N+ LN  ++GV+N  FRK  K+I  S
Sbjct:   43 IVVDVLGNILVILSVLRNKKLQNAGNLFVVSLSIADLVVAVYPYPVILIAIFQNGWTLGNIHCQISGFLMGLSVIGSVFNITAIAINRYCYICHSLRYDKLYNQRSTWCYLGLTWILTI-IAIVPNFFVGSLQYDPRIFSCTFAQTVSS-SYTITVVVVHFIVPLSVVTFCYLRIWVLVIQVKHR--VRQDFKQ----KLTQTDLRNFLTMFVVFVLFAVCWAPLNFIGLAVAINPFHVAPKIPEWLFVLSYFMAYFNSCLNAVIYGVLNQNFRKEYKRILMS 317          
BLAST of Melatonin receptor type 1A like vs. UniProt/SwissProt
Match: sp|P49288|MTR1C_CHICK (Melatonin receptor type 1C OS=Gallus gallus OX=9031 PE=2 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 2.522e-14
Identity = 77/286 (26.92%), Postives = 136/286 (47.55%), Query Frame = 1
Query:  310 LCINIVLGILFNLCVPFAISVDKKLWXXXXXXXXXXXXVDLMVCCYILPVTLANRILSRNVMGYIGCHVNSFLTFISMGINNFIFMIISFDRYLFIFHKLSHTQLFTISNTLILIALVWLFWIGYGIALSFFKG-FGYESDAFVCFILDTNGNIXXXXXXXXXXXXXPISVSTGFYTILLVKLFKTKRNLSIQ-KEFKRLSDIQRDKNEMRMVVLLIVTVGTFFLCWAPYTFHGFFYRFGGTLSAP-----LHRVIYWGTLTNATLNGWLFGVMNSRFRKSLKQIF 1146
            L + IV+ +L N  V  ++  +KKL  + N  ++++ + DL+V  Y  P+ L+    +   MG I C ++ FL  +S+  + F    I+ +RY +I H L + +LF + NT   I L W   +   I  +FF G   Y+   + C    T         + V +F++P+S+ T  Y  + + + + K  +    K+  R +DI   +N + M V+ ++    F +CW P  F G       +   P     L  + Y+    N+ LN  ++G++N  FRK  K+I 
Sbjct:   31 LIVTIVVDVLGNALVILSVLRNKKLRNAGNIFVVSLSVADLVVAVYPYPLILSAIFHNGWTMGNIHCQISGFLMGLSVIGSIFNITAIAINRYCYICHSLRYDKLFNLKNTCCYICLTWTLTV-VAIVPNFFVGSLQYDPRIYSCTFAQTVST-SYTITVVVVHFIVPLSIVTFCYLRIWILVIQVKHRVRQDCKQKIRAADI---RNFLTMFVVFVL----FAVCWGPLNFIGLAVSINPSKVQPHIPEWLFVLSYFMAYFNSCLNAVIYGLLNQNFRKEYKRIL 307          
BLAST of Melatonin receptor type 1A like vs. UniProt/SwissProt
Match: sp|P51046|MR1AA_DANRE (Melatonin receptor type 1A-A OS=Danio rerio OX=7955 GN=mtnr1aa PE=2 SV=2)

HSP 1 Score: 76.6406 bits (187), Expect = 4.703e-14
Identity = 74/290 (25.52%), Postives = 135/290 (46.55%), Query Frame = 1
Query:  307 YLCINIVLGILFNLCVPFAISVDKKLWXXXXXXXXXXXXVDLMVCCYILPVTLANRILSRNVMGYIGCHVNSFLTFISMGINNFIFMIISFDRYLFIFHKLSHTQLFTISNTLILIALVWLFWIGYGIALSFFKGFGYESDAFVCFILDTNGNIXXXXXXXXXXXXXPISVSTGFYTILLVKLFKTKRNLSIQKEFKRLSDIQRDK---NEMRMVVLLIVTVGTFFLCWAPYTFHGFFYRFGGTLSAPLHR-----VIYWGTLTNATLNGWLFGVMNSRFRKSLKQIFQS 1152
            +L   IV+ IL NL V F++  +KKL  + N  ++++ + DL+V  Y  P+ L +       +GY+ C ++ FL  +S+  + F    I+ + Y +I H L + +L++  N++  + L+W   +   +   F     Y+   + C   + + +      +  F+F+LPI + T  Y  + V + + +R         R+ +  R K   +++R  V + V    F +CWAP  F G           PL         Y+    N+ LN  ++GV+N  FR+  K+I  S
Sbjct:   33 FLIFTIVVDILGNLLVIFSVYRNKKLQNAGNIFVVSLAVADLVVAIYPYPLVLTSIFHRGWNLGYMHCQISGFLMGVSVIGSIFNITGIAINCYCYICHSLKYDKLYSDKNSVCYVLLIWALTVLAIVPNLFVGSLQYDPRVYSC-TFEQSASSAYTIAVVFFHFILPIMIVTYCYLRIWVLVIQVRR---------RVKNDNRPKITPHDVRNFVTMFVVFVLFAVCWAPLNFIGLAVAISPERVVPLIPEWLFVASYFMAYFNSCLNAIVYGVLNQNFRREYKRIVVS 312          
BLAST of Melatonin receptor type 1A like vs. UniProt/SwissProt
Match: sp|P51049|MR1BB_DANRE (Melatonin receptor type 1B-B OS=Danio rerio OX=7955 GN=mtnr1bb PE=2 SV=2)

HSP 1 Score: 76.2554 bits (186), Expect = 5.892e-14
Identity = 76/283 (26.86%), Postives = 139/283 (49.12%), Query Frame = 1
Query:  325 VLGILFNLCVPFAISVDKKLWXXXXXXXXXXXXVDLMVCCYILPVTLANRILSRNVMGYIGCHVNSFLTFISMGINNFIFMIISFDRYLFIFHKLSHTQLFTISNTLILIALVWLFWIGYGIALSFFKG-FGYESDAFVCFILDTNGNIXXXXXXXXXXXXXPISVSTGFYTILLVKLFKTKRNLSIQKEFK-RLSDIQRDKNEMRMVVLLIVTVGTFFLCWAPYTFHGFFYRFGGTLSAP-----LHRVIYWGTLTNATLNGWLFGVMNSRFRKSLKQIFQS 1152
            V+ +L NL V  ++  ++KL  + N  ++++   DL+V  Y  P+ L         +G   C ++ FL  +S+  + F    I+ +RY +I H  ++ +L++  NTL+L+AL+W   +   I  +FF G   Y+   + C    T  +      + V +FL+PI+V T  Y  + V + + +R +  ++  + R SD+   +N + M V+ ++    F +CWAP    G        + AP     L  V Y+    N+ LN  ++G++N  FRK   +I  +
Sbjct:   43 VVDVLGNLLVIISVFRNRKLRNAGNVFVVSLAFADLVVAFYPYPLVLYAIFHDGWSLGETQCKISGFLMGLSVIGSVFNITGIAINRYCYICHSFAYGRLYSFRNTLLLVALIWALTV-LAILPNFFVGSLSYDPRVYSCTFTQTASS-SYTVVVVVVHFLVPIAVVTFCYLRIWVLVIQVRRKVKSEERSRVRPSDL---RNFVTMFVVFVL----FAICWAPLNLIGLVVAINPEVMAPRVPEWLFVVSYFMAYFNSCLNAIIYGLLNRNFRKEYVRIMTA 316          
BLAST of Melatonin receptor type 1A like vs. UniProt/SwissProt
Match: sp|P49285|MTR1A_CHICK (Melatonin receptor type 1A OS=Gallus gallus OX=9031 PE=2 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 7.989e-14
Identity = 74/301 (24.58%), Postives = 142/301 (47.18%), Query Frame = 1
Query:  271 RFDYYLYSQDITYLCINIVLGILFNLCVPFAISVDKKLWXXXXXXXXXXXXVDLMVCCYILPVTLANRILSRNVMGYIGCHVNSFLTFISMGINNFIFMIISFDRYLFIFHKLSHTQLFTISNTLILIALVWLFWIGYGIALSFFKGFGYESDAFVCFILDTNGNIXXXXXXXXXXXXXPISVSTGFYTILLVKLFKTKRNLSIQKEFKRLSDIQRDKNEMRMVVLLIVTVGTFFLCWAPYTFHGFFYRFGGTLSAPLHRVIYWGTLT-------NATLNGWLFGVMNSRFRKSLKQIFQS 1152
            R   ++ S   T L   IV+ +L NL V  ++  +KKL  + N  ++++ I DL+V  Y  P+ L +   +   +GY+ C ++ FL  +S+  + F    I+ +RY +I H L + +L++  N+L  + L+W+  +   +   F     Y+   + C    +  +      +  F+F+LPI++ T  Y  + + + + +R +      K  ++ +   ++ R  V + V    F +CWAP  F G           P  R+  W  ++       N+ LN  ++G++N  FR+  K+I  S
Sbjct:   24 RRPPWVTSTLATILIFTIVVDLLGNLLVILSVYRNKKLRNAGNIFVVSLAIADLVVAIYPYPLVLTSVFHNGWNLGYLHCQISGFLMGLSVIGSIFNITGIAINRYCYICHSLKYDKLYSDKNSLCYVGLIWVLTVVAIVPNLFVGSLQYDPRIYSCTFAQSVSS-AYTIAVVFFHFILPIAIVTYCYLRIWILVIQVRRRV------KPDNNPRLKPHDFRNFVTMFVVFVLFAVCWAPLNFIGLAVAVDPETIIP--RIPEWLFVSSYYMAYFNSCLNAIIYGLLNQNFRREYKKIVVS 315          
BLAST of Melatonin receptor type 1A like vs. TrEMBL
Match: A0A193KUL8 (GCR030 OS=Schmidtea mediterranea OX=79327 GN=gcr030 PE=2 SV=1)

HSP 1 Score: 564.303 bits (1453), Expect = 0.000e+0
Identity = 321/323 (99.38%), Postives = 321/323 (99.38%), Query Frame = 1
Query:  220 MLDEXXXXXXXXXXXXXRFDYYLYSQDITYLCINIVLGILFNLCVPFAISVDKKLWXXXXXXXXXXXXVDLMVCCYILPVTLANRILSRNVMGYIGCHVNSFLTFISMGINNFIFMIISFDRYLFIFHKLSHTQLFTISNTLILIALVWLFWIGYGIALSFFKGFGYESDAFVCFILDTNGNIXXXXXXXXXXXXXPISVSTGFYTILLVKLFKTKRNLSIQKEFKRLSDIQRDKNEMRMVVLLIVTVGTFFLCWAPYTFHGFFYRFGGTLSAPLHRVIYWGTLTNATLNGWLFGVMNSRFRKSLKQIFQSKSRKSETLFSTN 1188
            MLDESFFGNSSNSTG NRFDYYLYSQDITYLCINIVLGILFNLCVPFAISVDKKLWISSNFLILNII VDLMVCCYILPVTLANRILSRNVMGYIGCHVNSFLTFISMGINNFIFMIISFDRYLFIFHKLSHTQLFTISNTLILIALVWLFWIGYGIALSFFKGFGYESDAFVCFILDTNGNIVTLFFLTVFNFLLPISVSTGFYTILLVKLFKTKRNLSIQKEFKRLSDIQRDKNEMRMVVLLIVTVGTFFLCWAPYTFHGFFYRFGGTLSAPLHRVIYWGTLTNATLNGWLFGVMNSRFRKSLKQIFQSKSRKSETLFSTN
Sbjct:    1 MLDESFFGNSSNSTGLNRFDYYLYSQDITYLCINIVLGILFNLCVPFAISVDKKLWISSNFLILNIITVDLMVCCYILPVTLANRILSRNVMGYIGCHVNSFLTFISMGINNFIFMIISFDRYLFIFHKLSHTQLFTISNTLILIALVWLFWIGYGIALSFFKGFGYESDAFVCFILDTNGNIVTLFFLTVFNFLLPISVSTGFYTILLVKLFKTKRNLSIQKEFKRLSDIQRDKNEMRMVVLLIVTVGTFFLCWAPYTFHGFFYRFGGTLSAPLHRVIYWGTLTNATLNGWLFGVMNSRFRKSLKQIFQSKSRKSETLFSTN 323          
BLAST of Melatonin receptor type 1A like vs. TrEMBL
Match: A0A193KU71 (GCR028 OS=Schmidtea mediterranea OX=79327 GN=gcr028 PE=2 SV=1)

HSP 1 Score: 266.544 bits (680), Expect = 6.975e-83
Identity = 164/305 (53.77%), Postives = 218/305 (71.48%), Query Frame = 1
Query:  277 DYYLYSQDITYLCINIVLGILFNLCVPFAISVDKKLWXXXXXXXXXXXXVDLMVCCYILPVTLANRILSRNVMGYIGCHVNSFLTFISMGINNFIFMIISFDRYLFIFHKLSHTQLFTISNTLILIALVWLFWIGYGIALSFFKGFGYESDAFVCFILDTNGNIXXXXXXXXXXXXXPISVSTGFYTILLVKLFKTKRNLS--IQKEFKRLSDIQRDKNEMRMVVLLIVTVGTFFLCWAPYTFHGFFYRFGGTLSAPLHRVIYWGTLTNATLNGWLFGVMNSRFRKSLKQIFQSKSRKSETLFST 1185
            D   Y +DI  LC  IV+GI+FNL VP A+  ++ L  ++NF ILNIIIVDL+VC YILPVTL NRILSRN +G +GC +NSFLTF+SMGINNF+FMIISFDRYLFIF++  H++ FT+   ++L+ L+W  W+ YGI+LSF +GF Y S AFVCFI D   N+  +  L V NF+LP  VST FYTILLV++FK K N+S  I  +   + + +  +NE R+V LLI+ V  +F+CWAPYTFHGF  +    +S  +HRVI+W TL N+  NG LFGV+NS+FR  +K+   SK+ K + +FS+
Sbjct:   11 DKQFYVEDIVCLCSMIVIGIIFNLFVPTALYFERSLRTANNFFILNIIIVDLLVCGYILPVTLLNRILSRNTVGQLGCQINSFLTFLSMGINNFLFMIISFDRYLFIFYRSLHSKWFTVKRVILLLLLIWTIWLVYGISLSFLEGFSYISVAFVCFISDNEENLGLIIILIVLNFVLPTLVSTCFYTILLVRMFKIKYNVSKPISCQSPDMVNKKDYRNETRLVGLLIMNVVVYFICWAPYTFHGFLIKDDSEMSPLMHRVIHWLTLANSVFNGLLFGVLNSKFRNVIKKRLISKN-KIDDIFSS 314          
BLAST of Melatonin receptor type 1A like vs. TrEMBL
Match: A0A1I8JMF0 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 151.754 bits (382), Expect = 7.835e-36
Identity = 94/277 (33.94%), Postives = 148/277 (53.43%), Query Frame = 1
Query:  298 DITYLCINIVLGILFNLCVPFAISVDKKLWXXXXXXXXXXXXVDLMVCCYILPVTLANRILSRNVMGYIGCHVNSFLTFISMGINNFIFMIISFDRYLFIFHKLSHTQLFTISNTLILIALVWLFWIGYGIALSFFKGFGYESDAFVCFILDTNGNIXXXXXXXXXXXXXPISVSTGFYTILLVKLFKTKRNLSIQKEFKRLSDIQRDKNEMRMVVLLIVTVGTFFLCWAPYTFHGFFYRFGGTLSAPLHRVIYWGTLTNATLNGWLFGVMNSRFRK 1128
            DI +L + I +G+  NL +  +I++ K+L  ++N L++NI I DL+VC Y +P TLANRI   NV   + C VN++  F + G++NF F +I+  R L++  ++ + + FT S  +      W+FW        +  GFGY  +AF+CF  D +      F LT+    +P  ++ G Y  L  KLF+  RN S        SD    K E + V  ++    TF LCW PY+ H +  +F   + A  H+V  W  + N+ LN  ++GV+N  FR+
Sbjct:   15 DIFFLIVGICVGVCGNLLMILSITLFKQLKSATNILVVNIGIADLLVCSYSIPATLANRIADSNVFNDVTCRVNAYALFSAAGVSNFSFTLIAVTRNLYVMRRVVYQRNFTDSKMIAYCVACWIFWFLVSGLFWWQGGFGYIPEAFICFYYDNDSPFTLSFLLTLLGVAIPSLLAAGCYVNLFYKLFRI-RNQSENSVSGDTSDTSVSK-EWKAVAPVLAAFITFNLCWGPYSIHVYIDKFFAHVGAIPHKVFTWLAVFNSMLNPIIYGVLNPNFRR 289          
BLAST of Melatonin receptor type 1A like vs. TrEMBL
Match: A0A1I8JKQ9 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 151.754 bits (382), Expect = 7.947e-36
Identity = 94/277 (33.94%), Postives = 148/277 (53.43%), Query Frame = 1
Query:  298 DITYLCINIVLGILFNLCVPFAISVDKKLWXXXXXXXXXXXXVDLMVCCYILPVTLANRILSRNVMGYIGCHVNSFLTFISMGINNFIFMIISFDRYLFIFHKLSHTQLFTISNTLILIALVWLFWIGYGIALSFFKGFGYESDAFVCFILDTNGNIXXXXXXXXXXXXXPISVSTGFYTILLVKLFKTKRNLSIQKEFKRLSDIQRDKNEMRMVVLLIVTVGTFFLCWAPYTFHGFFYRFGGTLSAPLHRVIYWGTLTNATLNGWLFGVMNSRFRK 1128
            DI +L + I +G+  NL +  +I++ K+L  ++N L++NI I DL+VC Y +P TLANRI   NV   + C VN++  F + G++NF F +I+  R L++  ++ + + FT S  +      W+FW        +  GFGY  +AF+CF  D +      F LT+    +P  ++ G Y  L  KLF+  RN S        SD    K E + V  ++    TF LCW PY+ H +  +F   + A  H+V  W  + N+ LN  ++GV+N  FR+
Sbjct:  172 DIFFLIVGICVGVCGNLLMILSITLFKQLKSATNILVVNIGIADLLVCSYSIPATLANRIADSNVFNDVTCRVNAYALFSAAGVSNFSFTLIAVTRNLYVMRRVVYQRNFTDSKMIAYCVACWIFWFLVSGLFWWQGGFGYIPEAFICFYYDNDSPFTLSFLLTLLGVAIPSLLAAGCYVNLFYKLFRI-RNQSENSVSGDTSDTSVSK-EWKAVAPVLAAFITFNLCWGPYSIHVYIDKFFAHVGAIPHKVFTWLAVFNSMLNPIIYGVLNPNFRR 446          
BLAST of Melatonin receptor type 1A like vs. TrEMBL
Match: A0A193KUR1 (GCR150 OS=Schmidtea mediterranea OX=79327 GN=gcr150 PE=2 SV=1)

HSP 1 Score: 129.028 bits (323), Expect = 1.711e-30
Identity = 75/249 (30.12%), Postives = 130/249 (52.21%), Query Frame = 1
Query:  424 VDLMVCCYILPVTLANRILSRNVMGYIGCHVNSFLTFISMGINNFIFMIISFDRYLFIFHKLSHTQLFTISNTLILIALVWLFWIGYGIALSFFKGFGYESDAFVCFILDTNGNIXXXXXXXXXXXXXPISVSTGFYTILLVKLFKTKRNLSIQKEFKRLS--DIQRDK---NEMRMVVLLIVTVGTFFLCWAPYTFHGFFYRFGGTLSAPLHRVIYWGTLTNATLNGWLFGVMNSRFRKSLKQIFQSK 1155
             D+++C YI+P T   R      +  I C +N FL F+  GI NF FM I+ +R  FI +K+ + +LFT    +I   ++W  W G+G+ L+FF  F Y  ++F CF  D    I+     TVF   +P  V+T  Y  +   +   KR ++      + +  +IQ +     EMR ++  +VT   F  CW PY  H +  ++ G ++  +H++I W  + N++++  + G ++S+FR S+ ++   K
Sbjct:   21 ADMIICGYIMPWTTYYRSKCLTDVNSITCTINGFLFFVCAGIANFNFMFIAINRRYFILNKMRYNKLFTNWKIIIYSCIIWTIWFGFGLILNFFNSFHYIPNSFTCFYWDDYSPILASVIFTVFGVAVPSLVATCCYVTIFYNMIVIKRKITQSISINKTANENIQHNSWMNKEMRSILSALVTFIIFNSCWTPYCVHVYIDKYQGPINPIVHKIITWMAMINSSMSPIIHGALHSKFRVSMLKLLTWK 269          
BLAST of Melatonin receptor type 1A like vs. Ensembl Cavefish
Match: mtnr1bb (melatonin receptor type 1B-B [Source:NCBI gene;Acc:103030874])

HSP 1 Score: 80.8777 bits (198), Expect = 2.185e-16
Identity = 78/283 (27.56%), Postives = 141/283 (49.82%), Query Frame = 1
Query:  325 VLGILFNLCVPFAISVDKKLWXXXXXXXXXXXXVDLMVCCYILPVTLANRILSRNVMGYIGCHVNSFLTFISMGINNFIFMIISFDRYLFIFHKLSHTQLFTISNTLILIALVWLFWIGYGIALSFFKG-FGYESDAFVCFILDTNGNIXXXXXXXXXXXXXPISVSTGFYTILLVKLFKTKRNLSIQKEFK-RLSDIQRDKNEMRMVVLLIVTVGTFFLCWAPYTFHGFFYRFGGTLSAP-----LHRVIYWGTLTNATLNGWLFGVMNSRFRKSLKQIFQS 1152
            V+ +L NL V  ++  ++KL  + N  ++++   DL+V  Y  P+ L         +G   C V+ FL  +S+  + F    I+ +RY +I H  ++ +L++  NTL+L+AL+W+  +   I  +FF G   Y+   + C    T  +      + V +FL+PI++ T  Y  + V + + +R +  ++  + R SD+   +N + M V+ ++    F +CWAP    G        + AP     L  V Y+    N+ LN  ++G++N  FRK  K+I  S
Sbjct:   44 VVDVLGNLLVIISVFRNRKLRNAGNVFVVSLAFADLVVAFYPYPLVLYALFHDGWSLGDTQCKVSGFLMGLSVIGSVFNITGIAINRYCYICHSFAYGRLYSFRNTLLLVALIWMLTV-LAILPNFFVGSLSYDPRVYSCTFTQTASS-SYTVVVVVVHFLVPIAIVTFCYMRIWVLVIQVRRKVKSEERSRVRPSDL---RNFVTMFVVFVL----FAICWAPLNLIGLVVAINPEVIAPRVPEWLFVVSYFMAYFNSCLNAIIYGLLNRNFRKEYKRIVTS 317          
BLAST of Melatonin receptor type 1A like vs. Ensembl Cavefish
Match: mtnr1bb (melatonin receptor type 1B-B [Source:NCBI gene;Acc:103030874])

HSP 1 Score: 80.8777 bits (198), Expect = 2.185e-16
Identity = 78/283 (27.56%), Postives = 141/283 (49.82%), Query Frame = 1
Query:  325 VLGILFNLCVPFAISVDKKLWXXXXXXXXXXXXVDLMVCCYILPVTLANRILSRNVMGYIGCHVNSFLTFISMGINNFIFMIISFDRYLFIFHKLSHTQLFTISNTLILIALVWLFWIGYGIALSFFKG-FGYESDAFVCFILDTNGNIXXXXXXXXXXXXXPISVSTGFYTILLVKLFKTKRNLSIQKEFK-RLSDIQRDKNEMRMVVLLIVTVGTFFLCWAPYTFHGFFYRFGGTLSAP-----LHRVIYWGTLTNATLNGWLFGVMNSRFRKSLKQIFQS 1152
            V+ +L NL V  ++  ++KL  + N  ++++   DL+V  Y  P+ L         +G   C V+ FL  +S+  + F    I+ +RY +I H  ++ +L++  NTL+L+AL+W+  +   I  +FF G   Y+   + C    T  +      + V +FL+PI++ T  Y  + V + + +R +  ++  + R SD+   +N + M V+ ++    F +CWAP    G        + AP     L  V Y+    N+ LN  ++G++N  FRK  K+I  S
Sbjct:   44 VVDVLGNLLVIISVFRNRKLRNAGNVFVVSLAFADLVVAFYPYPLVLYALFHDGWSLGDTQCKVSGFLMGLSVIGSVFNITGIAINRYCYICHSFAYGRLYSFRNTLLLVALIWMLTV-LAILPNFFVGSLSYDPRVYSCTFTQTASS-SYTVVVVVVHFLVPIAIVTFCYMRIWVLVIQVRRKVKSEERSRVRPSDL---RNFVTMFVVFVL----FAICWAPLNLIGLVVAINPEVIAPRVPEWLFVVSYFMAYFNSCLNAIIYGLLNRNFRKEYKRIVTS 317          
BLAST of Melatonin receptor type 1A like vs. Ensembl Cavefish
Match: mtnr1al (melatonin receptor type 1A like [Source:NCBI gene;Acc:30660])

HSP 1 Score: 78.9518 bits (193), Expect = 8.834e-16
Identity = 78/291 (26.80%), Postives = 137/291 (47.08%), Query Frame = 1
Query:  304 TYLCINIVLGILFNLCVPFAISVDKKLWXXXXXXXXXXXXVDLMVCCYILPVTLANRILSRNVMGYIGCHVNSFLTFISMGINNFIFMIISFDRYLFIFHKLSHTQLFTISNTLILIALVWLFWIGYGIALSFFKGFGYESDAFVCFILDTNGNIXXXXXXXXXXXXXPISVSTGFYTILLVKLFKTKRNLSIQKEFKRLSDIQRD-KNEMRMVVLLIVTVGTFFLCWAPYTFHGFFY----RFGGTLSAPLHRVIYWGTLTNATLNGWLFGVMNSRFRKSLKQIFQSKSR 1161
            + L   IV+ +L NL V  ++  ++KL  + N  ++++ + DL+V  Y  P+ L        + G I C ++ FL  +S+  + F    I+ +RY +I H L + +LF+  NT   + LVW   I   +   F +   Y+   + C    +  ++     + V +F+LPIS+ T  Y  + + + + +R +   K   R      D +N + M V+ ++    F +CWAP  F G       R G  +   L    Y+    N+ LN  ++GV+N  FRK  K+I  +  R
Sbjct:   68 SVLITTIVVDVLGNLLVIVSVFRNRKLRKAGNAFVVSLAVADLVVAIYPYPLVLTAIFHDGWIAGNIHCQISGFLMGLSVIGSIFNITGIAINRYCYICHSLKYDKLFSSKNTACYVVLVWSLTILAIVPNWFVESLQYDPRVYSCTFAQSVSSL-YTILVVVVHFILPISIVTYCYLRIWILVIQVRRRV---KPDTRPKIKPHDFRNFLTMFVVFVL----FAVCWAPLNFIGLAVAVHPRLGQAIPEWLFTASYFMAYFNSCLNAVIYGVLNHNFRKEYKRIVLACVR 350          
BLAST of Melatonin receptor type 1A like vs. Ensembl Cavefish
Match: mtnr1c (melatonin receptor type 1C-like [Source:NCBI gene;Acc:103024280])

HSP 1 Score: 73.1738 bits (178), Expect = 6.714e-14
Identity = 76/292 (26.03%), Postives = 133/292 (45.55%), Query Frame = 1
Query:  322 IVLGILFNLCVPFAISVDKKLWXXXXXXXXXXXXVDLMVCCYILPVTLANRILSRNVMGYIGCHVNSFLTFISMGINNFIFMIISFDRYLFIFHKLSHTQLFTISNTLILIALVWLFWIGYGIALSFFKGFGYESDAFVCFILDTNGNIXXXXXXXXXXXXXPISVSTGFYTILLVKLFKTKRNLSIQKEFKRLSDIQRDKNEMRMVVLLIVTVGTFFLCWAPYTFHGFFYRFGGTLSAP-----LHRVIYWGTLTNATLNGWLFGVMNSRFRKSLKQIFQSKSRKSETLFS 1182
            IV+ I+ NL V  ++  +KKL  + N  ++++ + DL+V  Y  P+ L     +   MG + C ++ F+  +S+  + F    I+ +RY +I H L + +L+T  NT I + L WL      +         Y+   F C    T  +      + V +F+ P+ V +  Y  +   + + K  +   +   R +D+   +N + M V+ ++    F +CWAP  F G          AP     L    Y+    N+ LN  ++G++N  FR+  KQI  +      TLFS
Sbjct:   43 IVVDIVGNLLVILSVCRNKKLRNAGNIFVVSLSVADLVVALYPYPLALLAIFHNGWTMGNLHCQLSGFVMGLSVIGSVFNITAIAINRYCYICHSLRYDRLYTRRNTCIYLTLTWLLTAVATLPNFLVGSLTYDPRVFSCTFAQTVSS-SYTVCVVVVHFMFPLGVVSYCYLRIWTLVIRVKGRVR-ARPGARAADL---RNFLTMFVVFVL----FAVCWAPLNFIGLAVAMDPARVAPNVPEWLFVTSYFMAYFNSCLNAVVYGLLNQNFRREYKQILLALC-TPRTLFS 324          
BLAST of Melatonin receptor type 1A like vs. Ensembl Cavefish
Match: ENSAMXT00000025669.2 (pep primary_assembly:Astyanax_mexicanus-2.0:21:5620899:5698838:-1 gene:ENSAMXG00000040854.1 transcript:ENSAMXT00000025669.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 69.707 bits (169), Expect = 7.687e-13
Identity = 63/247 (25.51%), Postives = 108/247 (43.72%), Query Frame = 1
Query:  427 DLMVCCYILPVTLANRILSRNVMGYIGCHVNSFLTFISMGINNFIFMIISFDRYLFIFHKLSHTQLFTISNTLILIALVWLFWIGYGIALSFFKGFGYESDAFVCFILDTNGNIXXXXXXXXXXXXXPISVSTGFYTILLVKLFKTKRNLSIQKEFKRLSDIQRDKNEMRMVVLLIVTVGTFFLCWAPYTFHGFFYRFGGTLSAP-----LHRVIYWGTLTNATLNGWLFGVMNSRFRKSLKQIFQS 1152
            DL+V  Y  P+ L         +G   C ++ FL  +S+  + F    I+ +RY +I H L + +LF+  N+   + L+W+  +   I   F     Y++  + C   + + +      +  F+F+LPI V T  Y  + V + + +R +      K         +++R  V + V    F +CWAP  F G          AP     L    Y+    N+ LN  ++GV+N  FR+  K+I  S
Sbjct:   50 DLVVALYPYPLVLTAIFHRGWNLGSTHCQISGFLMGVSVVGSIFNITGIAVNRYCYICHSLKYDKLFSDKNSACYVVLIWVLTVLAIIPNLFVGSLQYDARVYSC-TFEQSASSAYTIAVVFFHFILPIMVVTYCYLRIWVLVIQVRRRVKPDNRPK------LTPHDVRNFVTMFVVFVLFAVCWAPLNFIGLAVAVAPQRLAPIIPEWLFVASYFMAYFNSCLNAIVYGVLNQNFRREYKRIVVS 289          
BLAST of Melatonin receptor type 1A like vs. Ensembl Sea Lamprey
Match: galr2a (galanin receptor 2a [Source:ZFIN;Acc:ZDB-GENE-130603-37])

HSP 1 Score: 56.225 bits (134), Expect = 4.665e-9
Identity = 52/228 (22.81%), Postives = 99/228 (43.42%), Query Frame = 1
Query:  490 VMGYIGCHVNSFLTFISMGINNFIFMIISFDRYLFIFHKLSHTQLFTISNTLILIALVW-LFWIGYGIALSFFKGFGYESDAFVCFILDTNGNIXXXXXXXXXXXXXPISVSTGFYTILLVKLFKTKRNLSIQKEFKRLSDIQRDKNEMRMVVLLIVTVGTFFLCWAPYTFHGFFYRFGGTLSAPLHRVIYWGTL-------TNATLNGWLFGVMNSRFRKSLKQIFQ 1149
            + G   C    F+ F++M  ++F    +S DRYL I + L   +L T      +IA +W L  +  G  LS+++   +++ +    +       +      V  +L+P+SV      + L   F  K   +     + +S+ +R K ++  ++L++   G F  CW P+     ++ FG     PL    Y   L        N+ LN  ++ +++  FRK  ++ F 
Sbjct:   95 IFGSFLCKAVHFIIFLTMFASSFTLAAVSVDRYLAIRYPLRSRELRTPRKAAAVIAAIWGLALVFAGPYLSYYQAVTFQNMSMCMPVWAKEPRKLMDMVTFVCGYLVPVSV------LGLAYAFTLKYLWTAVDPLEEMSESKRAKRKVTTMILIV--AGLFCACWLPHHVLILYFWFG---HFPLTHATYAFRLLSHCMSYANSCLNPLVYALVSKHFRKGFRKAFA 311          
BLAST of Melatonin receptor type 1A like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006872.1 (pep scaffold:Pmarinus_7.0:GL476537:253210:263579:1 gene:ENSPMAG00000006208.1 transcript:ENSPMAT00000006872.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 54.299 bits (129), Expect = 1.624e-8
Identity = 69/297 (23.23%), Postives = 121/297 (40.74%), Query Frame = 1
Query:  325 VLGILFNLCVPFAISVDKKLWXXXXXXXXXXXXVDLMVCCYILPVTLANRILSRNVMGYIGCHV-NSF-LTFISMGINNFIFMIISFDRYLFIFHKLSHTQLFTISNTLILIALVWLFWIGYGIALSFF---------KGFGYESDAFVCFILDTNGNIXXXXXXXXXXXXXPISVSTGFYTILLVKLFKTKRNLS------IQKEFKRLSDIQRDKNEMRMVVLLIVTVGTFFLCWAPYTFHGFFYRFGGTLSAPLH------RVIYWGTLTNATLNGWLFGVMNSRFRKSLKQIF 1146
            ++ +L NL V     ++K+L   +   I+++   DL+V C ++P ++   +  R + G I C V  SF + F +  I    F  IS DRY  +     H          I +A+    W+ Y   +SF           G  ++S     F+ +    +V         F   + + T ++ I      K  R +S         + +R +++Q +    R + ++I     F LCW PY F   F  F        H      +VI W    N+ +N  L+  +N  F+ +L++IF
Sbjct:   30 LVTLLGNLVVFVCPVLEKRLRTVTYMFIMSLATADLLVACLVMPFSIIYEVTGRWMFGRIFCKVWISFDVMFCTASIVTLCF--ISLDRYCSV--SAPHRYTLPKEPKKICVAMTAAIWV-YSSLISFLPVMRGWNEIPGLDFDSSRECVFVTNRTFAVVASALAFYIPF---LVMCTMYFFIYRASRLKAARIMSQTLDIHYHPKSRRPNNLQLEHKATRTMSIII---SAFVLCWLPYFFFNVFIGFYSNNEDSAHVVQMAFKVITWLGYCNSAINPMLYAFLNRDFQHALRKIF 315          
BLAST of Melatonin receptor type 1A like vs. Ensembl Sea Lamprey
Match: prlh2r (prolactin releasing hormone 2 receptor [Source:ZFIN;Acc:ZDB-GENE-120411-41])

HSP 1 Score: 52.373 bits (124), Expect = 8.839e-8
Identity = 70/296 (23.65%), Postives = 130/296 (43.92%), Query Frame = 1
Query:  322 IVLGILFNLCVPFAISVDKKLWXXXXXXXXXXXXVDLMVCCYILPVTLANRILSRN-VMGYIGCHVNSFLTFISMGINNFIFMIISFDRYLFIFHKLSHTQLFTISNTLILIALVWLFWIGYGIAL---SFFKGFGYESDAFVC---FILDTNGNIXXXXXXXXXXXXXPISVSTGFYTILLVKLFKTKRNLSIQKEFKRLSDIQRDKNEMRMVVLLIVTVGTFFLCWAPYTFHGFFYRFGGTLSAP-----LHRVIYWGTLTNATLNGWLFGVMNSRFRKSLKQIFQSKSRKSET 1173
            +V+G+L N  + + I   KK+   +N LI N+   DL++C   +P+TLA    +R  V G   C+    +  +S+ ++ F   +I+ DRY+   + L   +  TI     L+A +W+            +++  F  E    +C   +I      +   +   V  + LP+ V +  Y  + VKL K +       + +   D  R +   R   LL++ V  F +CW P     F       L        +  + +W  +++A  N +++  ++ RFR  LK++F  K R + +
Sbjct:   32 VVVGVLGNFLLVYVICRVKKMHNVTNLLIGNLAFSDLLMCAMCVPLTLAYVFDARGWVFGSFMCYFVFLMQPVSVYVSVFTLTVIAVDRYIVTVYPLR--RRITIPTCGYLLAAIWVTACALAAPALAHTYYCEFP-EQRMTICEEFWIGTERERLAYAYSTLVLTYGLPLLVISLSYFKISVKL-KNRVVPGTVTQNQAEMDRARRRKTFR---LLVLVVTAFSVCWLPLHIFNFLRDVDIRLIDKYYFNLVQLLCHWFAMSSACYNPFIYAWLHDRFRSELKKMFTVKRRVAPS 320          
BLAST of Melatonin receptor type 1A like vs. Ensembl Sea Lamprey
Match: oprk1 (opioid receptor, kappa 1 [Source:ZFIN;Acc:ZDB-GENE-030729-1])

HSP 1 Score: 51.9878 bits (123), Expect = 8.887e-8
Identity = 56/240 (23.33%), Postives = 108/240 (45.00%), Query Frame = 1
Query:  451 LPVTLANRILSRNVMGYIGCHVNSFLTFISMGINNFIFMIISFDRYLFIFHKLSHTQLFTISNTLILIALVWLFWIGYGIALSFFKGFGYESDAFVCFILD-----TNGNIXXXXXXXXXXXXXPISVSTGFYTILLVKLFKTKRNLSIQKEFKRLSDIQRDKNEMRMVVLLIVTVGTFFLCWAP-YTFHGFFYRFG----GTLSAPLHRVIYWGTLTNATLNGWLFGVMNSRFRKSLKQ 1140
            LP   A+ ++     G + C V   + + +M  + F   I+S DRY+ + H +      T S   ++   +W+     GI +    G   + +  +  ILD          +    + +F F+LP+ +    Y++++++L +T R LS  KE        +D+N  R+  ++++ V  F +CW P + F     R       T+SA  +  +  G  TN+ LN  L+  ++  F++  K+
Sbjct:   28 LPFQSADYLMGSWPFGEVICKVVMSIDYYNMFTSIFTLTIMSVDRYIAVCHPVKALDFRTPSKAKLINICIWILSSAIGIPV-IVMGTAKKEEGIIECILDFPHPAVKWENLLKICVFIFAFILPVLIIVVCYSLMVLRL-RTVRLLSGSKE--------KDRNLRRITRMVLIVVAIFVICWTPIHLFVIIKSRVSISDTPTVSAAWYICVALG-YTNSCLNPVLYAFLDENFKRCFKE 256          
BLAST of Melatonin receptor type 1A like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008040.1 (pep scaffold:Pmarinus_7.0:GL477351:476361:492361:-1 gene:ENSPMAG00000007251.1 transcript:ENSPMAT00000008040.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 51.6026 bits (122), Expect = 1.944e-7
Identity = 53/227 (23.35%), Postives = 102/227 (44.93%), Query Frame = 1
Query:  508 CHVNSFLTFISMGINNFIFMIISFDRYLFIFHKLSHTQLFTISNTLILIALVWLFWIGYGIALSFFKGFGYESDAFVCFI-----LDTNGNIXXXXXXXXXXXXXPISVSTGFYTILLVKLFKTKRNLSIQKEFKRLSDIQRDKNEMRMVVLLIVTVGTFFLCWAPYTFHGFFYRFGGTLSAPLHR--------VIYWGTLTNATLNGWLFGVMNSRFRKSLKQIFQ 1149
            C   +F+   ++  + +    I+ DRY+ I H L      T  +T +++A +W   +   + LS +         FVC +     +  +   +    +    ++ P+ V    YTI+ V L+         + F+     ++ +++ ++V ++IV V TF +CW PY  H +F   G TL+   HR         I+W  +++   N  ++  +NSRFR   K+ F+
Sbjct:  130 CRFQNFIPVAAVFASIYSMTAIAVDRYMAIRHPLKPR--MTAQSTRLVMAGIWALAMCLSLPLSIYSRVEQRFGRFVCLVDWPGKMGGDSQFIYQLVVMTLVYVFPLLVMAVTYTIVGVTLWGGTIPGDSSEHFR-----EQLRSKRKVVKMMIVVVVTFAVCWMPY--HVYFL-LGRTLNRIYHRKYIQQVYLAIFWLAMSSTMYNPIIYCCLNSRFRTGFKRAFR 346          
BLAST of Melatonin receptor type 1A like vs. Ensembl Nematostella
Match: EDO38342 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SD89])

HSP 1 Score: 72.4034 bits (176), Expect = 4.880e-14
Identity = 71/284 (25.00%), Postives = 126/284 (44.37%), Query Frame = 1
Query:  310 LCINIVLGILFNLCVPFAISVDKKLWXXXXXXXXXXXXVDLMVCCYILPVTLANRILSRNVMGYIGCHVNSFLTFISMGINNFIFMIISFDRYLFIFHKLSHTQLFTISNTLILIALVWLFWIGYGIALSFFKGFGYESDAFVCFILDTNGNIXXXXXXXXXXXXXPISVSTGFYTILLVKLFKTKRNLS--IQKEFKRLS--DIQRDKNEMRMVVLLIVTVGTFFLCWAPYTFHGFFYRFGGTLSAPLHRVIY--WGTLTNATLNGWLFGVMNSRFRKSLKQI 1143
            LC  IV  I+ N  +  AI   + L   +N  ++N+ I D+ +    +P T+ + I    + G   C V      +    +      +S +R++ I H L + Q  T     I++  +WL  +    +   F  F +     +C + D + +I   FF  V  F LP +     Y ++L K  + +R ++     E +  S  + ++ K E +  +++ + VGTF  CW P+   G F    G    P    I   W  + N+ LN  ++G+MNS F+++ K I
Sbjct:   44 LCAIIVTAIIGNSLILTAIYRFRSLQTKTNVFVVNLAIADISLAVLAMPFTMTSSITYEWIFGDTFCKVQGIFNSLFCEASILTLTFVSLERFIAILHPLKYQQWMTPRTIKIMVVYIWLQSLICATSTFLFSKFEFLKFEHICTV-DWSYSIGYTFFFVVTFFFLPFAAMAVCYFVILRKALEQRRKIASITVGEIRGQSNEEQRKTKQEHKATIMIAIVVGTFSACWFPHAV-GIFCLVSGNCEWPDSYFIATTWLAMLNSALNSGIYGLMNSSFKRAFKSI 325          
BLAST of Melatonin receptor type 1A like vs. Ensembl Nematostella
Match: EDO46536 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPM7])

HSP 1 Score: 70.4774 bits (171), Expect = 1.117e-13
Identity = 68/241 (28.22%), Postives = 105/241 (43.57%), Query Frame = 1
Query:  451 LPVTLANRILSRNVMGYIGCHVNSFLTFISMGINNFIFMIISFDRYLFIFHKLSHTQLFTISNTLILIALVWLFWIGYGIA-LSFFKGFGY---ESDAFVCFILDTNGNIXXXXXXXXXXXXXPISVSTGFYTILLVKLFKTKRNLSIQKEFKRLSDIQRDKNEMRMVVLLIVTVGTFFLCWAPYTFHGFFYRFGGTLSAP--LHRVIYWGTLTNATLNGWLFGVMNSRFRKSLKQIFQSK 1155
            +P TL + I  + V G + C +N     +    +      +S DRY+ I H L +T+L        +I  +W     + +A L  F+   Y    S++   F  D   +I    F+ V  F +P+S          V +F   R    + E       QR K + + V  L++ VGTF LCW P+ F G F    GT + P     +  W  + N+  N  ++G M+ +FRK  KQI Q K
Sbjct:   48 MPFTLVSSITFQWVFGDVWCVINGMAVTLFCVASMLTLAAVSIDRYIAIIHPLKYTELMHSRTATGIIVYIWAH--SFIVALLPVFRWSRYIYIRSESICTF--DWAFDIACTLFIFVVCFFIPLS----------VMMFTYYRKSQQRTE-------QRFKQDNKAVRTLLIVVGTFILCWLPH-FIGIFCLMSGTCAWPDRYFAITTWLAMLNSACNPVIYGAMSRQFRKRFKQILQCK 266          
BLAST of Melatonin receptor type 1A like vs. Ensembl Nematostella
Match: EDO37522 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFM3])

HSP 1 Score: 68.5514 bits (166), Expect = 1.029e-12
Identity = 70/267 (26.22%), Postives = 121/267 (45.32%), Query Frame = 1
Query:  427 DLMVCCYILPVTLANRILSRNVMGYIG---CHVNSFLTFISMGINNFIFMIISFDRYLFIFHKLSHTQLFTISNTLILIALVWLF---WIGYGIALSFFKGFGYESDAFVCFILDTNGNIXXXXXXXXXXXXXPISVSTGFYTILLVKLFKTKR--NLSIQKEFKRLSDIQRDKNEMRMVVLLIVTVGTFFLCWAPYTFHGF------FYRFGGTLSAPLHRV-IYWGTLTNATLNGWLFGVMNSRFRKSLKQIFQSKSRKSETLFS 1182
            D+ + C+ +PV++   IL R    Y     C   +F  ++  G++ +   + + +RY  +     + QLFT+  T+ +I  VW+     IG  + + + +   YES    C +    G     +   VF FL+   + + F T    ++FK  R    +I K  K  S +    +E++M   L + V  F  CW+P   +         + F   L   +H V +Y+GTL++A +N +++G MN  FR+    IF    R   T FS
Sbjct:   84 DMCMACFCMPVSIG--ILMRGKWVYSQSSVCEFQAFFIYVLAGVSLYTMAVTAANRYYKVVKPRRYPQLFTMKLTVAIIVTVWVLIGSLIGVLMGIKWLR-VKYESAKASCVMFADLGTKPLTYAYQVFAFLVFFIIPSTFITRCYRQVFKAVRRHEENIAKTLKNRSFVG-SADEVKMTKTLFLVVLAFASCWSPVIAYEMILISSNMFGFLDRLPRQIHLVWLYFGTLSSA-VNAFIYGAMNRAFRREFIAIFTCNKRTQITPFS 345          
BLAST of Melatonin receptor type 1A like vs. Ensembl Nematostella
Match: EDO31702 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SX48])

HSP 1 Score: 59.3066 bits (142), Expect = 5.644e-10
Identity = 47/210 (22.38%), Postives = 90/210 (42.86%), Query Frame = 1
Query:  571 ISFDRYLFIFHKLSHTQLFTISNTLILIALVWLFWIGYGIALSFFKGFGYESDAFVCFILDTNGNIXXXXXXXXXXXXXPISVSTGFYTILLVKLFKTKR-NLSIQKEFKRLSDIQRDKNEMRMVVLLIVTVGTFFLCWAPY-TFHGFFYRFGGTLSAPLHRVIYWGTLTNATLNGWLFGVMNSRFRKSLKQIFQS--KSRKSETLFSTN 1188
            +S DRYL I H + +    T    L++I  +W+    Y I ++      +    +  F+   N  I              +++   ++ I L    + K+  L+I+ +  R    +    E++    L V +G F +CW+P+   +  +Y    T S  L  +  W    N+ LN  ++GVMN  FR++ K++       +++  L  +N
Sbjct:   86 VSIDRYLCIIHPMVYPLTMTKPRALVIIICIWV----YSIVVASLGSTLWHWRGYTLFVTVMNFLIPA------------VAICIAYFRIFLTARHQAKQIKLTIKGKTHRFFLTK----ELKATKTLAVVIGAFLVCWSPFFVINLCYYTSAVTPSPVLVAIAKWAHYGNSCLNPLIYGVMNKDFRRAFKRLLAPYLPGKQTTLLLRSN 275          
BLAST of Melatonin receptor type 1A like vs. Ensembl Nematostella
Match: EDO41157 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S581])

HSP 1 Score: 58.5362 bits (140), Expect = 1.137e-9
Identity = 53/247 (21.46%), Postives = 107/247 (43.32%), Query Frame = 1
Query:  427 DLMVCCYILPVTLANRILSRNVMGYIGCHVNSFLTFISMGINNFIFMIISFDRYLFIFHKLSHTQLFTISNTLILIALVWLFWIGYGIALSF--FKGFGYESDAFVCFI--LDTNGNIXXXXXXXXXXXXXPISVSTGFYTILLVKLFKTKRNLSIQKEFK-RLSDIQRDKNEMRMVVLLIVTVGTFFLCWAPYTFHGFFYR-FGGTLSAPLHRVIYWGTLTNATLNGWLFGVMNSRFRKSLKQIFQ 1149
            DL+  C  LP+      L R V G +GC +  F +   + ++ +   +I+ +RYL I     + + FT+    I +A +W+F     +  S   +  F + S    C +   +         F T+    LP+ +    YT + +++ K +RN++     + + S+++    E+++   L   V  F +CW P +      R   G++     RV+      ++    +++G +N  FR+   +I  
Sbjct:   59 DLLTACITLPMAAGTSALGRWVYGSLGCQLYGFCSKFLVYVSIYTISLIALNRYLRICRPKVYRKHFTVRKCFIFLAFIWVFPALVRLLPSVLGYAQFTFSSQTAGCSMSFYNMRAQSPYTLFATLVFIALPMLLIIFCYTAVSLRVRKHRRNVTSSLNVRNQRSELRLSVEEVKITRTLFTLVFAFLICWLPVSVALLIVRAIVGSVPIIAARVLNCLVALSSACTPFVYGALNRSFRREFVKILS 305          
BLAST of Melatonin receptor type 1A like vs. Ensembl Medaka
Match: mtnr1al (melatonin receptor type 1A-like [Source:NCBI gene;Acc:101173872])

HSP 1 Score: 83.1889 bits (204), Expect = 3.546e-17
Identity = 77/297 (25.93%), Postives = 138/297 (46.46%), Query Frame = 1
Query:  310 LCINIVLGILFNLCVPFAISVDKKLWXXXXXXXXXXXXVDLMVCCYILPVTLANRILSRNVMGYIGCHVNSFLTFISMGINNFIFMIISFDRYLFIFHKLSHTQLFTISNTLILIALVWLFWIGYGIALSFFKGFGYESDAFVCFILDTNGNIXXXXXXXXXXXXXPISVSTGFYTILLVKLFKTKRNLSIQKEFKRLSDIQRDKNEMRMVVLLIVTVGTFFLCWAPYTFHGFFYRFGGTLSAPLHR----VIYWGTLTNATLNGWLFGVMNSRFRKSLKQI------FQSKSRKSE 1170
            L   IV+ ++ NL V  ++  ++KL  + N  ++++ + DL+V  Y  P+ L        + GYI C ++ FL  +S+  + F    I+ +RY +I H L + +LF+ SNT+  + LVW   +   +   F +   Y+   + C    +  ++     + V +F+LPIS+ T  Y  + + + + +R +      K  S  +   +++R  + + V    F +CWAP    G        LS  +        Y+    N+ LN  ++GV+N  FRK  K+I      F SK    E
Sbjct:   56 LITTIVVDVIGNLLVIVSVFRNRKLRKAGNAFVVSLALADLVVAIYPYPLVLTAIFHGGWIAGYIHCQISGFLMGLSVIGSIFNITGIAINRYCYICHNLKYDKLFSNSNTMCYVVLVWALTVLAIVPNWFVESLQYDPRVYSCTFAQSVSSL-YTITVVVVHFILPISIVTYCYLRIWILVIQVRRRV------KPDSRPKIKPHDLRNFLTMFVVFVLFAVCWAPLNLIGLAVALDSRLSRAIPEWLFTASYFMAYFNSCLNAVIYGVLNHNFRKEYKRIVLIICKFHSKGNDDE 345          
BLAST of Melatonin receptor type 1A like vs. Ensembl Medaka
Match: mtnr1al (melatonin receptor type 1A-like [Source:NCBI gene;Acc:101173872])

HSP 1 Score: 81.2629 bits (199), Expect = 1.452e-16
Identity = 73/282 (25.89%), Postives = 134/282 (47.52%), Query Frame = 1
Query:  310 LCINIVLGILFNLCVPFAISVDKKLWXXXXXXXXXXXXVDLMVCCYILPVTLANRILSRNVMGYIGCHVNSFLTFISMGINNFIFMIISFDRYLFIFHKLSHTQLFTISNTLILIALVWLFWIGYGIALSFFKGFGYESDAFVCFILDTNGNIXXXXXXXXXXXXXPISVSTGFYTILLVKLFKTKRNLSIQKEFKRLSDIQRDKNEMRMVVLLIVTVGTFFLCWAPYTFHGFFYRFGGTLSAPLHR----VIYWGTLTNATLNGWLFGVMNSRFRKSLKQI 1143
            L   IV+ ++ NL V  ++  ++KL  + N  ++++ + DL+V  Y  P+ L        + GYI C ++ FL  +S+  + F    I+ +RY +I H L + +LF+ SNT+  + LVW   +   +   F +   Y+   + C    +  ++     + V +F+LPIS+ T  Y  + + + + +R +      K  S  +   +++R  + + V    F +CWAP    G        LS  +        Y+    N+ LN  ++GV+N  FRK  K+I
Sbjct:   71 LITTIVVDVIGNLLVIVSVFRNRKLRKAGNAFVVSLALADLVVAIYPYPLVLTAIFHGGWIAGYIHCQISGFLMGLSVIGSIFNITGIAINRYCYICHNLKYDKLFSNSNTMCYVVLVWALTVLAIVPNWFVESLQYDPRVYSCTFAQSVSSL-YTITVVVVHFILPISIVTYCYLRIWILVIQVRRRV------KPDSRPKIKPHDLRNFLTMFVVFVLFAVCWAPLNLIGLAVALDSRLSRAIPEWLFTASYFMAYFNSCLNAVIYGVLNHNFRKEYKRI 345          
BLAST of Melatonin receptor type 1A like vs. Ensembl Medaka
Match: mtnr1bb (melatonin receptor type 1B-B [Source:NCBI gene;Acc:101174522])

HSP 1 Score: 78.9518 bits (193), Expect = 8.579e-16
Identity = 80/283 (28.27%), Postives = 140/283 (49.47%), Query Frame = 1
Query:  325 VLGILFNLCVPFAISVDKKLWXXXXXXXXXXXXVDLMVCCYILPVTLANRILSRNVMGYIGCHVNSFLTFISMGINNFIFMIISFDRYLFIFHKLSHTQLFTISNTLILIALVWLFWIGYGIALSFFKG-FGYESDAFVCFILDTNGNIXXXXXXXXXXXXXPISVSTGFYTILLVKLFKTKRNLSIQKEFK-RLSDIQRDKNEMRMVVLLIVTVGTFFLCWAPYTFHGFFYRFGGTLSAP-----LHRVIYWGTLTNATLNGWLFGVMNSRFRKSLKQIFQS 1152
            V+ +L NL V  ++  ++KL  S N  ++++   DL+V  Y  P+ L         +G   C V+ FL  +S+  + F    I+ +RY +I H  S+++L++  NTL+ +AL+W+  +   I  +FF G   Y+   + C     N +      + V +FL+PI+V T  Y  + V + + +R +  ++  + R SD+   +N + M V+ ++    F +CWAP    G       T  AP     L  V Y+    N+ LN  ++G++N  FR   K+I  S
Sbjct:   47 VVDVLGNLLVIISVFRNRKLRNSGNVFVVSLAFADLVVAFYPYPLVLYALFHDGWALGNTQCMVSGFLMGLSVIGSIFNITGIAVNRYCYICHSFSYSRLYSYRNTLLFVALIWVLTV-VAIVPNFFVGSLRYDPRVYSC-TFAQNVSSSYTVAVVVVHFLVPIAVVTFCYLRIWVLVIQVRRKVKTEENPRLRPSDL---RNFITMFVVFVL----FAICWAPLNLIGLAVAIDPTRVAPRIPEWLFVVSYFMAYFNSCLNAVIYGLLNRNFRNEYKRIVTS 320          
BLAST of Melatonin receptor type 1A like vs. Ensembl Medaka
Match: mtnr1aa (melatonin receptor 1A [Source:NCBI gene;Acc:101162342])

HSP 1 Score: 78.5666 bits (192), Expect = 1.015e-15
Identity = 71/287 (24.74%), Postives = 134/287 (46.69%), Query Frame = 1
Query:  307 YLCINIVLGILFNLCVPFAISVDKKLWXXXXXXXXXXXXVDLMVCCYILPVTLANRILSRNVMGYIGCHVNSFLTFISMGINNFIFMIISFDRYLFIFHKLSHTQLFTISNTLILIALVWLFWIGYGIALSFFKGFGYESDAFVCFILDTNGNIXXXXXXXXXXXXXPISVSTGFYTILLVKLFKTKRNLSIQKEFKRLSDIQRDKNEMRMVVLLIVTVGTFFLCWAPYTFHGFFYRFGGTLSAPLHR-----VIYWGTLTNATLNGWLFGVMNSRFRKSLKQIFQS 1152
            +L   IV+ IL NL V F++  +KKL  + N  ++++ + DL+V  Y  P+ L +   +   +G + C ++ FL  +S+  + F    I+ +RY +I H L + +L++  N++  + L+W   +   +   F     Y+   + C   + + +      +  F+F+LPI + T  Y  + + + + +R +      K         +++R  V + V    F +CWAP  F G        +  PL         Y+    N+ LN  ++GV+N  FR+  K+I  S
Sbjct:   30 FLIFTIVVDILGNLLVIFSVYRNKKLRNAGNIFVVSLAVADLVVAIYPYPLVLTSIFNNGWNLGSVHCQISGFLMGVSVIGSIFNITAIAINRYCYICHSLKYDKLYSDKNSVCYVILIWALTVVAIVPNLFVGSLKYDPRVYSC-TFEQSASSAYTIAVVFFHFILPIMIVTYCYLRIWILVIQVRRRVKPDNRPK------LTPHDVRNFVTMFVVFVLFAVCWAPLNFIGLAVAIKPEVVVPLIPEWLFVASYFMAYFNSCLNAIVYGVLNQNFRREYKRIVVS 309          
BLAST of Melatonin receptor type 1A like vs. Ensembl Medaka
Match: mtnr1c (melatonin receptor type 1C-like [Source:NCBI gene;Acc:105357260])

HSP 1 Score: 72.7886 bits (177), Expect = 8.599e-14
Identity = 73/280 (26.07%), Postives = 125/280 (44.64%), Query Frame = 1
Query:  322 IVLGILFNLCVPFAISVDKKLWXXXXXXXXXXXXVDLMVCCYILPVTLANRILSRNVMGYIGCHVNSFLTFISMGINNFIFMIISFDRYLFIFHKLSHTQLFTISNTLILIALVWLFWIGYGIALSFFKGFGYESDAFVCFILDTNGNIXXXXXXXXXXXXXPISVSTGFYTILLVKLFKTKRNLSIQKEFKRLSDIQRDKNEMRMVVLLIVTVGTFFLCWAPYTFHGFFYRFGGTLSAP-----LHRVIYWGTLTNATLNGWLFGVMNSRFRKSLKQIF 1146
            IV+ IL N+ V  ++  +KKL  + N  ++++ + DL+V  Y  P+ L     +   MG + C  + F+  IS+  + F    I+ +RY +I H L + +L+++ NT   + L WL      +   F     Y+   + C    T  +      + V +FL+P+ V +  Y  + V + K K  +  ++  +      R+   M MV +L      F +CWAP    G          AP     L    Y+    N+ LN  ++G++N  FRK  K I 
Sbjct:   38 IVVDILGNVLVIMSVYRNKKLRNAGNIFVVSLSVADLVVALYPYPLVLTAIFHNDWTMGDLHCQASGFIMGISVIGSIFNITAIAINRYCYICHSLHYDRLYSVRNTCCYLGLTWLLTAIATVPNFFVGSLQYDPRIYSCTFAQTVSS-YYTISVVVIHFLIPLLVVSYCYMRIWVLVIKVKHRVKPEQRTRLKPSDVRNFLTMFMVFVL------FAVCWAPLNLIGLAVAINPVKVAPNIPEWLFVTSYFMAYFNSCLNAIIYGLLNQNFRKEYKTIL 310          
BLAST of Melatonin receptor type 1A like vs. Planmine SMEST
Match: SMESG000043394.1 (SMESG000043394.1)

HSP 1 Score: 564.688 bits (1454), Expect = 0.000e+0
Identity = 322/323 (99.69%), Postives = 322/323 (99.69%), Query Frame = 1
Query:  220 MLDEXXXXXXXXXXXXXRFDYYLYSQDITYLCINIVLGILFNLCVPFAISVDKKLWXXXXXXXXXXXXVDLMVCCYILPVTLANRILSRNVMGYIGCHVNSFLTFISMGINNFIFMIISFDRYLFIFHKLSHTQLFTISNTLILIALVWLFWIGYGIALSFFKGFGYESDAFVCFILDTNGNIXXXXXXXXXXXXXPISVSTGFYTILLVKLFKTKRNLSIQKEFKRLSDIQRDKNEMRMVVLLIVTVGTFFLCWAPYTFHGFFYRFGGTLSAPLHRVIYWGTLTNATLNGWLFGVMNSRFRKSLKQIFQSKSRKSETLFSTN 1188
            MLDESFFGNSSNSTG NRFDYYLYSQDITYLCINIVLGILFNLCVPFAISVDKKLWISSNFLILNIIIVDLMVCCYILPVTLANRILSRNVMGYIGCHVNSFLTFISMGINNFIFMIISFDRYLFIFHKLSHTQLFTISNTLILIALVWLFWIGYGIALSFFKGFGYESDAFVCFILDTNGNIVTLFFLTVFNFLLPISVSTGFYTILLVKLFKTKRNLSIQKEFKRLSDIQRDKNEMRMVVLLIVTVGTFFLCWAPYTFHGFFYRFGGTLSAPLHRVIYWGTLTNATLNGWLFGVMNSRFRKSLKQIFQSKSRKSETLFSTN
Sbjct:    1 MLDESFFGNSSNSTGLNRFDYYLYSQDITYLCINIVLGILFNLCVPFAISVDKKLWISSNFLILNIIIVDLMVCCYILPVTLANRILSRNVMGYIGCHVNSFLTFISMGINNFIFMIISFDRYLFIFHKLSHTQLFTISNTLILIALVWLFWIGYGIALSFFKGFGYESDAFVCFILDTNGNIVTLFFLTVFNFLLPISVSTGFYTILLVKLFKTKRNLSIQKEFKRLSDIQRDKNEMRMVVLLIVTVGTFFLCWAPYTFHGFFYRFGGTLSAPLHRVIYWGTLTNATLNGWLFGVMNSRFRKSLKQIFQSKSRKSETLFSTN 323          
BLAST of Melatonin receptor type 1A like vs. Planmine SMEST
Match: SMESG000043387.1 (SMESG000043387.1)

HSP 1 Score: 266.544 bits (680), Expect = 1.940e-86
Identity = 164/305 (53.77%), Postives = 218/305 (71.48%), Query Frame = 1
Query:  277 DYYLYSQDITYLCINIVLGILFNLCVPFAISVDKKLWXXXXXXXXXXXXVDLMVCCYILPVTLANRILSRNVMGYIGCHVNSFLTFISMGINNFIFMIISFDRYLFIFHKLSHTQLFTISNTLILIALVWLFWIGYGIALSFFKGFGYESDAFVCFILDTNGNIXXXXXXXXXXXXXPISVSTGFYTILLVKLFKTKRNLS--IQKEFKRLSDIQRDKNEMRMVVLLIVTVGTFFLCWAPYTFHGFFYRFGGTLSAPLHRVIYWGTLTNATLNGWLFGVMNSRFRKSLKQIFQSKSRKSETLFST 1185
            D   Y +DI  LC  IV+GI+FNL VP A+  ++ L  ++NF ILNIIIVDL+VC YILPVTL NRILSRN +G +GC +NSFLTF+SMGINNF+FMIISFDRYLFIF++  H++ FT+   ++L+ L+W  W+ YGI+LSF +GF Y S AFVCFI D   N+  +  L V NF+LP  VST FYTILLV++FK K N+S  I  +   + + +  +NE R+V LLI+ V  +F+CWAPYTFHGF  +    +S  +HRVI+W TL N+  NG LFGV+NS+FR  +K+   SK+ K + +FS+
Sbjct:   11 DKQFYVEDIVCLCSMIVIGIIFNLFVPTALYFERSLRTANNFFILNIIIVDLLVCGYILPVTLLNRILSRNTVGQLGCQINSFLTFLSMGINNFLFMIISFDRYLFIFYRSLHSKWFTVKRVILLLLLIWTIWLVYGISLSFLEGFSYISVAFVCFISDNEENLGLIIILIVLNFVLPTLVSTCFYTILLVRMFKIKYNVSKPISCQSPDMVNKKDYRNETRLVGLLIMNVVVYFICWAPYTFHGFLIKDDSEMSPLMHRVIHWLTLANSVFNGLLFGVLNSKFRNVIKKRLISKN-KIDDIFSS 314          
BLAST of Melatonin receptor type 1A like vs. Planmine SMEST
Match: SMESG000068085.1 (SMESG000068085.1)

HSP 1 Score: 129.028 bits (323), Expect = 3.944e-34
Identity = 75/249 (30.12%), Postives = 130/249 (52.21%), Query Frame = 1
Query:  424 VDLMVCCYILPVTLANRILSRNVMGYIGCHVNSFLTFISMGINNFIFMIISFDRYLFIFHKLSHTQLFTISNTLILIALVWLFWIGYGIALSFFKGFGYESDAFVCFILDTNGNIXXXXXXXXXXXXXPISVSTGFYTILLVKLFKTKRNLSIQKEFKRLS--DIQRDK---NEMRMVVLLIVTVGTFFLCWAPYTFHGFFYRFGGTLSAPLHRVIYWGTLTNATLNGWLFGVMNSRFRKSLKQIFQSK 1155
             D+++C YI+P T   R      +  I C +N FL F+  GI NF FM I+ +R  FI +K+ + +LFT    +I   ++W  W G+G+ L+FF  F Y  ++F CF  D    I+     TVF   +P  V+T  Y  +   +   KR ++      + +  +IQ +     EMR ++  +VT   F  CW PY  H +  ++ G ++  +H++I W  + N++++  + G ++S+FR S+ ++   K
Sbjct:   15 ADMIICGYIMPWTTYYRSKCLTDVNSITCTINGFLFFVCAGIANFNFMFIAINRRYFILNKMRYNKLFTNWKIIIYSCIIWTIWFGFGLILNFFNSFHYIPNSFTCFYWDDYSPILASVIFTVFGVAVPSLVATCCYVTIFYNMIVIKRKITQSISINKTANENIQHNSWMNKEMRSILSALVTFIIFNSCWTPYCVHVYIDKYQGPINPIVHKIITWMAMINSSMSPIIHGALHSKFRVSMLKLLTWK 263          
BLAST of Melatonin receptor type 1A like vs. Planmine SMEST
Match: SMESG000009917.1 (SMESG000009917.1)

HSP 1 Score: 48.9062 bits (115), Expect = 1.348e-6
Identity = 35/137 (25.55%), Postives = 68/137 (49.64%), Query Frame = 1
Query:  322 IVLGILFNLCVPFAISVDKKLWXXXXXXXXXXXXVDLMVCCYILPVTLANRILSRNVMGYIGCHVNSFLTFISMGINNFIFMIISFDRYLFIFHKLSHTQLFTISNTLILIALVWLFWIGYGIALSFFKGFGYESDA 732
            +V G   NL V   +S++K+L   +N LI ++ I D+    + +P+T    I     +G I C +  F T+++  ++ +  +++S DRYL + H ++   + T  N L ++   W+ ++     L F  G  Y   +
Sbjct:   11 VVFGFFGNLLVILVVSINKQLRNGTNILIASLAIADITFITFCVPLTATIFIKKGWFLGSIACKIYQFFTYLTAYMSVYTLVLMSVDRYLAVVHPIASIPIRTEKNVLKIVLSTWVIFMLCNCPLLFNSGVAYPPTS 147          
BLAST of Melatonin receptor type 1A like vs. Planmine SMEST
Match: SMESG000009917.1 (SMESG000009917.1)

HSP 1 Score: 49.2914 bits (116), Expect = 1.351e-6
Identity = 35/137 (25.55%), Postives = 68/137 (49.64%), Query Frame = 1
Query:  322 IVLGILFNLCVPFAISVDKKLWXXXXXXXXXXXXVDLMVCCYILPVTLANRILSRNVMGYIGCHVNSFLTFISMGINNFIFMIISFDRYLFIFHKLSHTQLFTISNTLILIALVWLFWIGYGIALSFFKGFGYESDA 732
            +V G   NL V   +S++K+L   +N LI ++ I D+    + +P+T    I     +G I C +  F T+++  ++ +  +++S DRYL + H ++   + T  N L ++   W+ ++     L F  G  Y   +
Sbjct:   23 VVFGFFGNLLVILVVSINKQLRNGTNILIASLAIADITFITFCVPLTATIFIKKGWFLGSIACKIYQFFTYLTAYMSVYTLVLMSVDRYLAVVHPIASIPIRTEKNVLKIVLSTWVIFMLCNCPLLFNSGVAYPPTS 159          
The following BLAST results are available for this feature:
BLAST of Melatonin receptor type 1A like vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MTNR1A4.131e-1224.75melatonin receptor 1A [Source:HGNC Symbol;Acc:HGNC... [more]
MTNR1B1.769e-922.89melatonin receptor 1B [Source:HGNC Symbol;Acc:HGNC... [more]
APLNR6.779e-823.24apelin receptor [Source:HGNC Symbol;Acc:HGNC:339][more]
APLNR6.779e-823.24apelin receptor [Source:HGNC Symbol;Acc:HGNC:339][more]
APLNR6.779e-823.24apelin receptor [Source:HGNC Symbol;Acc:HGNC:339][more]
back to top
BLAST of Melatonin receptor type 1A like vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
npr-351.094e-923.69NeuroPeptide Receptor family [Source:UniProtKB/Tr... [more]
back to top
BLAST of Melatonin receptor type 1A like vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
TkR99D6.267e-826.67gene:FBgn0004622 transcript:FBtr0301656[more]
TkR99D7.104e-826.67gene:FBgn0004622 transcript:FBtr0085507[more]
TkR99D8.283e-826.67gene:FBgn0004622 transcript:FBtr0330298[more]
back to top
BLAST of Melatonin receptor type 1A like vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mtnr1al7.869e-1826.76melatonin receptor type 1A like [Source:NCBI gene;... [more]
mtnr1ab3.920e-1726.30melatonin receptor 1A b [Source:ZFIN;Acc:ZDB-GENE-... [more]
AL929336.11.791e-1625.95melatonin receptor 1A b [Source:NCBI gene;Acc:5657... [more]
mtnr1aa9.023e-1625.86melatonin receptor 1A a [Source:NCBI gene;Acc:3066... [more]
mtnr1aa9.023e-1625.86melatonin receptor 1A a [Source:NCBI gene;Acc:3066... [more]
back to top
BLAST of Melatonin receptor type 1A like vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
yod13.288e-1628.14YOD1 deubiquitinase [Source:Xenbase;Acc:XB-GENE-99... [more]
yod13.293e-1628.27YOD1 deubiquitinase [Source:Xenbase;Acc:XB-GENE-99... [more]
ENSXETT00000016998.15.415e-1525.27pep primary_assembly:Xenopus_tropicalis_v9.1:2:162... [more]
ENSXETT00000017006.16.381e-1525.27pep primary_assembly:Xenopus_tropicalis_v9.1:2:162... [more]
ENSXETT00000017012.17.141e-1525.27pep primary_assembly:Xenopus_tropicalis_v9.1:2:162... [more]
back to top
BLAST of Melatonin receptor type 1A like vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mtnr1a1.169e-1125.44melatonin receptor 1A [Source:MGI Symbol;Acc:MGI:1... [more]
Hrh22.509e-923.69histamine receptor H2 [Source:MGI Symbol;Acc:MGI:1... [more]
Mtnr1b2.974e-924.09melatonin receptor 1B [Source:MGI Symbol;Acc:MGI:2... [more]
Mtnr1b2.974e-924.09melatonin receptor 1B [Source:MGI Symbol;Acc:MGI:2... [more]
Hrh23.300e-923.69histamine receptor H2 [Source:MGI Symbol;Acc:MGI:1... [more]
back to top
BLAST of Melatonin receptor type 1A like vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P49219|MTR1C_XENLA1.195e-1427.92Melatonin receptor type 1C OS=Xenopus laevis OX=83... [more]
sp|P49288|MTR1C_CHICK2.522e-1426.92Melatonin receptor type 1C OS=Gallus gallus OX=903... [more]
sp|P51046|MR1AA_DANRE4.703e-1425.52Melatonin receptor type 1A-A OS=Danio rerio OX=795... [more]
sp|P51049|MR1BB_DANRE5.892e-1426.86Melatonin receptor type 1B-B OS=Danio rerio OX=795... [more]
sp|P49285|MTR1A_CHICK7.989e-1424.58Melatonin receptor type 1A OS=Gallus gallus OX=903... [more]
back to top
BLAST of Melatonin receptor type 1A like vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A193KUL80.000e+099.38GCR030 OS=Schmidtea mediterranea OX=79327 GN=gcr03... [more]
A0A193KU716.975e-8353.77GCR028 OS=Schmidtea mediterranea OX=79327 GN=gcr02... [more]
A0A1I8JMF07.835e-3633.94Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8JKQ97.947e-3633.94Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A193KUR11.711e-3030.12GCR150 OS=Schmidtea mediterranea OX=79327 GN=gcr15... [more]
back to top
BLAST of Melatonin receptor type 1A like vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mtnr1bb2.185e-1627.56melatonin receptor type 1B-B [Source:NCBI gene;Acc... [more]
mtnr1bb2.185e-1627.56melatonin receptor type 1B-B [Source:NCBI gene;Acc... [more]
mtnr1al8.834e-1626.80melatonin receptor type 1A like [Source:NCBI gene;... [more]
mtnr1c6.714e-1426.03melatonin receptor type 1C-like [Source:NCBI gene;... [more]
ENSAMXT00000025669.27.687e-1325.51pep primary_assembly:Astyanax_mexicanus-2.0:21:562... [more]
back to top
BLAST of Melatonin receptor type 1A like vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
galr2a4.665e-922.81galanin receptor 2a [Source:ZFIN;Acc:ZDB-GENE-1306... [more]
ENSPMAT00000006872.11.624e-823.23pep scaffold:Pmarinus_7.0:GL476537:253210:263579:1... [more]
prlh2r8.839e-823.65prolactin releasing hormone 2 receptor [Source:ZFI... [more]
oprk18.887e-823.33opioid receptor, kappa 1 [Source:ZFIN;Acc:ZDB-GENE... [more]
ENSPMAT00000008040.11.944e-723.35pep scaffold:Pmarinus_7.0:GL477351:476361:492361:-... [more]
back to top
BLAST of Melatonin receptor type 1A like vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Melatonin receptor type 1A like vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO383424.880e-1425.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO465361.117e-1328.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO375221.029e-1226.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO317025.644e-1022.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO411571.137e-921.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Melatonin receptor type 1A like vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mtnr1al3.546e-1725.93melatonin receptor type 1A-like [Source:NCBI gene;... [more]
mtnr1al1.452e-1625.89melatonin receptor type 1A-like [Source:NCBI gene;... [more]
mtnr1bb8.579e-1628.27melatonin receptor type 1B-B [Source:NCBI gene;Acc... [more]
mtnr1aa1.015e-1524.74melatonin receptor 1A [Source:NCBI gene;Acc:101162... [more]
mtnr1c8.599e-1426.07melatonin receptor type 1C-like [Source:NCBI gene;... [more]
back to top
BLAST of Melatonin receptor type 1A like vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000043394.10.000e+099.69SMESG000043394.1[more]
SMESG000043387.11.940e-8653.77SMESG000043387.1[more]
SMESG000068085.13.944e-3430.12SMESG000068085.1[more]
SMESG000009917.11.348e-625.55SMESG000009917.1[more]
SMESG000009917.11.351e-625.55SMESG000009917.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011828 ID=SMED30011828|Name=Melatonin receptor type 1A like|organism=Schmidtea mediterranea sexual|type=transcript|length=1276bp
TTCAAACAAACAAAACGCAAAAAAAATAATGGGAAAATAGCGATTGATGA
GAAAAGATAATTGGGAAATATTGTTCAACGGGAGAAAAGAAAATCTTATC
AATTCACACATAAATTGTTTACAGAAATCGATTTGCACAAAATATTTTCC
ACCAATCAGAAATTTTTTCACTCAAAATTGAATAATTGTAATGGGAATTT
TCCTCCTTCATTGTCGATAATGCTTGACGAATCCTTTTTTGGGAATAGTT
CCAATTCGACTGGATCAAATCGGTTTGATTATTATTTGTATTCCCAGGAT
ATTACATATCTCTGTATCAATATCGTGTTGGGTATTCTGTTCAATTTATG
CGTCCCCTTTGCCATATCCGTAGATAAAAAACTCTGGATATCAAGTAACT
TCCTCATCCTTAATATCATTATTGTTGACCTTATGGTCTGTTGTTACATC
CTTCCTGTGACGCTGGCTAATCGGATCTTATCAAGAAATGTTATGGGCTA
CATCGGGTGTCACGTGAATTCTTTTCTCACGTTCATCAGCATGGGAATAA
ACAATTTCATATTCATGATAATTTCATTCGATAGATATTTGTTTATTTTT
CATAAACTATCCCATACGCAGTTGTTTACAATCTCCAACACTCTTATCCT
GATTGCACTGGTATGGCTGTTTTGGATTGGATACGGAATCGCTCTCAGTT
TTTTCAAAGGATTCGGTTACGAGTCCGACGCATTTGTCTGTTTTATTCTT
GACACGAACGGCAACATTGTCACGTTGTTTTTCTTGACAGTTTTCAATTT
CCTTTTGCCGATTTCTGTCAGCACAGGATTTTACACGATTCTTCTGGTAA
AGCTATTCAAAACCAAACGCAACTTGAGCATTCAAAAAGAATTCAAGCGA
CTCTCTGACATCCAACGAGACAAGAATGAAATGAGAATGGTGGTTTTGTT
GATTGTAACGGTTGGGACATTTTTCCTTTGCTGGGCTCCGTATACTTTTC
ACGGTTTCTTTTATCGGTTTGGTGGCACATTAAGTGCTCCCTTACATCGG
GTGATATACTGGGGAACACTAACAAATGCAACATTGAATGGATGGTTGTT
TGGAGTCATGAATTCACGGTTTAGGAAATCATTGAAGCAGATTTTTCAGA
GCAAATCACGAAAATCGGAAACTCTGTTTTCTACAAATTGAATCGTTTAA
TTAATAACTTCATTAATTAAAGTTAAAAGTTTATTTTTGTCATTTTCTAG
TGTTATTGTTTCGGTTTTGAAAAGCA
back to top

protein sequence of SMED30011828-orf-1

>SMED30011828-orf-1 ID=SMED30011828-orf-1|Name=SMED30011828-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=324bp
MLDESFFGNSSNSTGSNRFDYYLYSQDITYLCINIVLGILFNLCVPFAIS
VDKKLWISSNFLILNIIIVDLMVCCYILPVTLANRILSRNVMGYIGCHVN
SFLTFISMGINNFIFMIISFDRYLFIFHKLSHTQLFTISNTLILIALVWL
FWIGYGIALSFFKGFGYESDAFVCFILDTNGNIVTLFFLTVFNFLLPISV
STGFYTILLVKLFKTKRNLSIQKEFKRLSDIQRDKNEMRMVVLLIVTVGT
FFLCWAPYTFHGFFYRFGGTLSAPLHRVIYWGTLTNATLNGWLFGVMNSR
FRKSLKQIFQSKSRKSETLFSTN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction
GO:0007186G-protein coupled receptor signaling pathway
Vocabulary: molecular function
TermDefinition
GO:0008502melatonin receptor activity
GO:0004930G-protein coupled receptor activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR000276GPCR_Rhodpsn
IPR017452GPCR_Rhodpsn_7TM
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000276G protein-coupled receptor, rhodopsin-likePRINTSPR00237GPCRRHODOPSNcoord: 186..209
score: 20.73
coord: 240..264
score: 28.27
coord: 276..302
score: 19.32
coord: 59..80
score: 23.0
coord: 104..126
score: 25.47
IPR000276G protein-coupled receptor, rhodopsin-likePFAMPF000017tm_1coord: 42..290
e-value: 3.6E-34
score: 118.3
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 25..320
e-value: 8.2E-50
score: 171.5
NoneNo IPR availablePANTHERPTHR24241NEUROPEPTIDE RECEPTOR-RELATED G-PROTEIN COUPLED RECEPTORcoord: 29..314
NoneNo IPR availableCDDcd006377tm_classA_rhodopsin-likecoord: 28..298
e-value: 7.85553E-35
score: 125.853
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 28..315
NoneNo IPR availableTMHMMTMhelixcoord: 61..83
NoneNo IPR availableTMHMMTMhelixcoord: 98..120
NoneNo IPR availableTMHMMTMhelixcoord: 187..209
NoneNo IPR availableTMHMMTMhelixcoord: 27..49
NoneNo IPR availableTMHMMTMhelixcoord: 278..296
NoneNo IPR availableTMHMMTMhelixcoord: 140..162
NoneNo IPR availableTMHMMTMhelixcoord: 241..263
IPR017452GPCR, rhodopsin-like, 7TMPROSITEPS50262G_PROTEIN_RECEP_F1_2coord: 41..294
score: 30.121