Prefoldin

Overview
NamePrefoldin
Smed IDSMED30011827
Length (bp)6471
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Prefoldin (SMED30011827) t-SNE clustered cells

Violin plots show distribution of expression levels for Prefoldin (SMED30011827) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Prefoldin (SMED30011827) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Prefoldin (SMED30011827) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011827

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30011827SMESG000016835.1 dd_Smed_v4_2373_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30011827SMESG000016835.1 dd_Smed_v4_2373_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
anterior region of the whole animalSMED30011827SMESG000016835.1 dd_Smed_v4_2373_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30011827SMESG000016835.1 dd_Smed_v4_2373_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30011827SMESG000016792.1 SMESG000016835.1 OX_Smed_1.0.16115ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
musculature systemSMED30011827SMESG000016835.1 dd_Smed_v6_2373_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynx musculatureSMED30011827SMESG000016835.1 dd_Smed_v6_2373_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Prefoldin vs. Ensembl Human
Match: SOGA3 (SOGA family member 3 [Source:HGNC Symbol;Acc:HGNC:21494])

HSP 1 Score: 109.383 bits (272), Expect = 4.981e-23
Identity = 108/356 (30.34%), Postives = 190/356 (53.37%), Query Frame = 1
Query: 1183 EENDMLKXXXXXXXXXXXXXHDHFQEDDTDTLRELKRDLETSNKNCRIFQFKLRKTERRYEQCENERGILEEKLNRLEAQLYSENDVNLIRGLEEELRVAKEVSVRLNSELELVDEKRSYFEEDNKHLKEELKDSETRRRSLEAELSKCRQEIEKLKSLDSSGALQIPDTASKRKNRNLESLSREPSFEEQSLQRELDAAKERETDLTEQLKFAEDDIRKLKRRFNDIEEENDSLSKKLETIMK-----STNIEDNEFDDNASVR--ALKIQVELLEQQNSTLRKKFVSIEKENINLSNELRQAKAKSNSGTEKS-----DDTLKD--EKYKLLEQKINDLHSDVERLEKENRRLT 2208
            EEN+ LK E +E++ E++EM D F E+D   L+E++ +LE +NKNCRI Q++LRK ER+                RL      E D  L+R LE++L+VAK+VSVRL+ ELE V+EKR+  E++N+ L+++L + E  +++L+ EL       EK+K L          +  +R +++L      P  E+++ Q      +E   DL  QL+F +++   ++++   I++E D    +L+          + +   E     S R   LK+++ L+E++ + L +K V +E EN  L  EL   +    +G+         ++L +  +  +L+E +   L  +V  LE++N+R+T
Sbjct:  361 EENETLKNEIDELRTEMDEMRDTFFEEDACQLQEMRHELERANKNCRILQYRLRKAERK----------------RLRYAQTGEIDGELLRSLEQDLKVAKDVSVRLHHELENVEEKRTTTEDENEKLRQQLIEVEIAKQALQNEL-------EKMKEL----------SLKRRGSKDL------PKSEKKAQQ---TPTEEDNEDLKCQLQFVKEEAALMRKKMAKIDKEKDRFEHELQKYRSFYGDLDSPLPKGEAGGPPSTREAELKLRLRLVEEEANILGRKIVELEVENRGLKAELDDLRGDDFNGSANPLMREQSESLSELRQHLQLVEDETELLRRNVADLEEQNKRIT 674          
BLAST of Prefoldin vs. Ensembl Human
Match: SOGA3 (SOGA family member 3 [Source:HGNC Symbol;Acc:HGNC:21494])

HSP 1 Score: 108.997 bits (271), Expect = 5.488e-23
Identity = 108/356 (30.34%), Postives = 190/356 (53.37%), Query Frame = 1
Query: 1183 EENDMLKXXXXXXXXXXXXXHDHFQEDDTDTLRELKRDLETSNKNCRIFQFKLRKTERRYEQCENERGILEEKLNRLEAQLYSENDVNLIRGLEEELRVAKEVSVRLNSELELVDEKRSYFEEDNKHLKEELKDSETRRRSLEAELSKCRQEIEKLKSLDSSGALQIPDTASKRKNRNLESLSREPSFEEQSLQRELDAAKERETDLTEQLKFAEDDIRKLKRRFNDIEEENDSLSKKLETIMK-----STNIEDNEFDDNASVR--ALKIQVELLEQQNSTLRKKFVSIEKENINLSNELRQAKAKSNSGTEKS-----DDTLKD--EKYKLLEQKINDLHSDVERLEKENRRLT 2208
            EEN+ LK E +E++ E++EM D F E+D   L+E++ +LE +NKNCRI Q++LRK ER+                RL      E D  L+R LE++L+VAK+VSVRL+ ELE V+EKR+  E++N+ L+++L + E  +++L+ EL       EK+K L          +  +R +++L      P  E+++ Q      +E   DL  QL+F +++   ++++   I++E D    +L+          + +   E     S R   LK+++ L+E++ + L +K V +E EN  L  EL   +    +G+         ++L +  +  +L+E +   L  +V  LE++N+R+T
Sbjct:  361 EENETLKNEIDELRTEMDEMRDTFFEEDACQLQEMRHELERANKNCRILQYRLRKAERK----------------RLRYAQTGEIDGELLRSLEQDLKVAKDVSVRLHHELENVEEKRTTTEDENEKLRQQLIEVEIAKQALQNEL-------EKMKEL----------SLKRRGSKDL------PKSEKKAQQ---TPTEEDNEDLKCQLQFVKEEAALMRKKMAKIDKEKDRFEHELQKYRSFYGDLDSPLPKGEAGGPPSTREAELKLRLRLVEEEANILGRKIVELEVENRGLKAELDDLRGDDFNGSANPLMREQSESLSELRQHLQLVEDETELLRRNVADLEEQNKRIT 674          
BLAST of Prefoldin vs. Ensembl Human
Match: AL096711.2 (novel protein)

HSP 1 Score: 108.997 bits (271), Expect = 5.488e-23
Identity = 108/356 (30.34%), Postives = 190/356 (53.37%), Query Frame = 1
Query: 1183 EENDMLKXXXXXXXXXXXXXHDHFQEDDTDTLRELKRDLETSNKNCRIFQFKLRKTERRYEQCENERGILEEKLNRLEAQLYSENDVNLIRGLEEELRVAKEVSVRLNSELELVDEKRSYFEEDNKHLKEELKDSETRRRSLEAELSKCRQEIEKLKSLDSSGALQIPDTASKRKNRNLESLSREPSFEEQSLQRELDAAKERETDLTEQLKFAEDDIRKLKRRFNDIEEENDSLSKKLETIMK-----STNIEDNEFDDNASVR--ALKIQVELLEQQNSTLRKKFVSIEKENINLSNELRQAKAKSNSGTEKS-----DDTLKD--EKYKLLEQKINDLHSDVERLEKENRRLT 2208
            EEN+ LK E +E++ E++EM D F E+D   L+E++ +LE +NKNCRI Q++LRK ER+                RL      E D  L+R LE++L+VAK+VSVRL+ ELE V+EKR+  E++N+ L+++L + E  +++L+ EL       EK+K L          +  +R +++L      P  E+++ Q      +E   DL  QL+F +++   ++++   I++E D    +L+          + +   E     S R   LK+++ L+E++ + L +K V +E EN  L  EL   +    +G+         ++L +  +  +L+E +   L  +V  LE++N+R+T
Sbjct:  361 EENETLKNEIDELRTEMDEMRDTFFEEDACQLQEMRHELERANKNCRILQYRLRKAERK----------------RLRYAQTGEIDGELLRSLEQDLKVAKDVSVRLHHELENVEEKRTTTEDENEKLRQQLIEVEIAKQALQNEL-------EKMKEL----------SLKRRGSKDL------PKSEKKAQQ---TPTEEDNEDLKCQLQFVKEEAALMRKKMAKIDKEKDRFEHELQKYRSFYGDLDSPLPKGEAGGPPSTREAELKLRLRLVEEEANILGRKIVELEVENRGLKAELDDLRGDDFNGSANPLMREQSESLSELRQHLQLVEDETELLRRNVADLEEQNKRIT 674          
BLAST of Prefoldin vs. Ensembl Human
Match: MTCL1 (microtubule crosslinking factor 1 [Source:HGNC Symbol;Acc:HGNC:29121])

HSP 1 Score: 102.449 bits (254), Expect = 1.005e-20
Identity = 103/364 (28.30%), Postives = 188/364 (51.65%), Query Frame = 1
Query: 1186 ENDMLKXXXXXXXXXXXXXHDHFQEDDTDTLRELKRDLETSNKNCRIFQFKLRKTERRYEQCENERGILEEKLNRLEAQLYSENDVNLIRGLEEELRVAKEVSVRLNSELELVDEKRSYFEEDNKHLKEELKDSETRRRSLEAELSKCRQEIEKLKSLDSSGALQIPDTASKRKNRNLESLSREPSFEEQSLQRELDAAKERETDLTEQLKFAEDDIRKLKRRFNDIEEENDSLSKKLETIMK-----STNIEDNEFDDNASVR--ALKIQVELLEQQNSTLRKKFVSIEKENINLSNEL--------RQAKAKSNS---GTEKSDDTLKDE-----KYKLLEQKINDLHSDVERLEKENRRLT 2208
            END LK+E +E++ E+EEM D + E+D   L+EL+R+L+ +NKNCRI Q++LRK E++                 L+     + D  LIR LE++L+VAK+VSVRL+ EL+ V+EKR+  E++N+ L++++ + E  +++L+ EL       E+LK            +  +R  R +        ++E+    + D+A     DL  QL+FA+++   ++++   +  E D L ++L+          + +   E     S R   LK++++L+E++ + L +K V +E EN  L  E+        R+   + ++    T    D+L+         + +E++   L   +  +E  NR+LT
Sbjct:  346 ENDYLKDELDELRAEMEEMRDSYLEEDVYQLQELRRELDRANKNCRILQYRLRKAEQKS----------------LKVAETGQVDGELIRSLEQDLKVAKDVSVRLHHELKTVEEKRAKAEDENETLRQQMIEVEISKQALQNEL-------ERLKE----------SSLKRRSTREM--------YKEKKTFNQDDSA-----DLRCQLQFAKEEAFLMRKKMAKLGREKDELEQELQKYKSLYGDVDSPLPTGEAGGPPSTREAELKLRLKLVEEEANILGRKIVELEVENRGLKAEMEDMRGQQEREGPGRDHAPSIPTSPFGDSLESSTELRRHLQFVEEEAELLRRSISEIEDHNRQLT 663          
BLAST of Prefoldin vs. Ensembl Human
Match: MTCL1 (microtubule crosslinking factor 1 [Source:HGNC Symbol;Acc:HGNC:29121])

HSP 1 Score: 98.2117 bits (243), Expect = 1.549e-19
Identity = 83/280 (29.64%), Postives = 154/280 (55.00%), Query Frame = 1
Query: 1246 DHFQEDDTDTLRELKRDLETSNKNCRIFQFKLRKTERRYEQCENERGILEEKLNRLEAQLYSENDVNLIRGLEEELRVAKEVSVRLNSELELVDEKRSYFEEDNKHLKEELKDSETRRRSLEAELSKCRQEIEKLKSLDSSGALQIPDTASKRKNRNLESLSREPSFEEQSLQRELDAAKERETDLTEQLKFAEDDIRKLKRRFNDIEEENDSLSKKLETIMK-----STNIEDNEFDDNASVR--ALKIQVELLEQQNSTLRKKFVSIEKENINLSNEL 2064
            D + E+D   L+EL+R+L+ +NKNCRI Q++LRK E++                 L+     + D  LIR LE++L+VAK+VSVRL+ EL+ V+EKR+  E++N+ L++++ + E  +++L+ EL       E+LK           +++ KR++      +RE   E+++  ++ D+A     DL  QL+FA+++   ++++   +  E D L ++L+          + +   E     S R   LK++++L+E++ + L +K V +E EN  L  E+
Sbjct:    6 DSYLEEDVYQLQELRRELDRANKNCRILQYRLRKAEQK----------------SLKVAETGQVDGELIRSLEQDLKVAKDVSVRLHHELKTVEEKRAKAEDENETLRQQMIEVEISKQALQNEL-------ERLK-----------ESSLKRRS------TREMYKEKKTFNQD-DSA-----DLRCQLQFAKEEAFLMRKKMAKLGREKDELEQELQKYKSLYGDVDSPLPTGEAGGPPSTREAELKLRLKLVEEEANILGRKIVELEVENRGLKAEM 239          
BLAST of Prefoldin vs. Ensembl Celegans
Match: tag-241 (pep chromosome:WBcel235:X:11826093:11836162:1 gene:WBGene00044079.1 transcript:C34E11.3a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:tag-241)

HSP 1 Score: 145.206 bits (365), Expect = 2.987e-34
Identity = 158/489 (32.31%), Postives = 263/489 (53.78%), Query Frame = 1
Query:  991 LERRIQHLDEEVRNYRERLKLPESDQANIDVSESMNSKHQEILAENEQLRVRMEEIEQLCQDVMEENDMLKXXXXXXXXXXXXXHDHFQEDDTDTLRELKRDLETSNKNCRIFQFKLRKTERRYEQCENERGILEEKLNRL-----EAQLYS-ENDVNLIRGLEEELRVAKEVSVRLNSELELVDEKRSYFEEDNKHLKEELKDSETRRRSLEAELSKCRQEIEKLKSLDSSGALQIPDTASKRKNRNLESLSREPSFEEQSLQRELDAAKERETDLTEQLKFAEDDIRKLKRRFNDIEEENDSLSKKLETIMK-STNIEDNEFDDNASVRALKIQVELLEQQNSTLRKKFVSIEKENINLSNELRQAKAKSNSGTEKSDDTLKDEKYKL---LEQKINDLHSDVERLEKENRRLTLLNSLQQAAPGIKPKVSQPPY--PVETTTDFIQNVQ--IQDLKSECNRLKEQIKQYDKQ-IKAIMSQIEQQYG 2412
            LE R+   + ++++YR        D+  +   E    +       +E+LR ++   E LC ++MEEN+ LK E +++Q+EIEEM D ++E++ +  REL+R+LE + KNCR+ QFKLRKTER  +Q E E+   E+KL+       EA   S ++D   ++ LE E+RVAKEVSVRL++ELE  +EKR   E++  +LKE++++ +T+ +  EA                        D A KR   + E  +  P+  E  + +EL  A ERE DL EQ++F+E+D+++ + R  D+E EN+ L KKL    K    +  +  D NA      +Q+EL E Q   L  K   +EK N +L+ ++ + +A    G   S  + K  ++KL   +E+ ++ +   +  LE++N  L L   ++Q    + PK   P +  P  TTT  ++  Q   + L+++ N LK  + + D Q + ++ ++IEQ  G
Sbjct:  150 LEDRLNQAENQIQDYR--------DENTVLKCELRELQETTFATSDEKLREKIRTTEGLCDELMEENEQLKAEVKDLQQEIEEMQDQYREEEIEEFRELQRELELNAKNCRVLQFKLRKTERSRDQAEAEKMHSEKKLDEYMNSCPEAVAASIKSDSAKVKELEYEIRVAKEVSVRLHNELEQTEEKRCKLEDEVFYLKEKVREIQTQNKWREAR--------------------NKTDIAVKR--LSAEIAASVPNIPENEMSKELRDALEREIDLREQMRFSEEDLKRTQIRLQDVENENEELLKKLSKASKLRPPMIRSASDGNAH-----LQLELAESQVQHLNTKIERLEKTNDHLNKKIVELEADCKRGGVTSAHS-KAGEFKLTPEMEKDMSKMIVTISELERKN--LELTTQVKQLETKVTPK---PNFVVPSGTTTTELRKEQEKRKALEAQVNELKTTVFKSDNQKVISLATKIEQLNG 597          
BLAST of Prefoldin vs. Ensembl Celegans
Match: tag-241 (pep chromosome:WBcel235:X:11824184:11836162:1 gene:WBGene00044079.1 transcript:C34E11.3e.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:tag-241)

HSP 1 Score: 144.821 bits (364), Expect = 4.428e-34
Identity = 158/489 (32.31%), Postives = 263/489 (53.78%), Query Frame = 1
Query:  991 LERRIQHLDEEVRNYRERLKLPESDQANIDVSESMNSKHQEILAENEQLRVRMEEIEQLCQDVMEENDMLKXXXXXXXXXXXXXHDHFQEDDTDTLRELKRDLETSNKNCRIFQFKLRKTERRYEQCENERGILEEKLNRL-----EAQLYS-ENDVNLIRGLEEELRVAKEVSVRLNSELELVDEKRSYFEEDNKHLKEELKDSETRRRSLEAELSKCRQEIEKLKSLDSSGALQIPDTASKRKNRNLESLSREPSFEEQSLQRELDAAKERETDLTEQLKFAEDDIRKLKRRFNDIEEENDSLSKKLETIMK-STNIEDNEFDDNASVRALKIQVELLEQQNSTLRKKFVSIEKENINLSNELRQAKAKSNSGTEKSDDTLKDEKYKL---LEQKINDLHSDVERLEKENRRLTLLNSLQQAAPGIKPKVSQPPY--PVETTTDFIQNVQ--IQDLKSECNRLKEQIKQYDKQ-IKAIMSQIEQQYG 2412
            LE R+   + ++++YR        D+  +   E    +       +E+LR ++   E LC ++MEEN+ LK E +++Q+EIEEM D ++E++ +  REL+R+LE + KNCR+ QFKLRKTER  +Q E E+   E+KL+       EA   S ++D   ++ LE E+RVAKEVSVRL++ELE  +EKR   E++  +LKE++++ +T+ +  EA                        D A KR   + E  +  P+  E  + +EL  A ERE DL EQ++F+E+D+++ + R  D+E EN+ L KKL    K    +  +  D NA      +Q+EL E Q   L  K   +EK N +L+ ++ + +A    G   S  + K  ++KL   +E+ ++ +   +  LE++N  L L   ++Q    + PK   P +  P  TTT  ++  Q   + L+++ N LK  + + D Q + ++ ++IEQ  G
Sbjct:  163 LEDRLNQAENQIQDYR--------DENTVLKCELRELQETTFATSDEKLREKIRTTEGLCDELMEENEQLKAEVKDLQQEIEEMQDQYREEEIEEFRELQRELELNAKNCRVLQFKLRKTERSRDQAEAEKMHSEKKLDEYMNSCPEAVAASIKSDSAKVKELEYEIRVAKEVSVRLHNELEQTEEKRCKLEDEVFYLKEKVREIQTQNKWREAR--------------------NKTDIAVKR--LSAEIAASVPNIPENEMSKELRDALEREIDLREQMRFSEEDLKRTQIRLQDVENENEELLKKLSKASKLRPPMIRSASDGNAH-----LQLELAESQVQHLNTKIERLEKTNDHLNKKIVELEADCKRGGVTSAHS-KAGEFKLTPEMEKDMSKMIVTISELERKN--LELTTQVKQLETKVTPK---PNFVVPSGTTTTELRKEQEKRKALEAQVNELKTTVFKSDNQKVISLATKIEQLNG 610          
BLAST of Prefoldin vs. Ensembl Celegans
Match: tag-241 (pep chromosome:WBcel235:X:11826093:11836162:1 gene:WBGene00044079.1 transcript:C34E11.3b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:tag-241)

HSP 1 Score: 144.436 bits (363), Expect = 4.993e-34
Identity = 158/489 (32.31%), Postives = 263/489 (53.78%), Query Frame = 1
Query:  991 LERRIQHLDEEVRNYRERLKLPESDQANIDVSESMNSKHQEILAENEQLRVRMEEIEQLCQDVMEENDMLKXXXXXXXXXXXXXHDHFQEDDTDTLRELKRDLETSNKNCRIFQFKLRKTERRYEQCENERGILEEKLNRL-----EAQLYS-ENDVNLIRGLEEELRVAKEVSVRLNSELELVDEKRSYFEEDNKHLKEELKDSETRRRSLEAELSKCRQEIEKLKSLDSSGALQIPDTASKRKNRNLESLSREPSFEEQSLQRELDAAKERETDLTEQLKFAEDDIRKLKRRFNDIEEENDSLSKKLETIMK-STNIEDNEFDDNASVRALKIQVELLEQQNSTLRKKFVSIEKENINLSNELRQAKAKSNSGTEKSDDTLKDEKYKL---LEQKINDLHSDVERLEKENRRLTLLNSLQQAAPGIKPKVSQPPY--PVETTTDFIQNVQ--IQDLKSECNRLKEQIKQYDKQ-IKAIMSQIEQQYG 2412
            LE R+   + ++++YR        D+  +   E    +       +E+LR ++   E LC ++MEEN+ LK E +++Q+EIEEM D ++E++ +  REL+R+LE + KNCR+ QFKLRKTER  +Q E E+   E+KL+       EA   S ++D   ++ LE E+RVAKEVSVRL++ELE  +EKR   E++  +LKE++++ +T+ +  EA                        D A KR   + E  +  P+  E  + +EL  A ERE DL EQ++F+E+D+++ + R  D+E EN+ L KKL    K    +  +  D NA      +Q+EL E Q   L  K   +EK N +L+ ++ + +A    G   S  + K  ++KL   +E+ ++ +   +  LE++N  L L   ++Q    + PK   P +  P  TTT  ++  Q   + L+++ N LK  + + D Q + ++ ++IEQ  G
Sbjct:  150 LEDRLNQAENQIQDYR--------DENTVLKCELRELQETTFATSDEKLREKIRTTEGLCDELMEENEQLKAEVKDLQQEIEEMQDQYREEEIEEFRELQRELELNAKNCRVLQFKLRKTERSRDQAEAEKMHSEKKLDEYMNSCPEAVAASIKSDSAKVKELEYEIRVAKEVSVRLHNELEQTEEKRCKLEDEVFYLKEKVREIQTQNKWREAR--------------------NKTDIAVKR--LSAEIAASVPNIPENEMSKELRDALEREIDLREQMRFSEEDLKRTQIRLQDVENENEELLKKLSKASKLRPPMIRSASDGNAH-----LQLELAESQVQHLNTKIERLEKTNDHLNKKIVELEADCKRGGVTSAHS-KAGEFKLTPEMEKDMSKMIVTISELERKN--LELTTQVKQLETKVTPK---PNFVVPSGTTTTELRKEQEKRKALEAQVNELKTTVFKSDNQKVISLATKIEQLNG 597          
BLAST of Prefoldin vs. Ensembl Celegans
Match: tag-241 (pep chromosome:WBcel235:X:11824184:11836162:1 gene:WBGene00044079.1 transcript:C34E11.3f.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:tag-241)

HSP 1 Score: 144.436 bits (363), Expect = 5.552e-34
Identity = 158/489 (32.31%), Postives = 263/489 (53.78%), Query Frame = 1
Query:  991 LERRIQHLDEEVRNYRERLKLPESDQANIDVSESMNSKHQEILAENEQLRVRMEEIEQLCQDVMEENDMLKXXXXXXXXXXXXXHDHFQEDDTDTLRELKRDLETSNKNCRIFQFKLRKTERRYEQCENERGILEEKLNRL-----EAQLYS-ENDVNLIRGLEEELRVAKEVSVRLNSELELVDEKRSYFEEDNKHLKEELKDSETRRRSLEAELSKCRQEIEKLKSLDSSGALQIPDTASKRKNRNLESLSREPSFEEQSLQRELDAAKERETDLTEQLKFAEDDIRKLKRRFNDIEEENDSLSKKLETIMK-STNIEDNEFDDNASVRALKIQVELLEQQNSTLRKKFVSIEKENINLSNELRQAKAKSNSGTEKSDDTLKDEKYKL---LEQKINDLHSDVERLEKENRRLTLLNSLQQAAPGIKPKVSQPPY--PVETTTDFIQNVQ--IQDLKSECNRLKEQIKQYDKQ-IKAIMSQIEQQYG 2412
            LE R+   + ++++YR        D+  +   E    +       +E+LR ++   E LC ++MEEN+ LK E +++Q+EIEEM D ++E++ +  REL+R+LE + KNCR+ QFKLRKTER  +Q E E+   E+KL+       EA   S ++D   ++ LE E+RVAKEVSVRL++ELE  +EKR   E++  +LKE++++ +T+ +  EA                        D A KR   + E  +  P+  E  + +EL  A ERE DL EQ++F+E+D+++ + R  D+E EN+ L KKL    K    +  +  D NA      +Q+EL E Q   L  K   +EK N +L+ ++ + +A    G   S  + K  ++KL   +E+ ++ +   +  LE++N  L L   ++Q    + PK   P +  P  TTT  ++  Q   + L+++ N LK  + + D Q + ++ ++IEQ  G
Sbjct:  163 LEDRLNQAENQIQDYR--------DENTVLKCELRELQETTFATSDEKLREKIRTTEGLCDELMEENEQLKAEVKDLQQEIEEMQDQYREEEIEEFRELQRELELNAKNCRVLQFKLRKTERSRDQAEAEKMHSEKKLDEYMNSCPEAVAASIKSDSAKVKELEYEIRVAKEVSVRLHNELEQTEEKRCKLEDEVFYLKEKVREIQTQNKWREAR--------------------NKTDIAVKR--LSAEIAASVPNIPENEMSKELRDALEREIDLREQMRFSEEDLKRTQIRLQDVENENEELLKKLSKASKLRPPMIRSASDGNAH-----LQLELAESQVQHLNTKIERLEKTNDHLNKKIVELEADCKRGGVTSAHS-KAGEFKLTPEMEKDMSKMIVTISELERKN--LELTTQVKQLETKVTPK---PNFVVPSGTTTTELRKEQEKRKALEAQVNELKTTVFKSDNQKVISLATKIEQLNG 610          
BLAST of Prefoldin vs. Ensembl Celegans
Match: tag-241 (pep chromosome:WBcel235:X:11824184:11836162:1 gene:WBGene00044079.1 transcript:C34E11.3g.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:tag-241)

HSP 1 Score: 144.05 bits (362), Expect = 6.863e-34
Identity = 158/489 (32.31%), Postives = 263/489 (53.78%), Query Frame = 1
Query:  991 LERRIQHLDEEVRNYRERLKLPESDQANIDVSESMNSKHQEILAENEQLRVRMEEIEQLCQDVMEENDMLKXXXXXXXXXXXXXHDHFQEDDTDTLRELKRDLETSNKNCRIFQFKLRKTERRYEQCENERGILEEKLNRL-----EAQLYS-ENDVNLIRGLEEELRVAKEVSVRLNSELELVDEKRSYFEEDNKHLKEELKDSETRRRSLEAELSKCRQEIEKLKSLDSSGALQIPDTASKRKNRNLESLSREPSFEEQSLQRELDAAKERETDLTEQLKFAEDDIRKLKRRFNDIEEENDSLSKKLETIMK-STNIEDNEFDDNASVRALKIQVELLEQQNSTLRKKFVSIEKENINLSNELRQAKAKSNSGTEKSDDTLKDEKYKL---LEQKINDLHSDVERLEKENRRLTLLNSLQQAAPGIKPKVSQPPY--PVETTTDFIQNVQ--IQDLKSECNRLKEQIKQYDKQ-IKAIMSQIEQQYG 2412
            LE R+   + ++++YR        D+  +   E    +       +E+LR ++   E LC ++MEEN+ LK E +++Q+EIEEM D ++E++ +  REL+R+LE + KNCR+ QFKLRKTER  +Q E E+   E+KL+       EA   S ++D   ++ LE E+RVAKEVSVRL++ELE  +EKR   E++  +LKE++++ +T+ +  EA                        D A KR   + E  +  P+  E  + +EL  A ERE DL EQ++F+E+D+++ + R  D+E EN+ L KKL    K    +  +  D NA      +Q+EL E Q   L  K   +EK N +L+ ++ + +A    G   S  + K  ++KL   +E+ ++ +   +  LE++N  L L   ++Q    + PK   P +  P  TTT  ++  Q   + L+++ N LK  + + D Q + ++ ++IEQ  G
Sbjct:  163 LEDRLNQAENQIQDYR--------DENTVLKCELRELQETTFATSDEKLREKIRTTEGLCDELMEENEQLKAEVKDLQQEIEEMQDQYREEEIEEFRELQRELELNAKNCRVLQFKLRKTERSRDQAEAEKMHSEKKLDEYMNSCPEAVAASIKSDSAKVKELEYEIRVAKEVSVRLHNELEQTEEKRCKLEDEVFYLKEKVREIQTQNKWREAR--------------------NKTDIAVKR--LSAEIAASVPNIPENEMSKELRDALEREIDLREQMRFSEEDLKRTQIRLQDVENENEELLKKLSKASKLRPPMIRSASDGNAH-----LQLELAESQVQHLNTKIERLEKTNDHLNKKIVELEADCKRGGVTSAHS-KAGEFKLTPEMEKDMSKMIVTISELERKN--LELTTQVKQLETKVTPK---PNFVVPSGTTTTELRKEQEKRKALEAQVNELKTTVFKSDNQKVISLATKIEQLNG 610          
BLAST of Prefoldin vs. Ensembl Fly
Match: CG18304 (gene:FBgn0031869 transcript:FBtr0332326)

HSP 1 Score: 106.686 bits (265), Expect = 2.405e-22
Identity = 105/338 (31.07%), Postives = 163/338 (48.22%), Query Frame = 1
Query: 1132 QLRVRMEEIEQLCQDVMEENDMLKXXXXXXXXXXXXXHDHFQEDDTDTLRELKRDLETSNKNCRIFQFKLRKTERRYEQCENERGILEEKLNRLEAQLYSENDVNLIRGLEEELRVAKEVSVRLNSELELVDEKRSYFEEDNKHLKEELKDSETRRRSLEAELSKCRQEIEKL--KSLDSSGALQIPDTASKRKNRNLESLSREPSFEEQSLQRELDAAKERETDLTEQLKFAEDDIRKLKRRFNDIEEENDSLS---KKLETIMKSTNIE----------------DNEFDDNASVRALKIQVELLEQQNSTLRKKFVSIEKENINLSNELRQAKAK 2082
            +LR +++  EQ+C+++MEEN   K+E   +Q E++E+ D F++D+      L++DLE + KNCRI  FKL+K++R+ E  E ER       +   A+L      N I+ LEEELR + E++ +L +E                   EEL++   ++  +   L K      K   +SL   G+ + P                      Q LQREL  + ERETDL +QLKFAE++   L+++    E+EN+SL    KK+ T  +S  +                 D    D      L+I +EL EQ+ S LR K   +EKEN      +R+ +AK
Sbjct:  434 ELRRKLQAAEQICEELMEENQSAKKEILNLQAEMDEVQDTFRDDEVKAKTSLQKDLEKATKNCRILSFKLKKSDRKIETLEQERQ------SSFNAELS-----NKIKKLEEELRFSNELTRKLQAE------------------AEELRNPGKKKAPMLGVLGKSTSADAKFTRESLTRGGSQEDP----------------------QHLQRELQDSIERETDLKDQLKFAEEEAEHLRKKVTRFEDENESLMMQLKKMATRSRSRKLSPTPHPHRLAPEVHADRDEGISDEDDPAELRILLELNEQEASILRLKVEDLEKENAESKKYVRELQAK 720          
BLAST of Prefoldin vs. Ensembl Fly
Match: CG18304 (gene:FBgn0031869 transcript:FBtr0306285)

HSP 1 Score: 106.686 bits (265), Expect = 2.408e-22
Identity = 105/338 (31.07%), Postives = 163/338 (48.22%), Query Frame = 1
Query: 1132 QLRVRMEEIEQLCQDVMEENDMLKXXXXXXXXXXXXXHDHFQEDDTDTLRELKRDLETSNKNCRIFQFKLRKTERRYEQCENERGILEEKLNRLEAQLYSENDVNLIRGLEEELRVAKEVSVRLNSELELVDEKRSYFEEDNKHLKEELKDSETRRRSLEAELSKCRQEIEKL--KSLDSSGALQIPDTASKRKNRNLESLSREPSFEEQSLQRELDAAKERETDLTEQLKFAEDDIRKLKRRFNDIEEENDSLS---KKLETIMKSTNIE----------------DNEFDDNASVRALKIQVELLEQQNSTLRKKFVSIEKENINLSNELRQAKAK 2082
            +LR +++  EQ+C+++MEEN   K+E   +Q E++E+ D F++D+      L++DLE + KNCRI  FKL+K++R+ E  E ER       +   A+L      N I+ LEEELR + E++ +L +E                   EEL++   ++  +   L K      K   +SL   G+ + P                      Q LQREL  + ERETDL +QLKFAE++   L+++    E+EN+SL    KK+ T  +S  +                 D    D      L+I +EL EQ+ S LR K   +EKEN      +R+ +AK
Sbjct:  440 ELRRKLQAAEQICEELMEENQSAKKEILNLQAEMDEVQDTFRDDEVKAKTSLQKDLEKATKNCRILSFKLKKSDRKIETLEQERQ------SSFNAELS-----NKIKKLEEELRFSNELTRKLQAE------------------AEELRNPGKKKAPMLGVLGKSTSADAKFTRESLTRGGSQEDP----------------------QHLQRELQDSIERETDLKDQLKFAEEEAEHLRKKVTRFEDENESLMMQLKKMATRSRSRKLSPTPHPHRLAPEVHADRDEGISDEDDPAELRILLELNEQEASILRLKVEDLEKENAESKKYVRELQAK 726          
BLAST of Prefoldin vs. Ensembl Fly
Match: CG18304 (gene:FBgn0031869 transcript:FBtr0079367)

HSP 1 Score: 89.7373 bits (221), Expect = 3.260e-17
Identity = 78/243 (32.10%), Postives = 125/243 (51.44%), Query Frame = 1
Query: 1132 QLRVRMEEIEQLCQDVMEENDMLKXXXXXXXXXXXXXHDHFQEDDTDTLRELKRDLETSNKNCRIFQFKLRKTERRYEQCENERGILEEKLNRLEAQLYSENDVNLIRGLEEELRVAKEVSVRLNSELELVDEKRSYFEEDNKHLKEELKDSETRRRSLEAELSKCRQEIEKL--KSLDSSGALQIPDTASKRKNRNLESLSREPSFEEQSLQRELDAAKERETDLTEQLKFAEDDIRKLKRR 1854
            +LR +++  EQ+C+++MEEN   K+E   +Q E++E+ D F++D+      L++DLE + KNCRI  FKL+K++R+ E  E ER       +   A+L      N I+ LEEELR + E++ +L +E                   EEL++   ++  +   L K      K   +SL   G+ + P                      Q LQREL  + ERETDL +QLKFAE+++++L+ R
Sbjct:  434 ELRRKLQAAEQICEELMEENQSAKKEILNLQAEMDEVQDTFRDDEVKAKTSLQKDLEKATKNCRILSFKLKKSDRKIETLEQERQ------SSFNAELS-----NKIKKLEEELRFSNELTRKLQAE------------------AEELRNPGKKKAPMLGVLGKSTSADAKFTRESLTRGGSQEDP----------------------QHLQRELQDSIERETDLKDQLKFAEEELQRLRDR 625          
BLAST of Prefoldin vs. Ensembl Fly
Match: CG18304 (gene:FBgn0031869 transcript:FBtr0332327)

HSP 1 Score: 89.3521 bits (220), Expect = 3.520e-17
Identity = 78/243 (32.10%), Postives = 125/243 (51.44%), Query Frame = 1
Query: 1132 QLRVRMEEIEQLCQDVMEENDMLKXXXXXXXXXXXXXHDHFQEDDTDTLRELKRDLETSNKNCRIFQFKLRKTERRYEQCENERGILEEKLNRLEAQLYSENDVNLIRGLEEELRVAKEVSVRLNSELELVDEKRSYFEEDNKHLKEELKDSETRRRSLEAELSKCRQEIEKL--KSLDSSGALQIPDTASKRKNRNLESLSREPSFEEQSLQRELDAAKERETDLTEQLKFAEDDIRKLKRR 1854
            +LR +++  EQ+C+++MEEN   K+E   +Q E++E+ D F++D+      L++DLE + KNCRI  FKL+K++R+ E  E ER       +   A+L      N I+ LEEELR + E++ +L +E                   EEL++   ++  +   L K      K   +SL   G+ + P                      Q LQREL  + ERETDL +QLKFAE+++++L+ R
Sbjct:  440 ELRRKLQAAEQICEELMEENQSAKKEILNLQAEMDEVQDTFRDDEVKAKTSLQKDLEKATKNCRILSFKLKKSDRKIETLEQERQ------SSFNAELS-----NKIKKLEEELRFSNELTRKLQAE------------------AEELRNPGKKKAPMLGVLGKSTSADAKFTRESLTRGGSQEDP----------------------QHLQRELQDSIERETDLKDQLKFAEEELQRLRDR 631          
BLAST of Prefoldin vs. Ensembl Zebrafish
Match: soga3a (SOGA family member 3a [Source:ZFIN;Acc:ZDB-GENE-100921-84])

HSP 1 Score: 114.39 bits (285), Expect = 5.833e-25
Identity = 119/408 (29.17%), Postives = 219/408 (53.68%), Query Frame = 1
Query: 1150 EEIEQLCQDVMEENDMLKXXXXXXXXXXXXXHDHFQEDDTDTLRELKRDLETSNKNCRIFQFKLRKTERRYEQCENERGILEEKLNRLEAQLYSENDVNLIRGLEEELRVAKEVSVRLNSELELVDEKRSYFEEDNKHLKEELKDSETRRRSLEAELSKCRQEIEKLKSLDSSGA-LQIPDTASKRKNRNLES------------------LSREPSFEEQSLQR------ELDA----------AKERETDLTEQLKFAEDDIRKLKRRFNDIEEENDSLSKKLETI----MKSTNIEDNEFDDNASVRALKIQVELLEQQNSTLRKKFVSIEKENINLSNELRQAKAKSNS--GTEKSDDTLKDEKYKLLEQ-------KINDLHSDVERLEKENRRLTLLNSLQQ 2229
            EEIE+L QD   END LK E +EM+ E++EM D F E+D   L++++R+LE ++KNCRI Q++LRK ER+                R+      E D  L+R LE++L+VAK+VSVRL++ELE V++KR+  +++N+ L+++L + E  +++L+ EL K +    K +  D   +  + P T ++ +N +L+                   + +E    EQ LQ+      ++D+             RE++L  +L+  E++   L R+  ++E EN  L  +L+ +    +     + +  + + ++  L+ Q++L+E +   LR+    +E++N  +++EL + K K+ S  G+  S   +   K + L++       +IN+L   V +L+ ENR   LL+++Q+
Sbjct:  209 EEIERL-QD---ENDFLKHEIDEMRAEMDEMRDTFYEEDACQLQDMRRELERAHKNCRILQYRLRKAERK----------------RMRYAETGEIDSELLRSLEQDLKVAKDVSVRLHNELENVEDKRARTDDENERLRQQLIEVEVTKQALQNELDKTKDLSLKRRGKDVQKSEKRTPQTPTEEENEDLKCQLAFIKEEAVLMRKKMAKIDKEKDRLEQELQKYRSFYGDVDSPLPKGEAGGPPTTRESELKLRLRLVEEEANILGRKIVELEVENRGLKAELDDLRGDELTGGAADSSSREQSEALSELRQQLQLVEDEAELLRRNLADVEEQNTKMTSELNKLKYKAGSHEGSRYSSSAVDGAKLEALQEELKAARLQINELSGKVMQLQYENR--VLLSNMQR 594          
BLAST of Prefoldin vs. Ensembl Zebrafish
Match: soga3a (SOGA family member 3a [Source:ZFIN;Acc:ZDB-GENE-100921-84])

HSP 1 Score: 114.39 bits (285), Expect = 5.833e-25
Identity = 119/408 (29.17%), Postives = 219/408 (53.68%), Query Frame = 1
Query: 1150 EEIEQLCQDVMEENDMLKXXXXXXXXXXXXXHDHFQEDDTDTLRELKRDLETSNKNCRIFQFKLRKTERRYEQCENERGILEEKLNRLEAQLYSENDVNLIRGLEEELRVAKEVSVRLNSELELVDEKRSYFEEDNKHLKEELKDSETRRRSLEAELSKCRQEIEKLKSLDSSGA-LQIPDTASKRKNRNLES------------------LSREPSFEEQSLQR------ELDA----------AKERETDLTEQLKFAEDDIRKLKRRFNDIEEENDSLSKKLETI----MKSTNIEDNEFDDNASVRALKIQVELLEQQNSTLRKKFVSIEKENINLSNELRQAKAKSNS--GTEKSDDTLKDEKYKLLEQ-------KINDLHSDVERLEKENRRLTLLNSLQQ 2229
            EEIE+L QD   END LK E +EM+ E++EM D F E+D   L++++R+LE ++KNCRI Q++LRK ER+                R+      E D  L+R LE++L+VAK+VSVRL++ELE V++KR+  +++N+ L+++L + E  +++L+ EL K +    K +  D   +  + P T ++ +N +L+                   + +E    EQ LQ+      ++D+             RE++L  +L+  E++   L R+  ++E EN  L  +L+ +    +     + +  + + ++  L+ Q++L+E +   LR+    +E++N  +++EL + K K+ S  G+  S   +   K + L++       +IN+L   V +L+ ENR   LL+++Q+
Sbjct:  209 EEIERL-QD---ENDFLKHEIDEMRAEMDEMRDTFYEEDACQLQDMRRELERAHKNCRILQYRLRKAERK----------------RMRYAETGEIDSELLRSLEQDLKVAKDVSVRLHNELENVEDKRARTDDENERLRQQLIEVEVTKQALQNELDKTKDLSLKRRGKDVQKSEKRTPQTPTEEENEDLKCQLAFIKEEAVLMRKKMAKIDKEKDRLEQELQKYRSFYGDVDSPLPKGEAGGPPTTRESELKLRLRLVEEEANILGRKIVELEVENRGLKAELDDLRGDELTGGAADSSSREQSEALSELRQQLQLVEDEAELLRRNLADVEEQNTKMTSELNKLKYKAGSHEGSRYSSSAVDGAKLEALQEELKAARLQINELSGKVMQLQYENR--VLLSNMQR 594          
BLAST of Prefoldin vs. Ensembl Zebrafish
Match: soga1 (suppressor of glucose, autophagy associated 1 [Source:ZFIN;Acc:ZDB-GENE-090313-188])

HSP 1 Score: 112.464 bits (280), Expect = 5.182e-24
Identity = 129/453 (28.48%), Postives = 221/453 (48.79%), Query Frame = 1
Query: 1087 ESMNSKHQEILAENEQLRVRMEEIEQLCQDVMEENDMLKXXXXXXXXXXXXXHDHFQEDDTDTLRELKRDLETSNKNCRIFQFKLRKTERRYEQCENERGILEEKLNRLEAQLYSENDVNLIRGLEEELRVAKEVSVRLNSELELVDEKRSYFEEDNKHLKEELKDSETRRRSLEAELSKCRQEIEKLKSL------DSSGALQIPDTASKRKN--------------------RNLESLSREPSFEEQSLQRELDAA----------KERETDLTEQLKFAEDDIRKLKRRFNDIEEENDSLSKKLETIMKSTNIEDNE--------------FDDNASVRALKIQVELLEQQNSTLRKKFVSIEKENINLSNELRQAKAKSNSGTE------------------KSDDTLKDEKYK-LLEQK--INDLHSDVERLEKENRRLTLLNSLQQA 2232
            E M+  H+E++ E E+LR               END LK+E EE++ E+ EM D + E+D   L+EL++ L+ +NK CRI Q++L+K ERR                 +      + D  LIR LE++++VAK+VS+RL++EL+ V++KRS  E++N+ L+ +L+D E  ++ L+AE+ K R+   K +S       D   + Q P+ +S  K                     ++ ES+ RE   + +S+  E+DA+            RE ++   LK  E++   L RR  ++E EN    + L   M    I+D+               F  + +V  L+  ++ +E++   LR+  + +E++N  L NEL   K++  + TE                   S+D L +  +K LL  +  I +L+  V++L+ ENR   LL++LQ+ 
Sbjct:  270 ELMDGMHEELVREIEELR--------------SENDYLKDEMEELRSEMLEMRDMYLEEDVYQLQELRQQLDQANKTCRILQYRLKKAERR----------------SIRVAQTGQVDGELIRTLEQDVKVAKDVSIRLHNELDTVEKKRSRLEQENEELRVKLQDLEVAKQVLQAEMEKARENSLKKRSARPNNKPDKKASPQPPEDSSDLKCQLHFAKEESALMCKKLTKMVKDNESM-REELAKFRSMYGEVDASLTVEEVADSPHTREAEVKVHLKLVEEEANLLSRRIVELEVEN----RGLRAEMDDMKIQDSPGGIGITGGVGSHLLFSTSENVMELQRHLQFVEEEADLLRRSLIEMEEQNKLLMNELNHYKSELPAVTEIEPSSSSTTITSPTILPGPSEDALNEATHKELLAARLQIAELNGKVKKLQYENR--VLLSNLQRC 685          
BLAST of Prefoldin vs. Ensembl Zebrafish
Match: soga1 (suppressor of glucose, autophagy associated 1 [Source:ZFIN;Acc:ZDB-GENE-090313-188])

HSP 1 Score: 112.079 bits (279), Expect = 6.018e-24
Identity = 129/453 (28.48%), Postives = 221/453 (48.79%), Query Frame = 1
Query: 1087 ESMNSKHQEILAENEQLRVRMEEIEQLCQDVMEENDMLKXXXXXXXXXXXXXHDHFQEDDTDTLRELKRDLETSNKNCRIFQFKLRKTERRYEQCENERGILEEKLNRLEAQLYSENDVNLIRGLEEELRVAKEVSVRLNSELELVDEKRSYFEEDNKHLKEELKDSETRRRSLEAELSKCRQEIEKLKSL------DSSGALQIPDTASKRKN--------------------RNLESLSREPSFEEQSLQRELDAA----------KERETDLTEQLKFAEDDIRKLKRRFNDIEEENDSLSKKLETIMKSTNIEDNE--------------FDDNASVRALKIQVELLEQQNSTLRKKFVSIEKENINLSNELRQAKAKSNSGTE------------------KSDDTLKDEKYK-LLEQK--INDLHSDVERLEKENRRLTLLNSLQQA 2232
            E M+  H+E++ E E+LR               END LK+E EE++ E+ EM D + E+D   L+EL++ L+ +NK CRI Q++L+K ERR                 +      + D  LIR LE++++VAK+VS+RL++EL+ V++KRS  E++N+ L+ +L+D E  ++ L+AE+ K R+   K +S       D   + Q P+ +S  K                     ++ ES+ RE   + +S+  E+DA+            RE ++   LK  E++   L RR  ++E EN    + L   M    I+D+               F  + +V  L+  ++ +E++   LR+  + +E++N  L NEL   K++  + TE                   S+D L +  +K LL  +  I +L+  V++L+ ENR   LL++LQ+ 
Sbjct:  270 ELMDGMHEELVREIEELR--------------SENDYLKDEMEELRSEMLEMRDMYLEEDVYQLQELRQQLDQANKTCRILQYRLKKAERR----------------SIRVAQTGQVDGELIRTLEQDVKVAKDVSIRLHNELDTVEKKRSRLEQENEELRVKLQDLEVAKQVLQAEMEKARENSLKKRSARPNNKPDKKASPQPPEDSSDLKCQLHFAKEESALMCKKLTKMVKDNESM-REELAKFRSMYGEVDASLTVEEVADSPHTREAEVKVHLKLVEEEANLLSRRIVELEVEN----RGLRAEMDDMKIQDSPGGIGITGGVGSHLLFSTSENVMELQRHLQFVEEEADLLRRSLIEMEEQNKLLMNELNHYKSELPAVTEIEPSSSSTTITSPTILPGPSEDALNEATHKELLAARLQIAELNGKVKKLQYENR--VLLSNLQRC 685          
BLAST of Prefoldin vs. Ensembl Zebrafish
Match: CR388032.1 (suppressor of glucose, autophagy associated 1 [Source:NCBI gene;Acc:797906])

HSP 1 Score: 108.227 bits (269), Expect = 9.619e-23
Identity = 127/453 (28.04%), Postives = 221/453 (48.79%), Query Frame = 1
Query: 1087 ESMNSKHQEILAENEQLRVRMEEIEQLCQDVMEENDMLKXXXXXXXXXXXXXHDHFQEDDTDTLRELKRDLETSNKNCRIFQFKLRKTERRYEQCENERGILEEKLNRLEAQLYSENDVNLIRGLEEELRVAKEVSVRLNSELELVDEKRSYFEEDNKHLKEELKDSETRRRSLEAELSKCRQEIEKLKSL------DSSGALQIPDTASKRKN--------------------RNLESLSREPSFEEQSLQRELDAA----------KERETDLTEQLKFAEDDIRKLKRRFNDIEEENDSLSKKLETIMKSTNIEDNE--------------FDDNASVRALKIQVELLEQQNSTLRKKFVSIEKENINLSNELRQAKAKSNSGTE------------------KSDDTLKDEKYK-LLEQK--INDLHSDVERLEKENRRLTLLNSLQQA 2232
            E M+  ++E++ E E+LR               END LK+E EE++ E+ EM D + E+D   L+EL++ L+ +NK CRI Q++L+K ERR                 +      + D  LIR LE++++VAK+VS+RL++EL+ V++KRS  E++N+ L+ +L+D E  ++ L+AE+ K R+   K +S       D   + Q P+ +S  K                     ++ E++ RE   + +S+  E+DA+            RE ++   LK  E++   L RR  ++E EN    + L   M    I+D+               F  + +V  L+  ++ +E++   LR+  + +E++N  L NEL   K++  + TE                   S+D L +  +K LL  +  I +L+  V++L+ ENR   LL++LQ+ 
Sbjct:  270 ELMDGMNEELVREIEELR--------------SENDYLKDEMEELRSEMLEMRDMYLEEDVYQLQELRQQLDQANKTCRILQYRLKKAERR----------------SIRVAQTGQVDGELIRTLEQDVKVAKDVSIRLHNELDTVEKKRSRLEQENEELRVKLQDLEVAKQVLQAEMEKARENSLKKRSARPNNKPDKKASPQPPEDSSDLKCQLHFAKEESALMCKKLTKMVKDNEAM-REELAKFRSMYGEVDASLTVEEVADSPHTREAEVKVHLKLVEEEANLLSRRIVELEVEN----RGLRAEMDDMKIQDSPGGIGITGGVGSHLLFSTSENVMELQRHLQFVEEEADLLRRSLIEMEEQNKLLMNELNHYKSELPAVTEIEPSSSSTTITSPTILPGPSEDALNEATHKELLAARLQIAELNGKVKKLQYENR--VLLSNLQRC 685          
BLAST of Prefoldin vs. Ensembl Xenopus
Match: rasa1 (RAS p21 protein activator (GTPase activating protein) 1 [Source:Xenbase;Acc:XB-GENE-6085075])

HSP 1 Score: 104.76 bits (260), Expect = 1.370e-21
Identity = 127/461 (27.55%), Postives = 232/461 (50.33%), Query Frame = 1
Query: 1000 RIQHLDEEVRNYRERLKLPESDQANIDVSESMNSKHQEILAENEQLRVRMEEIEQLCQDVMEENDMLKXXXXXXXXXXXXXHDHFQEDDTDTLRELKRDLETSNKNCRIFQFKLRKTERRYEQCENERGILEEKLNRLEAQLYSENDVNLIRGLEEELRVAKEVSVRLNSELELVDEKRSYFEEDNKHLKEELKDSETRRRSLEAELSKCRQ---------EIEKLKSL-------DSSGALQIPDTASKRKNRNLESLSREPSFEEQSLQR------ELDA----------AKERETDLTEQLKFAEDDIRKLKRRFNDIEEENDSLSKKLETIM-----------KSTNIEDNEFDDNA-SVRALKIQVELLEQQNSTLRKKFVSIEKENINLSNELRQAKAKS-------NSGTEKSDDTLKDEKYKLLEQKINDLHSDVERLEKENRRLTLLNSLQQ 2229
            R+Q++D     +R+R   P SD+     + SM ++++     +   RV+ E++ +  +++  END LK+E +E++ E+EEM D + E+D   L+EL+R+L+ +NKNCRI Q++LRK E++                 L+     + D  LIR LE++L+VAK+VSVRL+ ELE V+EKR   E++N+ L++++ + E  R++L  EL + ++         E+ K K +       D    LQ     +    + +  L +E    EQ L++      ++D              RE +L  +LK  E++   L R+  ++E EN  +  ++E +              ++I  + + D+  S   L+  ++ +E++   LR+    IE  N  L+ EL + K          +  T K + ++++E  K    +IN+L   V +L+ ENR   LL+++Q+
Sbjct:  208 RVQNVD----THRQRNAAPPSDEPR--ETGSMGAQYKRPATPS---RVQEEDLLRELEELRSENDYLKDELDELRAEMEEMRDSYLEEDVYQLQELRRELDRANKNCRILQYRLRKAEQK----------------SLKVAQTGQVDGELIRSLEQDLKVAKDVSVRLHHELESVEEKRIKTEDENEELRQQIIEMEITRQALHNELDRTKESTLKRKGSREMHKEKKIISQEDNADLKCQLQFAKEEAALMRKKMAKLGKEKDDLEQELEKYKSIYGDVDGPLSTGETGGPPSTREAELKLRLKLVEEEANILSRKIVELEVENRGIKAEMEDLRCQLEKEFLSREYVSSIPTSPYGDSMESAAELRRHLQFVEEEAELLRRSISEIEDHNKQLTTELNRFKFGPEQDLVWIDDSTSKCNGSVQEE-LKSARIQINELSGKVMKLQYENR--VLLSNVQR 640          
BLAST of Prefoldin vs. Ensembl Xenopus
Match: rasa1 (RAS p21 protein activator (GTPase activating protein) 1 [Source:Xenbase;Acc:XB-GENE-6085075])

HSP 1 Score: 104.375 bits (259), Expect = 2.241e-21
Identity = 127/461 (27.55%), Postives = 232/461 (50.33%), Query Frame = 1
Query: 1000 RIQHLDEEVRNYRERLKLPESDQANIDVSESMNSKHQEILAENEQLRVRMEEIEQLCQDVMEENDMLKXXXXXXXXXXXXXHDHFQEDDTDTLRELKRDLETSNKNCRIFQFKLRKTERRYEQCENERGILEEKLNRLEAQLYSENDVNLIRGLEEELRVAKEVSVRLNSELELVDEKRSYFEEDNKHLKEELKDSETRRRSLEAELSKCRQ---------EIEKLKSL-------DSSGALQIPDTASKRKNRNLESLSREPSFEEQSLQR------ELDA----------AKERETDLTEQLKFAEDDIRKLKRRFNDIEEENDSLSKKLETIM-----------KSTNIEDNEFDDNA-SVRALKIQVELLEQQNSTLRKKFVSIEKENINLSNELRQAKAKS-------NSGTEKSDDTLKDEKYKLLEQKINDLHSDVERLEKENRRLTLLNSLQQ 2229
            R+Q++D     +R+R   P SD+     + SM ++++     +   RV+ E++ +  +++  END LK+E +E++ E+EEM D + E+D   L+EL+R+L+ +NKNCRI Q++LRK E++                 L+     + D  LIR LE++L+VAK+VSVRL+ ELE V+EKR   E++N+ L++++ + E  R++L  EL + ++         E+ K K +       D    LQ     +    + +  L +E    EQ L++      ++D              RE +L  +LK  E++   L R+  ++E EN  +  ++E +              ++I  + + D+  S   L+  ++ +E++   LR+    IE  N  L+ EL + K          +  T K + ++++E  K    +IN+L   V +L+ ENR   LL+++Q+
Sbjct:  189 RVQNVD----THRQRNAAPPSDEPR--ETGSMGAQYKRPATPS---RVQEEDLLRELEELRSENDYLKDELDELRAEMEEMRDSYLEEDVYQLQELRRELDRANKNCRILQYRLRKAEQK----------------SLKVAQTGQVDGELIRSLEQDLKVAKDVSVRLHHELESVEEKRIKTEDENEELRQQIIEMEITRQALHNELDRTKESTLKRKGSREMHKEKKIISQEDNADLKCQLQFAKEEAALMRKKMAKLGKEKDDLEQELEKYKSIYGDVDGPLSTGETGGPPSTREAELKLRLKLVEEEANILSRKIVELEVENRGIKAEMEDLRCQLEKEFLSREYVSSIPTSPYGDSMESAAELRRHLQFVEEEAELLRRSISEIEDHNKQLTTELNRFKFGPEQDLVWIDDSTSKCNGSVQEE-LKSARIQINELSGKVMKLQYENR--VLLSNVQR 621          
BLAST of Prefoldin vs. Ensembl Xenopus
Match: rasa1 (RAS p21 protein activator (GTPase activating protein) 1 [Source:Xenbase;Acc:XB-GENE-6085075])

HSP 1 Score: 100.908 bits (250), Expect = 2.459e-20
Identity = 105/365 (28.77%), Postives = 182/365 (49.86%), Query Frame = 1
Query: 1246 DHFQEDDTDTLRELKRDLETSNKNCRIFQFKLRKTERRYEQCENERGILEEKLNRLEAQLYSENDVNLIRGLEEELRVAKEVSVRLNSELELVDEKRSYFEEDNKHLKEELKDSETRRRSLEAELSKCRQEIEKLKS---LDSSGALQIPDTASKRKNRNLESLSREPSFEEQSLQR------ELDA----------AKERETDLTEQLKFAEDDIRKLKRRFNDIEEENDSLSKKLETIM-----------KSTNIEDNEFDDNA-SVRALKIQVELLEQQNSTLRKKFVSIEKENINLSNELRQAKAKS-------NSGTEKSDDTLKDEKYKLLEQKINDLHSDVERLEKENRRLTLLNSLQ 2226
            D + E+D   L+EL+R+L+ +NKNCRI Q++LRK E++                 L+     + D  LIR LE++L+VAK+VSVRL+ ELE V+EKR   E++N+ L++++ + E  R++L  EL + + E+  L S   L  S      + A  RK   +  L +E    EQ L++      ++D              RE +L  +LK  E++   L R+  ++E EN  +  ++E +              ++I  + + D+  S   L+  ++ +E++   LR+    IE  N  L+ EL + K          +  T K + ++++E  K    +IN+L   V +L+ ENR   LL+++Q
Sbjct:    6 DSYLEEDVYQLQELRRELDRANKNCRILQYRLRKAEQK----------------SLKVAQTGQVDGELIRSLEQDLKVAKDVSVRLHHELESVEEKRIKTEDENEELRQQIIEMEITRQALHNELDRTK-EVSMLLSCNMLPVSLLFTYEEAALMRK--KMAKLGKEKDDLEQELEKYKSIYGDVDGPLSTGETGGPPSTREAELKLRLKLVEEEANILSRKIVELEVENRGIKAEMEDLRCQLEKEFLSREYVSSIPTSPYGDSMESAAELRRHLQFVEEEAELLRRSISEIEDHNKQLTTELNRFKFGPEQDLVWIDDSTSKCNGSVQEE-LKSARIQINELSGKVMKLQYENR--VLLSNVQ 348          
BLAST of Prefoldin vs. Ensembl Xenopus
Match: SOGA1 (suppressor of glucose, autophagy associated 1 [Source:NCBI gene;Acc:100493417])

HSP 1 Score: 97.8265 bits (242), Expect = 1.782e-19
Identity = 108/379 (28.50%), Postives = 192/379 (50.66%), Query Frame = 1
Query: 1186 ENDMLKXXXXXXXXXXXXXHDHFQEDDTDTLRELKRDLETSNKNCRIFQFKLRKTERRYEQCENERGILEEKLNRLEAQLYSENDVNLIRGLEEELRVAKEVSVRLNSELELVDEKRSYFEEDNKHLKEELKDSETRRRSLEAELSKCRQEIEKLKSLDSSGALQIPDTASKRKNRNLESLS------REPSFEEQSLQRELDAA----------KERETDLTEQLKFAEDDIRKLKRRFNDIEEENDSLSKKLETIMKSTNIE----DNEF-----DDNASVRALKIQVELLEQQNSTLRKKFVSIEKENINLSNELRQAKAKSNSGTEKSDDTL------KDEKYKLLEQKINDLHSDVERLEKENRRLTLLNSLQQ 2229
            END LK+E EE++ E+ EM D + E+D   L+EL++ LE  +K CRI Q++L+K ERR                 L      + D  LI  LE++++VAK+VSVRL+SELE V++KR   E++N+ L++ L +++  ++ L+ E+ K ++E     S D    L      S    + L  L+      +E   + +S+  ++D++            RE +L   LK  E++   L RR  ++E EN  L  +++ +    + E    D  F     +   +   L+  ++ +E++   LR+  + +E +N  L NEL + K+  +     S+D+         E+    + +I++L   V++L+ ENR   LL++LQ+
Sbjct:  156 ENDYLKDEIEELRSEMLEMRDVYMEEDVYQLQELRQQLEQVHKTCRILQYRLKKAERR----------------GLRVAQTGQVDSELISTLEQDVKVAKDVSVRLHSELEAVEKKRIKLEDENEELRQRLIETDLAKQVLQNEMEKMKEE----DSADLKCQLHFAKEESALMCKKLTKLAKDNDNMKEDLTKYRSMYGDMDSSLSVEELANSPHSREAELKVHLKLVEEEANLLSRRIVELEVENRGLRAEMDEMKIHHDRELLSQDGRFAFPPGESGDNFVELRRHLQFVEEEAELLRRSMMELEDQNKLLMNELNKYKSDHDLDITLSEDSCSVISEPSQEELTTAKMQISELSGKVKKLQYENR--VLLSNLQR 512          
BLAST of Prefoldin vs. Ensembl Xenopus
Match: SOGA1 (suppressor of glucose, autophagy associated 1 [Source:NCBI gene;Acc:100493417])

HSP 1 Score: 94.7449 bits (234), Expect = 1.802e-18
Identity = 87/304 (28.62%), Postives = 159/304 (52.30%), Query Frame = 1
Query: 1186 ENDMLKXXXXXXXXXXXXXHDHFQEDDTDTLRELKRDLETSNKNCRIFQFKLRKTERRYEQCENERGILEEKLNRLEAQLYSENDVNLIRGLEEELRVAKEVSVRLNSELELVDEKRSYFEEDNKHLKEELKDSETRRRSLEAELSKCRQEIEKLKSLDSSGALQIPDTASKRKNRNLESLSREPSFEEQSLQRELDAAKERETDLTEQLKFAEDDIRKLKRRFNDIEEENDSLSKKLET-------IMKSTNIEDNEFDDNASVRALKIQVELLEQQNSTLRKKFVSIEKENINLSNELRQAK 2076
            END LK+E EE++ E+ EM D + E+D   L+EL++ LE  +K CRI Q++L+K ERR                 L      + D  LI  LE++++VAK+VSVRL+SELE V++KR   E++N+ L++ L +++  ++ L+ E+ K ++                    S +K R+   + ++PS +E S             DL  QL FA+++   + ++   + ++ND++ + L         +  S ++E+     ++    LK+ ++L+E++ + L ++ V +E EN  L  E+ + K
Sbjct:  156 ENDYLKDEIEELRSEMLEMRDVYMEEDVYQLQELRQQLEQVHKTCRILQYRLKKAERR----------------GLRVAQTGQVDSELISTLEQDVKVAKDVSVRLHSELEAVEKKRIKLEDENEELRQRLIETDLAKQVLQNEMEKMKEN-------------------SLKKRRSSGRIDKKPSLQEDS------------ADLKCQLHFAKEESALMCKKLTKLAKDNDNMKEDLTKYRSMYGDMDSSLSVEELANSPHSREAELKVHLKLVEEEANLLSRRIVELEVENRGLRAEMDEMK 412          
BLAST of Prefoldin vs. Ensembl Mouse
Match: Soga3 (SOGA family member 3 [Source:MGI Symbol;Acc:MGI:1914662])

HSP 1 Score: 111.694 bits (278), Expect = 5.736e-24
Identity = 109/356 (30.62%), Postives = 191/356 (53.65%), Query Frame = 1
Query: 1183 EENDMLKXXXXXXXXXXXXXHDHFQEDDTDTLRELKRDLETSNKNCRIFQFKLRKTERRYEQCENERGILEEKLNRLEAQLYSENDVNLIRGLEEELRVAKEVSVRLNSELELVDEKRSYFEEDNKHLKEELKDSETRRRSLEAELSKCRQEIEKLKSLDSSGALQIPDTASKRKNRNLESLSREPSFEEQSLQRELDAAKERETDLTEQLKFAEDDIRKLKRRFNDIEEENDSLSKKLETIMK-----STNIEDNEFDDNASVR--ALKIQVELLEQQNSTLRKKFVSIEKENINLSNELRQAKAK-----SNSGTEKSDDTLKD--EKYKLLEQKINDLHSDVERLEKENRRLT 2208
            EEN+ LK E +E++ E++EM D F E+D   L+E++ +LE +NKNCRI Q++LRK ER+                RL      E D  L+R LE++L+VAK+VSVRL+ ELE V+EKR+  E++N+ L+++L + E  +++L+ EL       EK+K L          +  +R +++L      P  E+++ Q   +   E   DL  QL+F +++   ++++   I++E D    +L+          + +   E     S R   LK+++ L+E++ + L +K V +E EN  L  EL   + +     SN    +  ++L +  +  +L+E +   L  +V  LE++N+R+T
Sbjct:  359 EENETLKNEIDELRTEMDEMRDTFFEEDACQLQEMRHELERANKNCRILQYRLRKAERK----------------RLRYAQTGEIDGELLRSLEQDLKVAKDVSVRLHHELENVEEKRTTTEDENEKLRQQLIEVEIAKQALQNEL-------EKMKEL----------SLKRRGSKDL------PKSEKKAQQTPTEDDNE---DLKCQLQFVKEEAALMRKKMAKIDKEKDRFEHELQKYRSFYGDLDSPLPKGEAGGPPSTREAELKLRLRLVEEEANILGRKIVELEVENRGLKAELDDLRGEDFNGSSNPLMREQSESLSELRQHLQLVEDETELLRRNVADLEEQNKRIT 672          
BLAST of Prefoldin vs. Ensembl Mouse
Match: Mtcl1 (microtubule crosslinking factor 1 [Source:MGI Symbol;Acc:MGI:1915867])

HSP 1 Score: 111.694 bits (278), Expect = 1.036e-23
Identity = 97/300 (32.33%), Postives = 168/300 (56.00%), Query Frame = 1
Query: 1186 ENDMLKXXXXXXXXXXXXXHDHFQEDDTDTLRELKRDLETSNKNCRIFQFKLRKTERRYEQCENERGILEEKLNRLEAQLYSENDVNLIRGLEEELRVAKEVSVRLNSELELVDEKRSYFEEDNKHLKEELKDSETRRRSLEAELSKCRQEIEKLKSLDSSGALQIPDTASKRKNRNLESLSREPSFEEQSLQRELDAAKERETDLTEQLKFAEDDIRKLKRRFNDIEEENDSLSKKLETIMK-----STNIEDNEFDDNASVR--ALKIQVELLEQQNSTLRKKFVSIEKENINLSNEL 2064
            END LK+E +E++ E+EEM D + E+D   L+EL+R+L+ +NKNCRI Q++LRK E++                 L+     + D  LIR LE++L+VAK+VSVRL+ ELE V+EKR+  E+DN+ L++++ + E  R++L+        E+E+L+           +++ KR+       SRE  ++E+ L  + D+A     DL  QL+F +++   ++++   +  E D L ++L+          + +   E     S R   LK++++L+E++ S L +K V +E EN  L  E+
Sbjct:  338 ENDYLKDELDELRAEMEEMRDSYLEEDGYQLQELRRELDRANKNCRILQYRLRKAEQKS----------------LKVAETGQVDGELIRSLEQDLKVAKDVSVRLHHELETVEEKRAKAEDDNETLRQQMIEVEVSRQALQ-------NEVERLR-----------ESSLKRRG------SRE-MYKEKKLVNQDDSA-----DLKCQLQFVKEEASLMRKKMAKLGREKDELEQELQKYKSLYGDVDSPLPTGEAGGPPSTREAELKLRLKLVEEEASILGRKIVELEVENRGLKAEM 591          
BLAST of Prefoldin vs. Ensembl Mouse
Match: Mtcl1 (microtubule crosslinking factor 1 [Source:MGI Symbol;Acc:MGI:1915867])

HSP 1 Score: 110.923 bits (276), Expect = 1.426e-23
Identity = 97/300 (32.33%), Postives = 168/300 (56.00%), Query Frame = 1
Query: 1186 ENDMLKXXXXXXXXXXXXXHDHFQEDDTDTLRELKRDLETSNKNCRIFQFKLRKTERRYEQCENERGILEEKLNRLEAQLYSENDVNLIRGLEEELRVAKEVSVRLNSELELVDEKRSYFEEDNKHLKEELKDSETRRRSLEAELSKCRQEIEKLKSLDSSGALQIPDTASKRKNRNLESLSREPSFEEQSLQRELDAAKERETDLTEQLKFAEDDIRKLKRRFNDIEEENDSLSKKLETIMK-----STNIEDNEFDDNASVR--ALKIQVELLEQQNSTLRKKFVSIEKENINLSNEL 2064
            END LK+E +E++ E+EEM D + E+D   L+EL+R+L+ +NKNCRI Q++LRK E++                 L+     + D  LIR LE++L+VAK+VSVRL+ ELE V+EKR+  E+DN+ L++++ + E  R++L+        E+E+L+           +++ KR+       SRE  ++E+ L  + D+A     DL  QL+F +++   ++++   +  E D L ++L+          + +   E     S R   LK++++L+E++ S L +K V +E EN  L  E+
Sbjct:  338 ENDYLKDELDELRAEMEEMRDSYLEEDGYQLQELRRELDRANKNCRILQYRLRKAEQKS----------------LKVAETGQVDGELIRSLEQDLKVAKDVSVRLHHELETVEEKRAKAEDDNETLRQQMIEVEVSRQALQ-------NEVERLR-----------ESSLKRRG------SRE-MYKEKKLVNQDDSA-----DLKCQLQFVKEEASLMRKKMAKLGREKDELEQELQKYKSLYGDVDSPLPTGEAGGPPSTREAELKLRLKLVEEEASILGRKIVELEVENRGLKAEM 591          
BLAST of Prefoldin vs. Ensembl Mouse
Match: Soga1 (suppressor of glucose, autophagy associated 1 [Source:MGI Symbol;Acc:MGI:2444575])

HSP 1 Score: 108.997 bits (271), Expect = 5.485e-23
Identity = 94/310 (30.32%), Postives = 160/310 (51.61%), Query Frame = 1
Query: 1186 ENDMLKXXXXXXXXXXXXXHDHFQEDDTDTLRELKRDLETSNKNCRIFQFKLRKTERRYEQCENERGILEEKLNRLEAQLYSENDVNLIRGLEEELRVAKEVSVRLNSELELVDEKRSYFEEDNKHLKEELKDSETRRRSLEAELSKCRQEIEKLKSLDSSGALQIPDTASKRKNRNLESLSREPSFEEQSLQRELDAAKERETDLTEQLKFAEDDIRKLKRRFNDIEEENDSLSKKLETIMK-----STNIEDNEFDDNASVR--ALKIQVELLEQQNSTLRKKFVSIEKENINLSNELRQAKAKSNSG 2094
            END LK+E EE++ E+ EM D + E+D   L+EL++ L+ ++K CRI Q++LRK ERR                 L A    + D  LIRGLE++++V+K++S+RL+ ELE+V++KR   EE+N+ L++ L ++E  ++ L+ EL + R+   K                 KR  R+L    ++P+ +E S             DL  QL FA+++   + ++   + +ENDS+ ++L             +   E  D    R   LK+ ++L+E++ + L ++ V +E EN  L  E+   K     G
Sbjct:  222 ENDYLKDEIEELRAEMLEMRDVYMEEDVYQLQELRQQLDQASKTCRILQYRLRKAERRS----------------LRAAQTGQVDGELIRGLEQDVKVSKDISMRLHKELEVVEKKRMRLEEENEGLRQRLIETELAKQVLQTELDRPREHSLK-----------------KRGTRSLGKTDKKPTAQEDS------------ADLKCQLHFAKEESALMCKKLTKLAKENDSMKEELLKYRSLYGDLDAALSAEELADAPHSRETELKVHLKLVEEEANLLSRRIVELEVENRGLRAEMDDMKDHGGGG 486          
BLAST of Prefoldin vs. Ensembl Mouse
Match: Mtcl1 (microtubule crosslinking factor 1 [Source:MGI Symbol;Acc:MGI:1915867])

HSP 1 Score: 106.686 bits (265), Expect = 2.913e-22
Identity = 86/280 (30.71%), Postives = 152/280 (54.29%), Query Frame = 1
Query: 1246 DHFQEDDTDTLRELKRDLETSNKNCRIFQFKLRKTERRYEQCENERGILEEKLNRLEAQLYSENDVNLIRGLEEELRVAKEVSVRLNSELELVDEKRSYFEEDNKHLKEELKDSETRRRSLEAELSKCRQEIEKLKSLDSSGALQIPDTASKRKNRNLESLSREPSFEEQSLQRELDAAKERETDLTEQLKFAEDDIRKLKRRFNDIEEENDSLSKKLETIMK-----STNIEDNEFDDNASVR--ALKIQVELLEQQNSTLRKKFVSIEKENINLSNEL 2064
            D + E+D   L+EL+R+L+ +NKNCRI Q++LRK E++                 L+     + D  LIR LE++L+VAK+VSVRL+ ELE V+EKR+  E+DN+ L++++ + E  R++L+        E+E+L+           +++ KR+       SRE  ++E+ L  + D+A     DL  QL+F +++   ++++   +  E D L ++L+          + +   E     S R   LK++++L+E++ S L +K V +E EN  L  E+
Sbjct:    6 DSYLEEDGYQLQELRRELDRANKNCRILQYRLRKAEQKS----------------LKVAETGQVDGELIRSLEQDLKVAKDVSVRLHHELETVEEKRAKAEDDNETLRQQMIEVEVSRQALQ-------NEVERLR-----------ESSLKRRG------SRE-MYKEKKLVNQDDSA-----DLKCQLQFVKEEASLMRKKMAKLGREKDELEQELQKYKSLYGDVDSPLPTGEAGGPPSTREAELKLRLKLVEEEASILGRKIVELEVENRGLKAEM 239          
BLAST of Prefoldin vs. UniProt/SwissProt
Match: sp|Q6NZL0|SOGA3_MOUSE (Protein SOGA3 OS=Mus musculus OX=10090 GN=Soga3 PE=1 SV=2)

HSP 1 Score: 111.694 bits (278), Expect = 4.012e-23
Identity = 109/356 (30.62%), Postives = 191/356 (53.65%), Query Frame = 1
Query: 1183 EENDMLKXXXXXXXXXXXXXHDHFQEDDTDTLRELKRDLETSNKNCRIFQFKLRKTERRYEQCENERGILEEKLNRLEAQLYSENDVNLIRGLEEELRVAKEVSVRLNSELELVDEKRSYFEEDNKHLKEELKDSETRRRSLEAELSKCRQEIEKLKSLDSSGALQIPDTASKRKNRNLESLSREPSFEEQSLQRELDAAKERETDLTEQLKFAEDDIRKLKRRFNDIEEENDSLSKKLETIMK-----STNIEDNEFDDNASVR--ALKIQVELLEQQNSTLRKKFVSIEKENINLSNELRQAKAK-----SNSGTEKSDDTLKD--EKYKLLEQKINDLHSDVERLEKENRRLT 2208
            EEN+ LK E +E++ E++EM D F E+D   L+E++ +LE +NKNCRI Q++LRK ER+                RL      E D  L+R LE++L+VAK+VSVRL+ ELE V+EKR+  E++N+ L+++L + E  +++L+ EL       EK+K L          +  +R +++L      P  E+++ Q   +   E   DL  QL+F +++   ++++   I++E D    +L+          + +   E     S R   LK+++ L+E++ + L +K V +E EN  L  EL   + +     SN    +  ++L +  +  +L+E +   L  +V  LE++N+R+T
Sbjct:  359 EENETLKNEIDELRTEMDEMRDTFFEEDACQLQEMRHELERANKNCRILQYRLRKAERK----------------RLRYAQTGEIDGELLRSLEQDLKVAKDVSVRLHHELENVEEKRTTTEDENEKLRQQLIEVEIAKQALQNEL-------EKMKEL----------SLKRRGSKDL------PKSEKKAQQTPTEDDNE---DLKCQLQFVKEEAALMRKKMAKIDKEKDRFEHELQKYRSFYGDLDSPLPKGEAGGPPSTREAELKLRLRLVEEEANILGRKIVELEVENRGLKAELDDLRGEDFNGSSNPLMREQSESLSELRQHLQLVEDETELLRRNVADLEEQNKRIT 672          
BLAST of Prefoldin vs. UniProt/SwissProt
Match: sp|Q3UHU5|MTCL1_MOUSE (Microtubule cross-linking factor 1 OS=Mus musculus OX=10090 GN=Mtcl1 PE=1 SV=1)

HSP 1 Score: 111.694 bits (278), Expect = 7.250e-23
Identity = 97/300 (32.33%), Postives = 168/300 (56.00%), Query Frame = 1
Query: 1186 ENDMLKXXXXXXXXXXXXXHDHFQEDDTDTLRELKRDLETSNKNCRIFQFKLRKTERRYEQCENERGILEEKLNRLEAQLYSENDVNLIRGLEEELRVAKEVSVRLNSELELVDEKRSYFEEDNKHLKEELKDSETRRRSLEAELSKCRQEIEKLKSLDSSGALQIPDTASKRKNRNLESLSREPSFEEQSLQRELDAAKERETDLTEQLKFAEDDIRKLKRRFNDIEEENDSLSKKLETIMK-----STNIEDNEFDDNASVR--ALKIQVELLEQQNSTLRKKFVSIEKENINLSNEL 2064
            END LK+E +E++ E+EEM D + E+D   L+EL+R+L+ +NKNCRI Q++LRK E++                 L+     + D  LIR LE++L+VAK+VSVRL+ ELE V+EKR+  E+DN+ L++++ + E  R++L+        E+E+L+           +++ KR+       SRE  ++E+ L  + D+A     DL  QL+F +++   ++++   +  E D L ++L+          + +   E     S R   LK++++L+E++ S L +K V +E EN  L  E+
Sbjct:  338 ENDYLKDELDELRAEMEEMRDSYLEEDGYQLQELRRELDRANKNCRILQYRLRKAEQKS----------------LKVAETGQVDGELIRSLEQDLKVAKDVSVRLHHELETVEEKRAKAEDDNETLRQQMIEVEVSRQALQ-------NEVERLR-----------ESSLKRRG------SRE-MYKEKKLVNQDDSA-----DLKCQLQFVKEEASLMRKKMAKLGREKDELEQELQKYKSLYGDVDSPLPTGEAGGPPSTREAELKLRLKLVEEEASILGRKIVELEVENRGLKAEM 591          
BLAST of Prefoldin vs. UniProt/SwissProt
Match: sp|Q5TF21|SOGA3_HUMAN (Protein SOGA3 OS=Homo sapiens OX=9606 GN=SOGA3 PE=3 SV=1)

HSP 1 Score: 108.997 bits (271), Expect = 2.635e-22
Identity = 108/356 (30.34%), Postives = 190/356 (53.37%), Query Frame = 1
Query: 1183 EENDMLKXXXXXXXXXXXXXHDHFQEDDTDTLRELKRDLETSNKNCRIFQFKLRKTERRYEQCENERGILEEKLNRLEAQLYSENDVNLIRGLEEELRVAKEVSVRLNSELELVDEKRSYFEEDNKHLKEELKDSETRRRSLEAELSKCRQEIEKLKSLDSSGALQIPDTASKRKNRNLESLSREPSFEEQSLQRELDAAKERETDLTEQLKFAEDDIRKLKRRFNDIEEENDSLSKKLETIMK-----STNIEDNEFDDNASVR--ALKIQVELLEQQNSTLRKKFVSIEKENINLSNELRQAKAKSNSGTEKS-----DDTLKD--EKYKLLEQKINDLHSDVERLEKENRRLT 2208
            EEN+ LK E +E++ E++EM D F E+D   L+E++ +LE +NKNCRI Q++LRK ER+                RL      E D  L+R LE++L+VAK+VSVRL+ ELE V+EKR+  E++N+ L+++L + E  +++L+ EL       EK+K L          +  +R +++L      P  E+++ Q      +E   DL  QL+F +++   ++++   I++E D    +L+          + +   E     S R   LK+++ L+E++ + L +K V +E EN  L  EL   +    +G+         ++L +  +  +L+E +   L  +V  LE++N+R+T
Sbjct:  361 EENETLKNEIDELRTEMDEMRDTFFEEDACQLQEMRHELERANKNCRILQYRLRKAERK----------------RLRYAQTGEIDGELLRSLEQDLKVAKDVSVRLHHELENVEEKRTTTEDENEKLRQQLIEVEIAKQALQNEL-------EKMKEL----------SLKRRGSKDL------PKSEKKAQQ---TPTEEDNEDLKCQLQFVKEEAALMRKKMAKIDKEKDRFEHELQKYRSFYGDLDSPLPKGEAGGPPSTREAELKLRLRLVEEEANILGRKIVELEVENRGLKAELDDLRGDDFNGSANPLMREQSESLSELRQHLQLVEDETELLRRNVADLEEQNKRIT 674          
BLAST of Prefoldin vs. UniProt/SwissProt
Match: sp|E1U8D0|SOGA1_MOUSE (Protein SOGA1 OS=Mus musculus OX=10090 GN=Soga1 PE=1 SV=3)

HSP 1 Score: 105.145 bits (261), Expect = 6.093e-21
Identity = 83/290 (28.62%), Postives = 145/290 (50.00%), Query Frame = 1
Query: 1246 DHFQEDDTDTLRELKRDLETSNKNCRIFQFKLRKTERRYEQCENERGILEEKLNRLEAQLYSENDVNLIRGLEEELRVAKEVSVRLNSELELVDEKRSYFEEDNKHLKEELKDSETRRRSLEAELSKCRQEIEKLKSLDSSGALQIPDTASKRKNRNLESLSREPSFEEQSLQRELDAAKERETDLTEQLKFAEDDIRKLKRRFNDIEEENDSLSKKLETIMK-----STNIEDNEFDDNASVR--ALKIQVELLEQQNSTLRKKFVSIEKENINLSNELRQAKAKSNSG 2094
            D + E+D   L+EL++ L+ ++K CRI Q++LRK ERR                 L A    + D  LIRGLE++++V+K++S+RL+ ELE+V++KR   EE+N+ L++ L ++E  ++ L+ EL + R+   K                 KR  R+L    ++P+ +E S             DL  QL FA+++   + ++   + +ENDS+ ++L             +   E  D    R   LK+ ++L+E++ + L ++ V +E EN  L  E+   K     G
Sbjct:    6 DVYMEEDVYQLQELRQQLDQASKTCRILQYRLRKAERR----------------SLRAAQTGQVDGELIRGLEQDVKVSKDISMRLHKELEVVEKKRMRLEEENEGLRQRLIETELAKQVLQTELDRPREHSLK-----------------KRGTRSLGKTDKKPTAQEDS------------ADLKCQLHFAKEESALMCKKLTKLAKENDSMKEELLKYRSLYGDLDAALSAEELADAPHSRETELKVHLKLVEEEANLLSRRIVELEVENRGLRAEMDDMKDHGGGG 250          
BLAST of Prefoldin vs. UniProt/SwissProt
Match: sp|Q9Y4B5|MTCL1_HUMAN (Microtubule cross-linking factor 1 OS=Homo sapiens OX=9606 GN=MTCL1 PE=1 SV=5)

HSP 1 Score: 102.449 bits (254), Expect = 4.829e-20
Identity = 103/364 (28.30%), Postives = 188/364 (51.65%), Query Frame = 1
Query: 1186 ENDMLKXXXXXXXXXXXXXHDHFQEDDTDTLRELKRDLETSNKNCRIFQFKLRKTERRYEQCENERGILEEKLNRLEAQLYSENDVNLIRGLEEELRVAKEVSVRLNSELELVDEKRSYFEEDNKHLKEELKDSETRRRSLEAELSKCRQEIEKLKSLDSSGALQIPDTASKRKNRNLESLSREPSFEEQSLQRELDAAKERETDLTEQLKFAEDDIRKLKRRFNDIEEENDSLSKKLETIMK-----STNIEDNEFDDNASVR--ALKIQVELLEQQNSTLRKKFVSIEKENINLSNEL--------RQAKAKSNS---GTEKSDDTLKDE-----KYKLLEQKINDLHSDVERLEKENRRLT 2208
            END LK+E +E++ E+EEM D + E+D   L+EL+R+L+ +NKNCRI Q++LRK E++                 L+     + D  LIR LE++L+VAK+VSVRL+ EL+ V+EKR+  E++N+ L++++ + E  +++L+ EL       E+LK            +  +R  R +        ++E+    + D+A     DL  QL+FA+++   ++++   +  E D L ++L+          + +   E     S R   LK++++L+E++ + L +K V +E EN  L  E+        R+   + ++    T    D+L+         + +E++   L   +  +E  NR+LT
Sbjct:  346 ENDYLKDELDELRAEMEEMRDSYLEEDVYQLQELRRELDRANKNCRILQYRLRKAEQKS----------------LKVAETGQVDGELIRSLEQDLKVAKDVSVRLHHELKTVEEKRAKAEDENETLRQQMIEVEISKQALQNEL-------ERLKE----------SSLKRRSTREM--------YKEKKTFNQDDSA-----DLRCQLQFAKEEAFLMRKKMAKLGREKDELEQELQKYKSLYGDVDSPLPTGEAGGPPSTREAELKLRLKLVEEEANILGRKIVELEVENRGLKAEMEDMRGQQEREGPGRDHAPSIPTSPFGDSLESSTELRRHLQFVEEEAELLRRSISEIEDHNRQLT 663          
BLAST of Prefoldin vs. TrEMBL
Match: A0A4E0S252 (Prefoldin OS=Fasciola hepatica OX=6192 GN=D915_001960 PE=4 SV=1)

HSP 1 Score: 419.083 bits (1076), Expect = 5.887e-117
Identity = 310/776 (39.95%), Postives = 453/776 (58.38%), Query Frame = 1
Query:  388 ALTKKKECYTFEPQQWRRTVCKNCFRSLPDHPTEPSAGSGN-NGKGISPRTSPLLGTKSVNAATPQLTAISGISKDPVLRKGETSPNNRRRPKSDEFKQKTPSPRESKRTMGSNTGRRSP--------ANSPSSSVTRHSGS--FSANRQNSTSSIDTKYVXXXXXXXXXXXXKYDEISXXXXXXXXXXXXXTHLNEDFLEDIEAYKNKTIHLERRIQHLDEEVRNYRERLKLPESDQANIDV-------SESMNSKHQEILAENEQLRVRMEEIEQLCQDVMEENDMLKXXXXXXXXXXXXXHDHFQEDDTDTLRELKRDLETSNKNCRIFQFKLRKTERRYEQCENERGILEEKLNRLEAQLYSENDVNLIRGLEEELRVAKEVSVRLNSELELVDEKRSYFEEDNKHLKEELKDSETRRRSLEAELSKCRQEIEKLKS----LDSSGALQIPDTASKRKNRNLESLSREPSFEEQSLQRELDAAKERETDLTEQLKFAEDDIRKLKRRFNDIEEENDSLSKKLETIMKSTN---IEDNEFDDNASVRALKI---------------------------QVELLEQQNSTLRKKFVSIEKENINLSNELRQAKAKSNSGTEKSDDTLKDEKYKL--LEQKINDLHSDVERLEKENRRLTLLNSLQQAAPGIKPKVSQPPYPVETTTDFIQNVQIQDLKSECNRLKEQIKQYDKQIKAIMSQIEQQYGSHLTDKKQLEYLSKYNETINTCRTQEKQIMQLNKQIEGLKEDICKYK 2553
             +  KKEC+ FEPQQWRRTVCKNCFR+ P+H    +   GN +G  +  R +  +     + +  Q    S          GE  P            Q+  S R+S +T GS    R+           S +    R +G    +    +S SSID +Y+EELENDFF LEDK++ + +E+ EL  EL  K     +    +E YK K   LERR  HL+EE++ YRERL+LPESDQ++  V       S +      EI   +E L+ R+ E+EQLCQ+VMEEN+ LKEE EEMQREIEEMHDHFQEDD D +REL+RDLE +NK CRI QFKLRK ERR+EQCE ER  LEE+L RLEA+LYSE DV  IR LEEE+RVAKEV VRLN+EL+++DEKR+YFE++N+ LKEEL+ S+ RR  +E EL + + E++K+KS    LD  G LQ+ D    R++ +  SLSRE SFEEQ LQRELDA++ERETDL+EQL+FAE++IRKLKRR  D + EN+ L+KK++ I+ + +    + +     ++  A ++                           Q+++ E++N TLR+K ++ E+E      EL++ + ++  G       L+  + ++  ++  +N L  + +RLE ENRRL       Q     KP  S+     E TT       I  L  +   L ++IK+++K+++ +  ++    GS    +++ E++ KYN+   + + QE Q++++ K++  L+++  + +
Sbjct:   54 GMKAKKECFVFEPQQWRRTVCKNCFRTEPEHKQSANTKEGNASGPSVVLRRAENVVQVPASGSVAQTQGESAA--------GEAKP------------QEVKSDRDSVKTGGSTNATRAALRKTAAIQGQSNAHGDGRRAGGQNSAGGIHSSASSIDARYIEELENDFFALEDKHEAVLRERNELTAELEAKVRSVTELQTALEQYKEKVSLLERRCLHLEEEIKGYRERLRLPESDQSHQPVGGETRGESPTAAGSMAEIACSSE-LQQRLNEVEQLCQEVMEENEQLKEEVEEMQREIEEMHDHFQEDDRDAMRELQRDLEAANKTCRILQFKLRKAERRFEQCEAERANLEERLARLEAELYSEADVAHIRNLEEEVRVAKEVGVRLNNELDILDEKRAYFEQENRQLKEELQVSQNRRIQVENELGRVKLEMDKVKSEKGILD-KGPLQVTDKNRSRQSNSRPSLSREASFEEQQLQRELDASRERETDLSEQLRFAEEEIRKLKRRVKDSQVENEMLTKKMDRILATQSQDLYQPSSVGRQSNTSAAQVSPKTGPREGDGRLPPGQLENELIMTRRQLDMAEEENLTLRRKVLNFERELNAAHAELQRLQNRAGRGMPLDSPELETLRTQMNQVQTHLNRLEGERDRLEGENRRLRA-----QTPMAGKPAASE---DTEETT-------IDRLTKQNEALTQRIKEWNKRLRQLTREV-NLVGSI---EREHEWMEKYNDARESLKEQETQLLRVKKRVSELQDENARLR 788          

HSP 2 Score: 207.994 bits (528), Expect = 6.418e-50
Identity = 179/561 (31.91%), Postives = 320/561 (57.04%), Query Frame = 1
Query: 3004 SVRATNQGKTCQFS---AGSDDVFNEHYGYQIDAPGNLNDAEKIKFRFTCLERLLSEERKRTRIAEKQAEMALKDSVHSRVNEDSQLKKKEIEMLKTDXXXXXXXXXXXXQHIQDLKNRLDQTRKMNEALRTLLDKQDEGVSSSSLKTKDGSNKEQSIEISSYKKEVSALKNDIHQYAIKISESEKIREKLAKEIRNLQAEMKVREEQIYEQDDEMRAKDQELRTVKRLLDETQNTLKS---------QAQSNNITKDIEEKIQKNGELINKVEELNKTLQKYKTQIEEREIEKKQWETQQKILTDSITTRDERIQEKDDLINHLNQRLQNREKELTDFDIL---ISQTNEKLEKNQEIIKNTQMLLSKKDVDFESLKAKTDDLQTSYDNITGNLHSVRKENEKLKTKIAEFEKEKSKPPPVPRISTSSAVDVDKLKMEISQLKKDKENLTTMLNKDKVSFSAARRDSETAKTES-------DSYMKAIQHQQYVTRVNLLTDNVTRLNRINIELKLQNEAIQNNMLEYQRKYKNIKEQYENEQESWTTERITLTSRMKEY 4620
            S+ A+ + +T  FS   AGSD+VF++           L+   +++ R + LERLL EER++T IAE Q + +     +   N D QLK +++++LK +LEEK+E++E +++ I DLK+R+DQ RKMN+ALR+L++K D G    +++     N E S+E++SY+KE+ + + ++      + ++EKIRE+L KE R LQ E+K+RE+ I++QDDE+  ++ ELRTVK  L+  Q  L+          Q +S+  +  +  +I +N ++   + E  + L + K + +E     +  + +   L+  +      +QEKD +I  LN+ L+   +++++       + +   KLEK  E +K     LS KD + +SL  + D            +   R E+ + ++ +   +   ++      +S  SA +VD+L+ E+S +++++++L T + + +    A    S+  + E        ++Y KAI  QQ  T+++LL +++  LNR N+ELKL NE++QN +++ QR+Y+++KEQYE EQE+W TER+ L S+ KE 
Sbjct:  913 SMEASAESRTSTFSTASAGSDEVFDDSTET---GKAALDIEHQLRNRVSFLERLLEEERRKTEIAENQLQQS-----NVIPNADGQLKSRQMDLLKKELEEKDELIEARDEQIADLKSRVDQARKMNDALRSLMEK-DSGTEKGTVQ-----NVESSVEMASYRKEIESARKEMQILRTNLGQAEKIRERLVKENRELQEELKLREDSIFDQDDEIEKRNAELRTVKANLEAVQKELEQTRRDLSAVKQRESSGSSGRLSAQIAQNEKIRADLHETTRQLNEMKLKYDEAMRAGQTADEKFTQLSADMNQLRGTLQEKDSIIIDLNKNLKKNNEDMSEMRHARQNLEKERSKLEKLLEEVKKD---LSAKDQEIKSLHVRLDSFPV-------KMFPDRPESSQ-ESGLGTPDNSSTRDGGT--LSRRSA-EVDRLRRELSMMRRERDDLATEVKQLRSKLRAKEEGSKKDQPEGLIGLPTGNAYAKAIAAQQTTTKISLLNEHIASLNRTNVELKLHNESLQNTVIDLQRRYRSLKEQYEGEQETWLTERVVLESKAKEV 1445          
BLAST of Prefoldin vs. TrEMBL
Match: A0A4S2L072 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_010296 PE=4 SV=1)

HSP 1 Score: 414.846 bits (1065), Expect = 2.547e-113
Identity = 313/805 (38.88%), Postives = 449/805 (55.78%), Query Frame = 1
Query:  382 SGALTKKKECYTFEPQQWRRTVCKNCFRSLPDHPTEPSAGSGNNGKGISPRTSPLLGTKSVNAATPQLTAISGISKDPVLRKGE----TSPNNRRRPKSDEFKQKTPSPR---------ESKRTMGSNTG--RRSPANSPSSSVTRHSGSFSANRQNSTSSIDTKYVXXXXXXXXXXXXKYDEISXXXXXXXXXXXXXTHLNEDFLEDIEAYKNKTIHLERRIQHLDEEVRNYRERLKLPESDQ-----------ANIDVSESMNSKHQEILAENEQLRVRMEEIEQLCQDVMEENDMLKXXXXXXXXXXXXXHDHFQEDDTDTLRELKRDLETSNKNCRIFQFKLRKTERRYEQCENERGILEEKLNRLEAQLYSENDVNLIRGLEEELRVAKEVSVRLNSELELVDEKRSYFEEDNKHLKEELKDSETRRRSLEAELSKCRQEIEKLKS----LDSSGALQIPDTASKRKNRNLESLSREPSFEEQSLQRELDAAKERETDLTEQLKFAEDDIRKLKRRFNDIEEENDSLSKKLE---------------------------TIMKSTNIEDNEFDDNASVRALKI--------------QVELLEQQNSTLRKKFVSIEKENINLSNELRQAKAKSNSGTEKSD----DTLKDEKYKLLEQKINDLHSDVERLEKENRRLTLLNSLQQAAPGIKPKVSQPPYPVETTTDFIQNVQIQDLKSECNRLKEQIKQYDKQIK------AIMSQIEQQYGSHLTDKKQLEYLSKYNETINTCRTQEKQIMQLNKQIEGLKEDICKYK 2553
            SG    KKEC+ FEPQQWRRTVCKNCFR+ P+H        G  G  +  R +  + ++S N +  Q  A S +  D   +  E    TS +N R            + R         +  R   S  G  RR+  NS  +S +  +G +S     S SSID +Y+EELENDFF LEDK+D + +E+  L  EL  K  +  D    +E Y+ K   LERR  H++EE+++YRERL+LPESDQ              D + S        LA + +L+ R+ E+EQLCQ+VMEEN+ LKEE EEMQREIEEMHDHFQEDD D +REL+RDLE +NK CRI QFKLRK ERR+EQCE+ER  LEE+L RLEA+LYSE DV  IR LEEE+RVAKEV VRLN+EL+++DEKR+++E++N  LKEEL+    RR ++E EL + + E EKLK+    LD  G LQ+ D +  R+  +  SLSRE SFEEQ LQRELDA++ERETDL+EQL+FAE+++RK+KRR  + + EN+ LSKKLE                           T  +S+   DN   D       K+              Q+ L+E++N  LR+K +S E++       L++      +G+ + D    D+L+++   L++  +  +  + +RLE ENRRL       +     +P V               +  ++ L  E   +K ++K+ D++++      A++  IE+ +          E++ KYN+   T + QE Q+ +  K++  L+++  + +
Sbjct:   33 SGGQKSKKECFVFEPQQWRRTVCKNCFRTQPEHRLSTGKDDGPGGPNVVLRRTDGIPSQSSNPSATQ-HAQSDVGTDSTSKHSEHKTATSRDNGRNGTGSSGNAARSTARKLASGQRVGDEHRPQTSTIGESRRTGTNSSGTSASTATGIYS-----SASSIDARYIEELENDFFALEDKHDALLRERELLASELETKVRMVADLQSTLEQYREKVTLLERRCIHMEEEIKSYRERLRLPESDQSPPSHDRLPTDGQGDGTSSGGGMGD--LACSGELQQRLNEVEQLCQEVMEENEQLKEEVEEMQREIEEMHDHFQEDDRDAMRELQRDLEAANKTCRILQFKLRKAERRFEQCESERANLEERLARLEAELYSEADVAHIRNLEEEIRVAKEVGVRLNNELDILDEKRAFYEQENHQLKEELQACHNRRIAVENELGRLKLEAEKLKAEQGILD-KGPLQVTDRSRSRQTNSRPSLSREASFEEQQLQRELDASRERETDLSEQLRFAEEEVRKMKRRVKESQVENELLSKKLERLYTTQPKDPFQFGQTVRSASAGAQPRTPSESSQTPDNTAGDGPVGNGTKLSPGQMETELTATRRQLNLVEEENLGLRRKILSYERDLTAAQGRLQRTVPSRITGSPQLDSQELDSLRNQ-LNLIQDHLARMEHERDRLESENRRLRCTEGDSR-----RPTVE-------------SSAGMEALIRENEAIKSKLKEGDRRLRHLAREVALIGSIERDH----------EWIEKYNDARETIKEQEIQLSRSKKRVAELQDENARLR 799          

HSP 2 Score: 77.411 bits (189), Expect = 5.799e-10
Identity = 48/85 (56.47%), Postives = 58/85 (68.24%), Query Frame = 1
Query: 5572 RNNRSVSPDHSRSTSITRKITNYPDPTPGFMLKPXXXXXXXXXXXKDPTDYTSRSFTLPGLRNNHNASRISPARQKFFELTDSKP 5826
            R  RSVSP+ S      RK++NYPDPTPGF+++P+SRQ S +S+S    DYT RSFTLPG       S ISPAR+KFFE T S P
Sbjct: 1843 RCGRSVSPEVS-----VRKVSNYPDPTPGFLVRPTSRQGSHDSLS-SVGDYTQRSFTLPG--KPPVRSIISPARKKFFEDTSSVP 1919          
BLAST of Prefoldin vs. TrEMBL
Match: A0A4S2KZT4 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_010296 PE=4 SV=1)

HSP 1 Score: 413.69 bits (1062), Expect = 4.656e-113
Identity = 313/805 (38.88%), Postives = 449/805 (55.78%), Query Frame = 1
Query:  382 SGALTKKKECYTFEPQQWRRTVCKNCFRSLPDHPTEPSAGSGNNGKGISPRTSPLLGTKSVNAATPQLTAISGISKDPVLRKGE----TSPNNRRRPKSDEFKQKTPSPR---------ESKRTMGSNTG--RRSPANSPSSSVTRHSGSFSANRQNSTSSIDTKYVXXXXXXXXXXXXKYDEISXXXXXXXXXXXXXTHLNEDFLEDIEAYKNKTIHLERRIQHLDEEVRNYRERLKLPESDQ-----------ANIDVSESMNSKHQEILAENEQLRVRMEEIEQLCQDVMEENDMLKXXXXXXXXXXXXXHDHFQEDDTDTLRELKRDLETSNKNCRIFQFKLRKTERRYEQCENERGILEEKLNRLEAQLYSENDVNLIRGLEEELRVAKEVSVRLNSELELVDEKRSYFEEDNKHLKEELKDSETRRRSLEAELSKCRQEIEKLKS----LDSSGALQIPDTASKRKNRNLESLSREPSFEEQSLQRELDAAKERETDLTEQLKFAEDDIRKLKRRFNDIEEENDSLSKKLE---------------------------TIMKSTNIEDNEFDDNASVRALKI--------------QVELLEQQNSTLRKKFVSIEKENINLSNELRQAKAKSNSGTEKSD----DTLKDEKYKLLEQKINDLHSDVERLEKENRRLTLLNSLQQAAPGIKPKVSQPPYPVETTTDFIQNVQIQDLKSECNRLKEQIKQYDKQIK------AIMSQIEQQYGSHLTDKKQLEYLSKYNETINTCRTQEKQIMQLNKQIEGLKEDICKYK 2553
            SG    KKEC+ FEPQQWRRTVCKNCFR+ P+H        G  G  +  R +  + ++S N +  Q  A S +  D   +  E    TS +N R            + R         +  R   S  G  RR+  NS  +S +  +G +S     S SSID +Y+EELENDFF LEDK+D + +E+  L  EL  K  +  D    +E Y+ K   LERR  H++EE+++YRERL+LPESDQ              D + S        LA + +L+ R+ E+EQLCQ+VMEEN+ LKEE EEMQREIEEMHDHFQEDD D +REL+RDLE +NK CRI QFKLRK ERR+EQCE+ER  LEE+L RLEA+LYSE DV  IR LEEE+RVAKEV VRLN+EL+++DEKR+++E++N  LKEEL+    RR ++E EL + + E EKLK+    LD  G LQ+ D +  R+  +  SLSRE SFEEQ LQRELDA++ERETDL+EQL+FAE+++RK+KRR  + + EN+ LSKKLE                           T  +S+   DN   D       K+              Q+ L+E++N  LR+K +S E++       L++      +G+ + D    D+L+++   L++  +  +  + +RLE ENRRL       +     +P V               +  ++ L  E   +K ++K+ D++++      A++  IE+ +          E++ KYN+   T + QE Q+ +  K++  L+++  + +
Sbjct:   33 SGGQKSKKECFVFEPQQWRRTVCKNCFRTQPEHRLSTGKDDGPGGPNVVLRRTDGIPSQSSNPSATQ-HAQSDVGTDSTSKHSEHKTATSRDNGRNGTGSSGNAARSTARKLASGQRVGDEHRPQTSTIGESRRTGTNSSGTSASTATGIYS-----SASSIDARYIEELENDFFALEDKHDALLRERELLASELETKVRMVADLQSTLEQYREKVTLLERRCIHMEEEIKSYRERLRLPESDQSPPSHDRLPTDGQGDGTSSGGGMGD--LACSGELQQRLNEVEQLCQEVMEENEQLKEEVEEMQREIEEMHDHFQEDDRDAMRELQRDLEAANKTCRILQFKLRKAERRFEQCESERANLEERLARLEAELYSEADVAHIRNLEEEIRVAKEVGVRLNNELDILDEKRAFYEQENHQLKEELQACHNRRIAVENELGRLKLEAEKLKAEQGILD-KGPLQVTDRSRSRQTNSRPSLSREASFEEQQLQRELDASRERETDLSEQLRFAEEEVRKMKRRVKESQVENELLSKKLERLYTTQPKDPFQFGQTVRSASAGAQPRTPSESSQTPDNTAGDGPVGNGTKLSPGQMETELTATRRQLNLVEEENLGLRRKILSYERDLTAAQGRLQRTVPSRITGSPQLDSQELDSLRNQ-LNLIQDHLARMEHERDRLESENRRLRCTEGDSR-----RPTVE-------------SSAGMEALIRENEAIKSKLKEGDRRLRHLAREVALIGSIERDH----------EWIEKYNDARETIKEQEIQLSRSKKRVAELQDENARLR 799          

HSP 2 Score: 77.0258 bits (188), Expect = 5.943e-10
Identity = 48/85 (56.47%), Postives = 58/85 (68.24%), Query Frame = 1
Query: 5572 RNNRSVSPDHSRSTSITRKITNYPDPTPGFMLKPXXXXXXXXXXXKDPTDYTSRSFTLPGLRNNHNASRISPARQKFFELTDSKP 5826
            R  RSVSP+ S      RK++NYPDPTPGF+++P+SRQ S +S+S    DYT RSFTLPG       S ISPAR+KFFE T S P
Sbjct: 1835 RCGRSVSPEVS-----VRKVSNYPDPTPGFLVRPTSRQGSHDSLS-SVGDYTQRSFTLPG--KPPVRSIISPARKKFFEDTSSVP 1911          
BLAST of Prefoldin vs. TrEMBL
Match: A0A4S2L5I2 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_010296 PE=4 SV=1)

HSP 1 Score: 413.69 bits (1062), Expect = 5.141e-113
Identity = 313/805 (38.88%), Postives = 449/805 (55.78%), Query Frame = 1
Query:  382 SGALTKKKECYTFEPQQWRRTVCKNCFRSLPDHPTEPSAGSGNNGKGISPRTSPLLGTKSVNAATPQLTAISGISKDPVLRKGE----TSPNNRRRPKSDEFKQKTPSPR---------ESKRTMGSNTG--RRSPANSPSSSVTRHSGSFSANRQNSTSSIDTKYVXXXXXXXXXXXXKYDEISXXXXXXXXXXXXXTHLNEDFLEDIEAYKNKTIHLERRIQHLDEEVRNYRERLKLPESDQ-----------ANIDVSESMNSKHQEILAENEQLRVRMEEIEQLCQDVMEENDMLKXXXXXXXXXXXXXHDHFQEDDTDTLRELKRDLETSNKNCRIFQFKLRKTERRYEQCENERGILEEKLNRLEAQLYSENDVNLIRGLEEELRVAKEVSVRLNSELELVDEKRSYFEEDNKHLKEELKDSETRRRSLEAELSKCRQEIEKLKS----LDSSGALQIPDTASKRKNRNLESLSREPSFEEQSLQRELDAAKERETDLTEQLKFAEDDIRKLKRRFNDIEEENDSLSKKLE---------------------------TIMKSTNIEDNEFDDNASVRALKI--------------QVELLEQQNSTLRKKFVSIEKENINLSNELRQAKAKSNSGTEKSD----DTLKDEKYKLLEQKINDLHSDVERLEKENRRLTLLNSLQQAAPGIKPKVSQPPYPVETTTDFIQNVQIQDLKSECNRLKEQIKQYDKQIK------AIMSQIEQQYGSHLTDKKQLEYLSKYNETINTCRTQEKQIMQLNKQIEGLKEDICKYK 2553
            SG    KKEC+ FEPQQWRRTVCKNCFR+ P+H        G  G  +  R +  + ++S N +  Q  A S +  D   +  E    TS +N R            + R         +  R   S  G  RR+  NS  +S +  +G +S     S SSID +Y+EELENDFF LEDK+D + +E+  L  EL  K  +  D    +E Y+ K   LERR  H++EE+++YRERL+LPESDQ              D + S        LA + +L+ R+ E+EQLCQ+VMEEN+ LKEE EEMQREIEEMHDHFQEDD D +REL+RDLE +NK CRI QFKLRK ERR+EQCE+ER  LEE+L RLEA+LYSE DV  IR LEEE+RVAKEV VRLN+EL+++DEKR+++E++N  LKEEL+    RR ++E EL + + E EKLK+    LD  G LQ+ D +  R+  +  SLSRE SFEEQ LQRELDA++ERETDL+EQL+FAE+++RK+KRR  + + EN+ LSKKLE                           T  +S+   DN   D       K+              Q+ L+E++N  LR+K +S E++       L++      +G+ + D    D+L+++   L++  +  +  + +RLE ENRRL       +     +P V               +  ++ L  E   +K ++K+ D++++      A++  IE+ +          E++ KYN+   T + QE Q+ +  K++  L+++  + +
Sbjct:   33 SGGQKSKKECFVFEPQQWRRTVCKNCFRTQPEHRLSTGKDDGPGGPNVVLRRTDGIPSQSSNPSATQ-HAQSDVGTDSTSKHSEHKTATSRDNGRNGTGSSGNAARSTARKLASGQRVGDEHRPQTSTIGESRRTGTNSSGTSASTATGIYS-----SASSIDARYIEELENDFFALEDKHDALLRERELLASELETKVRMVADLQSTLEQYREKVTLLERRCIHMEEEIKSYRERLRLPESDQSPPSHDRLPTDGQGDGTSSGGGMGD--LACSGELQQRLNEVEQLCQEVMEENEQLKEEVEEMQREIEEMHDHFQEDDRDAMRELQRDLEAANKTCRILQFKLRKAERRFEQCESERANLEERLARLEAELYSEADVAHIRNLEEEIRVAKEVGVRLNNELDILDEKRAFYEQENHQLKEELQACHNRRIAVENELGRLKLEAEKLKAEQGILD-KGPLQVTDRSRSRQTNSRPSLSREASFEEQQLQRELDASRERETDLSEQLRFAEEEVRKMKRRVKESQVENELLSKKLERLYTTQPKDPFQFGQTVRSASAGAQPRTPSESSQTPDNTAGDGPVGNGTKLSPGQMETELTATRRQLNLVEEENLGLRRKILSYERDLTAAQGRLQRTVPSRITGSPQLDSQELDSLRNQ-LNLIQDHLARMEHERDRLESENRRLRCTEGDSR-----RPTVE-------------SSAGMEALIRENEAIKSKLKEGDRRLRHLAREVALIGSIERDH----------EWIEKYNDARETIKEQEIQLSRSKKRVAELQDENARLR 799          

HSP 2 Score: 77.0258 bits (188), Expect = 5.993e-10
Identity = 48/85 (56.47%), Postives = 58/85 (68.24%), Query Frame = 1
Query: 5572 RNNRSVSPDHSRSTSITRKITNYPDPTPGFMLKPXXXXXXXXXXXKDPTDYTSRSFTLPGLRNNHNASRISPARQKFFELTDSKP 5826
            R  RSVSP+ S      RK++NYPDPTPGF+++P+SRQ S +S+S    DYT RSFTLPG       S ISPAR+KFFE T S P
Sbjct: 1836 RCGRSVSPEVS-----VRKVSNYPDPTPGFLVRPTSRQGSHDSLS-SVGDYTQRSFTLPG--KPPVRSIISPARKKFFEDTSSVP 1912          
BLAST of Prefoldin vs. TrEMBL
Match: H2KRN1 (Uncharacterized protein OS=Clonorchis sinensis OX=79923 GN=CLF_106748 PE=4 SV=1)

HSP 1 Score: 408.683 bits (1049), Expect = 1.804e-111
Identity = 313/814 (38.45%), Postives = 451/814 (55.41%), Query Frame = 1
Query:  382 SGALTKKKECYTFEPQQWRRTVCKNCFRSLPDHPTEPSAGSGNNGKGISPRTSPLLGTKSVNAATPQLTAISGISKDPVLRK--------------GETSPNNRRRPKS----------DEFKQKTPSPRESKRTMGSNTGRRSPANSPSSSVTRHSGSFSANRQNSTSSIDTKYVXXXXXXXXXXXXKYDEISXXXXXXXXXXXXXTHLNEDFLEDIEAYKNKTIHLERRIQHLDEEVRNYRERLKLPESDQ-----------ANIDVSESMNSKHQEILAENEQLRVRMEEIEQLCQDVMEENDMLKXXXXXXXXXXXXXHDHFQEDDTDTLRELKRDLETSNKNCRIFQFKLRKTERRYEQCENERGILEEKLNRLEAQLYSENDVNLIRGLEEELRVAKEVSVRLNSELELVDEKRSYFEEDNKHLKEELKDSETRRRSLEAELSKCRQEIEKLKS----LDSSGALQIPDTASKRKNRNLESLSREPSFEEQSLQRELDAAKERETDLTEQLKFAEDDIRKLKRRFNDIEEENDSLSKKLE---------------------------TIMKSTNIEDNEFDDNASVRALKI--------------QVELLEQQNSTLRKKFVSIEKENINLSNELRQAKAKSNSGTEKSD----DTLKDEKYKLLEQKINDLHSDVERLEKENRRLTLLNSLQQAAPGIKPKVSQPPYPVETTTDFIQNVQIQDLKSECNRLKEQIKQYDKQIK------AIMSQIEQQYGSHLTDKKQLEYLSKYNETINTCRTQEKQIMQLNKQIEGLKEDICKYK 2553
            SG    KKEC+ FEPQQWRRTVCKNCFR+ P+H        G  G  +  R +  + ++S N    Q  A S +  D   R               G  S  N  R  +          DE + +T +  ES+RT G+N        S  +S +  +G +S     S SSID +Y+EELENDFF LEDK+D + +E+  L  EL  K  +  D    +E Y+ K   LERR  H++EE+++YRERL+LPESDQ              D ++S        LA + +L+ R+ E+EQLCQ+VMEEN+ LKEE EEMQREIEEMHDHFQEDD D +REL+RDLE +NK CRI QFKLRK ERR+EQCE+ER  LEE+L RLEA+LYSE DV  IR LEEE+RVAKEV VRLN+EL+++DEKR+++E++N  LKEEL+    RR ++E EL + + E EKLK+    LD  G LQ+ D +  R+  +  SLSRE SFEEQ LQRELDA++ERETDL+EQL+FAE+++RK+KRR  + + EN+ LSKKLE                           T  +S+   DN   D       K+              Q+ L+E++N  LR+K ++ E++       L++      +G+ + D    D+L+++   L++  +  +  + +RLE EN+RL       +     +P                 +  ++ L  E   +K ++K+ D++++      A++  IE+ +          E++ KYN+   T + QE Q+ +  K++  L+++  K +
Sbjct:   35 SGGQKSKKECFVFEPQQWRRTVCKNCFRTQPEHRLSTGKDDGPGGPNVVLRRTDSIPSQSSNPNAAQ-HAQSDVCADSTSRHSEHKTATSRDNGRNGTASSGNAARATARKLASGQRVGDEHRPQTSTIGESRRT-GTNI-------SSGASASTATGIYS-----SASSIDARYIEELENDFFALEDKHDALLRERELLASELETKVRMVADLQSTLEQYREKVTLLERRCIHMEEEIKSYRERLRLPESDQSPPSHDRLPTDGQGDGTQSGAGMGD--LACSGELQQRLNEVEQLCQEVMEENEQLKEEVEEMQREIEEMHDHFQEDDRDAMRELQRDLEAANKTCRILQFKLRKAERRFEQCESERANLEERLARLEAELYSEADVAHIRNLEEEIRVAKEVGVRLNNELDILDEKRAFYEQENHQLKEELQACHNRRIAVENELGRLKLEAEKLKAEQGILD-KGPLQVTDRSRSRQTNSRPSLSREASFEEQQLQRELDASRERETDLSEQLRFAEEEVRKMKRRVKESQVENELLSKKLERLYTTQPKDPFQFGQTVRSASAGAQPRTPSESSQTPDNTAADGPVGNGAKLSPGQMETELTATRRQLNLVEEENLGLRRKILAYERDLTAAQGRLQRTVPSRITGSPQLDSQELDSLRNQ-LNLIQDHLARMEHERDRLESENQRLRCTEGDSR-----RPTAE-------------SSAGMEALIRENEAIKSKLKEGDRRLRHLAREVALIGSIERDH----------EWIEKYNDARETIKEQEIQLSRSKKRVAELQDENAKLR 802          

HSP 2 Score: 77.411 bits (189), Expect = 5.751e-10
Identity = 48/85 (56.47%), Postives = 58/85 (68.24%), Query Frame = 1
Query: 5572 RNNRSVSPDHSRSTSITRKITNYPDPTPGFMLKPXXXXXXXXXXXKDPTDYTSRSFTLPGLRNNHNASRISPARQKFFELTDSKP 5826
            R  RSVSP+ S      RK++NYPDPTPGF+++P+SRQ S +S+S    DYT RSFTLPG       S ISPAR+KFFE T S P
Sbjct: 1839 RCGRSVSPEVS-----VRKVSNYPDPTPGFLVRPTSRQGSHDSLS-SVGDYTQRSFTLPG--KPPVRSIISPARKKFFEDTSSVP 1915          
BLAST of Prefoldin vs. Ensembl Cavefish
Match: soga3a (SOGA family member 3a [Source:ZFIN;Acc:ZDB-GENE-100921-84])

HSP 1 Score: 113.62 bits (283), Expect = 9.324e-25
Identity = 126/426 (29.58%), Postives = 218/426 (51.17%), Query Frame = 1
Query: 1150 EEIEQLCQDVMEENDMLKXXXXXXXXXXXXXHDHFQEDDTDTLRELKRDLETSNKNCRIFQFKLRKTERRYEQCENERGILEEKLNRLEAQLYSENDVNLIRGLEEELRVAKEVSVRLNSELELVDEKRSYFEEDNKHLKEELKDSETRRRSLEAELSKCRQEIEKLKSLDSSGA-------LQIPDTASKRKNRNLES------------------LSREPSFEEQSLQR------ELDA----------AKERETDLTEQLKFAEDDIRKLKRRFNDIEEENDSLSKKLETIMK---STNIED-NEFDDNASVRALKIQVELLEQQNSTLRKKFVSIEKENINLSNELRQAKAKSNS--GTEKSDDTLKD--------EKYKLLEQKINDLHSDVERLEKENRRLTLLNSLQQ----AAPGIKP 2250
            +E+E     + +END LK E EEM+ E++EM D F E+D   L+ L+R+LE +NKNCRI Q++LRK ER+                R+      E D  L+R LE++L+VAK+VSVRL++ELE V+EKR+  E++N+ L+++L + E  +++L+ EL K ++      SL   G         + P T ++ +N +L+                   + +E    EQ LQ+      ++D+             RE++L  +L+  E++   L R+  ++E EN  L  +L+ +     ++ I D +  +   ++  ++ Q++L+E +   LR+    +E+EN  ++ EL + K K+ S  G   S     D        E+ K    +IN+L   V +L+ ENR   LL+++Q+    +  GI+P
Sbjct:  203 QELESEIDRLNDENDDLKHEIEEMRAEMDEMRDTFYEEDACQLQVLRRELERANKNCRILQYRLRKAERK----------------RMRYAETGEIDGELLRSLEQDLKVAKDVSVRLHNELENVEEKRTRTEDENEKLRQQLIEVEVTKQALQNELEKAKE-----ASLKRRGGKDPQKSEKRTPQTPTEEENDDLKCQLALIKEEAVLMRKKMAKIDKEKDRLEQELQKYRSFYGDVDSPLSKGEAGGPPTTRESELKLRLRLVEEEANILGRKIVELEVENRGLKAELDDVRGEDLASGISDPSSREQGEALLEMRQQLQLVEDEAELLRRNLADMEEENKRVTGELNKLKFKAGSHEGPRHSGGAAADGAKTEALQEELKAARLQINELSGKVMQLQYENR--VLLSNMQRYDLASHLGIRP 605          
BLAST of Prefoldin vs. Ensembl Cavefish
Match: soga1 (suppressor of glucose, autophagy associated 1 [Source:NCBI gene;Acc:103039957])

HSP 1 Score: 109.768 bits (273), Expect = 2.474e-23
Identity = 102/347 (29.39%), Postives = 178/347 (51.30%), Query Frame = 1
Query: 1078 DVSESM-NSKHQEILAENEQLRVRMEEIEQLCQDVMEENDMLKXXXXXXXXXXXXXHDHFQEDDTDTLRELKRDLETSNKNCRIFQFKLRKTERRYEQCENERGILEEKLNRLEAQLYSENDVNLIRGLEEELRVAKEVSVRLNSELELVDEKRSYFEEDNKHLKEELKDSETRRRSLEAELSKCRQEIEKLKSLDSSGALQIPDTASKRKNRNLESLSREPSFEEQSLQRELDAAKERETDLTEQLKFAEDDIRKLKRRFNDIEEENDSLSKKLET-------IMKSTNIEDNEFDDNASVRALKIQVELLEQQNSTLRKKFVSIEKENINLSNELRQAKAKSNSG 2094
            D++E + +  H+E L E E+LR               END LK+E +E++ E+ EM D + E+D   L+EL++ L+ +NK CRI Q++LRK ERR                 L      + D  LIR LE++++VAK+VS+RL+SELE V++KRS  E++N+ L+ +L+D E  ++ L+AEL K R+      SL   GA        +  N+  +  S +P               E  +DL  QL FA+++   + ++   + ++N+++ ++L         +  S  +ED     +     +++ ++L+E++ + L ++ V +E EN  L  E+   K +   G
Sbjct:  240 DLTEELTDGVHEEYLREIEELR--------------SENDYLKDEMDELRSEMLEMRDMYMEEDVYQLQELRQQLDQANKTCRILQYRLRKAERRS----------------LRVAQTGQVDGELIRTLEQDVKVAKDVSIRLHSELETVEKKRSRLEQENEELQVKLQDLEVAKQVLQAELEKSRE-----NSLKKRGA--------RPNNKPDKKASPQP--------------PEDSSDLKCQLHFAKEESALMCKKLTKMVKDNETMKEELAKYRSLYGDVDASLTVEDVADSPHTREAEVRVHLKLVEEEANLLSRRIVELEVENRGLRAEMDDMKIQETPG 529          
BLAST of Prefoldin vs. Ensembl Cavefish
Match: ENSAMXT00000040582.1 (microtubule crosslinking factor 1 [Source:NCBI gene;Acc:103038614])

HSP 1 Score: 93.9745 bits (232), Expect = 1.993e-18
Identity = 96/323 (29.72%), Postives = 173/323 (53.56%), Query Frame = 1
Query: 1120 AENEQLRVRMEEIEQLCQDVMEENDMLKXXXXXXXXXXXXXHDHFQEDDTDTLRELKRDLETSNKNCRIFQFKLRKTERRYEQCENERGILEEKLNRLEAQLYSENDVNLIRGLEEELRVAKEVSVRLNSELELVDEKRSYFEEDNKHLKEELKDSETRRRSLEAELSKCRQEIEKLKSLDSSGALQIPDTASKRKNRNLESLSREPSFEEQSLQRELDAAKERETDLTEQLKFAEDDIRKLKRRFNDIEEENDSLSKKLETIMKSTNIEDNEF-------DDNASVR--ALKIQVELLEQQNSTLRKKFVSIEKENINLSNE 2061
            +E+E LR    EIE+L      END LK+E +E++ E+EE+ D + E++   L+E++R+L+ SNKNCRI Q++LRK E++                 L        D  L+R LE++L+VAK+VSVRL++ELE V++KR+  E++N+ L++++ + E  +++L  E+ + ++                   A +R+       SRE   ++++L +E D+A     DL  QL+FA+++   ++++   +  E D L ++L+         D+             S R   L++++ L+E++ + L +K V +E EN  L  E
Sbjct:  250 SEDELLR----EIEEL----RSENDYLKDEVDELRAEMEEIRDSYLEEEVYQLQEMRRELDRSNKNCRILQYRLRKAEQKS----------------LRVAQTGHVDGELLRNLEQDLKVAKDVSVRLHNELESVEDKRTRAEDENEMLRQKIIEVEISKQALHNEMERAKE------------------MALRRRG------SRETFKDKKALSQE-DSA-----DLRCQLQFAKEESTLMRKKMAKLGREKDELEQELQKYKSVYGDVDSPLPLAELTGGGPHSTREAELRLRLRLVEEEANILGRKIVELEVENRGLRAE 518          
BLAST of Prefoldin vs. Ensembl Cavefish
Match: ENSAMXT00000012328.2 (microtubule crosslinking factor 1 [Source:NCBI gene;Acc:103038614])

HSP 1 Score: 93.5893 bits (231), Expect = 2.257e-18
Identity = 96/323 (29.72%), Postives = 173/323 (53.56%), Query Frame = 1
Query: 1120 AENEQLRVRMEEIEQLCQDVMEENDMLKXXXXXXXXXXXXXHDHFQEDDTDTLRELKRDLETSNKNCRIFQFKLRKTERRYEQCENERGILEEKLNRLEAQLYSENDVNLIRGLEEELRVAKEVSVRLNSELELVDEKRSYFEEDNKHLKEELKDSETRRRSLEAELSKCRQEIEKLKSLDSSGALQIPDTASKRKNRNLESLSREPSFEEQSLQRELDAAKERETDLTEQLKFAEDDIRKLKRRFNDIEEENDSLSKKLETIMKSTNIEDNEF-------DDNASVR--ALKIQVELLEQQNSTLRKKFVSIEKENINLSNE 2061
            +E+E LR    EIE+L      END LK+E +E++ E+EE+ D + E++   L+E++R+L+ SNKNCRI Q++LRK E++                 L        D  L+R LE++L+VAK+VSVRL++ELE V++KR+  E++N+ L++++ + E  +++L  E+ + ++                   A +R+       SRE   ++++L +E D+A     DL  QL+FA+++   ++++   +  E D L ++L+         D+             S R   L++++ L+E++ + L +K V +E EN  L  E
Sbjct:  250 SEDELLR----EIEEL----RSENDYLKDEVDELRAEMEEIRDSYLEEEVYQLQEMRRELDRSNKNCRILQYRLRKAEQKS----------------LRVAQTGHVDGELLRNLEQDLKVAKDVSVRLHNELESVEDKRTRAEDENEMLRQKIIEVEISKQALHNEMERAKE------------------MALRRRG------SRETFKDKKALSQE-DSA-----DLRCQLQFAKEESTLMRKKMAKLGREKDELEQELQKYKSVYGDVDSPLPLAELTGGGPHSTREAELRLRLRLVEEEANILGRKIVELEVENRGLRAE 518          
BLAST of Prefoldin vs. Ensembl Cavefish
Match: ENSAMXT00000043669.1 (microtubule crosslinking factor 1 [Source:NCBI gene;Acc:103038614])

HSP 1 Score: 93.2041 bits (230), Expect = 2.701e-18
Identity = 96/323 (29.72%), Postives = 173/323 (53.56%), Query Frame = 1
Query: 1120 AENEQLRVRMEEIEQLCQDVMEENDMLKXXXXXXXXXXXXXHDHFQEDDTDTLRELKRDLETSNKNCRIFQFKLRKTERRYEQCENERGILEEKLNRLEAQLYSENDVNLIRGLEEELRVAKEVSVRLNSELELVDEKRSYFEEDNKHLKEELKDSETRRRSLEAELSKCRQEIEKLKSLDSSGALQIPDTASKRKNRNLESLSREPSFEEQSLQRELDAAKERETDLTEQLKFAEDDIRKLKRRFNDIEEENDSLSKKLETIMKSTNIEDNEF-------DDNASVR--ALKIQVELLEQQNSTLRKKFVSIEKENINLSNE 2061
            +E+E LR    EIE+L      END LK+E +E++ E+EE+ D + E++   L+E++R+L+ SNKNCRI Q++LRK E++                 L        D  L+R LE++L+VAK+VSVRL++ELE V++KR+  E++N+ L++++ + E  +++L  E+ + ++                   A +R+       SRE   ++++L +E D+A     DL  QL+FA+++   ++++   +  E D L ++L+         D+             S R   L++++ L+E++ + L +K V +E EN  L  E
Sbjct:  250 SEDELLR----EIEEL----RSENDYLKDEVDELRAEMEEIRDSYLEEEVYQLQEMRRELDRSNKNCRILQYRLRKAEQKS----------------LRVAQTGHVDGELLRNLEQDLKVAKDVSVRLHNELESVEDKRTRAEDENEMLRQKIIEVEISKQALHNEMERAKE------------------MALRRRG------SRETFKDKKALSQE-DSA-----DLRCQLQFAKEESTLMRKKMAKLGREKDELEQELQKYKSVYGDVDSPLPLAELTGGGPHSTREAELRLRLRLVEEEANILGRKIVELEVENRGLRAE 518          
BLAST of Prefoldin vs. Ensembl Sea Lamprey
Match: SOGA1 (suppressor of glucose, autophagy associated 1 [Source:HGNC Symbol;Acc:HGNC:16111])

HSP 1 Score: 102.834 bits (255), Expect = 6.864e-22
Identity = 110/413 (26.63%), Postives = 195/413 (47.22%), Query Frame = 1
Query: 1108 QEILAENEQLRVRMEEIEQLCQDVMEENDMLKXXXXXXXXXXXXXHDHFQEDDTDTLRELKRDLETSNKNCRIFQFKLRKTERRYEQCENERGILEEKLNRLEAQLYSENDVNLIRGLEEELRVAKEVSVRLNSELELVDEKRSYFEEDNKHLKEELKDSETRRRSLEAELSKCRQEIEKLKSLDSSGALQIPDTASKRKNRNLESLSREPSFEEQSLQRELDAAKERETDLTEQLKFAEDDIRKLKRRFNDIEEENDSLSKKLETIMKSTNIEDNEF---DDNASVRA---------LKIQVELLEQQNSTLRKKFVSIEKENINLSNELRQAKAKSNSGTEKSDDTLKDE--------------------KYKLLEQKINDLHSDVERLEKENRRLTLLNSLQQAAPGIKP 2250
            QEI  E E+LR               EN  LK+E EE++ E+EEM D + E+D   +++L+R+L+ ++K+CRI Q++LRK ERR              L  L A     +D  LIR  E++L+VAK+VSVRL+ ELE V+++R   E++N  L+ +L   E  +++L+ E+ K ++                  +  +R +R L    + P             ++E   DL  QL+F +++   ++R+   + +E D   ++L+    S    D      D ++++           LK+++ L+E++ + L +K V +E EN  L +E+ + K     G+  ++ +  D+                      + +E++   L   V  LE++NR LT    L ++ PG  P
Sbjct:    2 QEIFREMEELR--------------SENTYLKDELEELRTEMEEMRDSYLEEDAQHVQDLRRELDRAHKSCRILQYRLRKAERR-------------SLRALAAAHSGHSDGELIRAFEQDLKVAKDVSVRLHRELESVEDRRVRAEDENDTLRAKLIQLEVAKQALQNEMDKLKE-----------------SSLRRRGSRELYKPEKRP------------LSQEDNADLKCQLQFLKEEAALMRRKMVRVGKERDRFEQELQKYKASYGDLDGPLTAGDGSSAIGGGPPSTRETELKLRLRLVEEEATVLSRKIVELEVENGGLKSEMEEMKCHCEKGSATAEGSDADDHRSCISVDGELGESACELRRHLQFVEEEAEVLRRSVVELEEQNRLLT--EELGRSRPGSDP 356          
BLAST of Prefoldin vs. Ensembl Sea Lamprey
Match: SOGA1 (suppressor of glucose, autophagy associated 1 [Source:HGNC Symbol;Acc:HGNC:16111])

HSP 1 Score: 102.834 bits (255), Expect = 7.495e-22
Identity = 110/413 (26.63%), Postives = 195/413 (47.22%), Query Frame = 1
Query: 1108 QEILAENEQLRVRMEEIEQLCQDVMEENDMLKXXXXXXXXXXXXXHDHFQEDDTDTLRELKRDLETSNKNCRIFQFKLRKTERRYEQCENERGILEEKLNRLEAQLYSENDVNLIRGLEEELRVAKEVSVRLNSELELVDEKRSYFEEDNKHLKEELKDSETRRRSLEAELSKCRQEIEKLKSLDSSGALQIPDTASKRKNRNLESLSREPSFEEQSLQRELDAAKERETDLTEQLKFAEDDIRKLKRRFNDIEEENDSLSKKLETIMKSTNIEDNEF---DDNASVRA---------LKIQVELLEQQNSTLRKKFVSIEKENINLSNELRQAKAKSNSGTEKSDDTLKDE--------------------KYKLLEQKINDLHSDVERLEKENRRLTLLNSLQQAAPGIKP 2250
            QEI  E E+LR               EN  LK+E EE++ E+EEM D + E+D   +++L+R+L+ ++K+CRI Q++LRK ERR              L  L A     +D  LIR  E++L+VAK+VSVRL+ ELE V+++R   E++N  L+ +L   E  +++L+ E+ K ++                  +  +R +R L    + P             ++E   DL  QL+F +++   ++R+   + +E D   ++L+    S    D      D ++++           LK+++ L+E++ + L +K V +E EN  L +E+ + K     G+  ++ +  D+                      + +E++   L   V  LE++NR LT    L ++ PG  P
Sbjct:    2 QEIFREMEELR--------------SENTYLKDELEELRTEMEEMRDSYLEEDAQHVQDLRRELDRAHKSCRILQYRLRKAERR-------------SLRALAAAHSGHSDGELIRAFEQDLKVAKDVSVRLHRELESVEDRRVRAEDENDTLRAKLIQLEVAKQALQNEMDKLKE-----------------SSLRRRGSRELYKPEKRP------------LSQEDNADLKCQLQFLKEEAALMRRKMVRVGKERDRFEQELQKYKASYGDLDGPLTAGDGSSAIGGGPPSTRETELKLRLRLVEEEATVLSRKIVELEVENGGLKSEMEEMKCHCEKGSATAEGSDADDHRSCISVDGELGESACELRRHLQFVEEEAEVLRRSVVELEEQNRLLT--EELGRSRPGSDP 356          
BLAST of Prefoldin vs. Ensembl Medaka
Match: soga3a (protein SOGA3-like [Source:NCBI gene;Acc:111948921])

HSP 1 Score: 112.849 bits (281), Expect = 1.790e-24
Identity = 121/411 (29.44%), Postives = 216/411 (52.55%), Query Frame = 1
Query: 1144 RMEEIEQLCQDVME----ENDMLKXXXXXXXXXXXXXHDHFQEDDTDTLRELKRDLETSNKNCRIFQFKLRKTERRYEQCENERGILEEKLNRLEAQLYSENDVNLIRGLEEELRVAKEVSVRLNSELELVDEKRSYFEEDNKHLKEELKDSETRRRSLEAELSKCRQ-EIEKLKSLDSSGA-LQIPDTASKRKNRNLES------------------LSREPSFEEQSLQR------ELDA----------AKERETDLTEQLKFAEDDIRKLKRRFNDIEEENDSLSKKLETIMKSTNIEDNEFDDNASVRALKIQVELLEQQNSTLRKKFVSIEKENINLSNELRQAKAKSNS---------GTEKSDDTLKDEKYKLLEQKINDLHSDVERLEKENRRLTLLNSLQQ 2229
            R  + +Q  QD +E    EN+ LK E EEM+ E++EM D F E+D   L++++R+LE +NKNCRI Q++L+K ER+                RL      + D  L+R  E++L+VAK+VSVRL+ ELE V+EKR+  EE N+ L+++L + E  +++L+ EL K ++  +++  S D   A  ++P T  + +N +L+                   + +E    EQ LQ+      ++D+             RE++L  +L+  E++   L R+  ++E EN  L  +L+ + + ++      + + ++  L+ Q++L+E +   LR+    IE+EN  +++EL + K K+ S         G + +      E+ K    +IN+L   V +L+ ENR   LL+++Q+
Sbjct:  187 RAPQPDQNLQDEIERLEDENEDLKTEIEEMRAEMDEMRDTFYEEDACQLQDMRRELERANKNCRILQYRLKKAERK----------------RLRFTESGQVDGELLRSFEQDLKVAKDVSVRLHHELENVEEKRTKTEEQNEKLRQQLIEVEVTKQALQNELDKTKELSLKRKGSKDGQRAERKMPQTPVEEENEDLKCQLAFIKEEAILMRKKMAKIDKEKDRLEQELQKYRSFYGDVDSPLPKGEAGGPPTTRESELKLRLRLVEEEANILGRKIVELEVENRGLKAELDDMREESSGGHQSREQSEALSELRQQLQLVEDEAELLRRNLADIEEENKKVTSELNKLKYKAGSHEAGSRHGGGADPAKVEALQEELKAARLQINELSGKVMQLQYENR--VLLSNMQR 579          
BLAST of Prefoldin vs. Ensembl Medaka
Match: soga3a (protein SOGA3-like [Source:NCBI gene;Acc:111948921])

HSP 1 Score: 112.464 bits (280), Expect = 2.121e-24
Identity = 121/411 (29.44%), Postives = 216/411 (52.55%), Query Frame = 1
Query: 1144 RMEEIEQLCQDVME----ENDMLKXXXXXXXXXXXXXHDHFQEDDTDTLRELKRDLETSNKNCRIFQFKLRKTERRYEQCENERGILEEKLNRLEAQLYSENDVNLIRGLEEELRVAKEVSVRLNSELELVDEKRSYFEEDNKHLKEELKDSETRRRSLEAELSKCRQ-EIEKLKSLDSSGA-LQIPDTASKRKNRNLES------------------LSREPSFEEQSLQR------ELDA----------AKERETDLTEQLKFAEDDIRKLKRRFNDIEEENDSLSKKLETIMKSTNIEDNEFDDNASVRALKIQVELLEQQNSTLRKKFVSIEKENINLSNELRQAKAKSNS---------GTEKSDDTLKDEKYKLLEQKINDLHSDVERLEKENRRLTLLNSLQQ 2229
            R  + +Q  QD +E    EN+ LK E EEM+ E++EM D F E+D   L++++R+LE +NKNCRI Q++L+K ER+                RL      + D  L+R  E++L+VAK+VSVRL+ ELE V+EKR+  EE N+ L+++L + E  +++L+ EL K ++  +++  S D   A  ++P T  + +N +L+                   + +E    EQ LQ+      ++D+             RE++L  +L+  E++   L R+  ++E EN  L  +L+ + + ++      + + ++  L+ Q++L+E +   LR+    IE+EN  +++EL + K K+ S         G + +      E+ K    +IN+L   V +L+ ENR   LL+++Q+
Sbjct:  187 RAPQPDQNLQDEIERLEDENEDLKTEIEEMRAEMDEMRDTFYEEDACQLQDMRRELERANKNCRILQYRLKKAERK----------------RLRFTESGQVDGELLRSFEQDLKVAKDVSVRLHHELENVEEKRTKTEEQNEKLRQQLIEVEVTKQALQNELDKTKELSLKRKGSKDGQRAERKMPQTPVEEENEDLKCQLAFIKEEAILMRKKMAKIDKEKDRLEQELQKYRSFYGDVDSPLPKGEAGGPPTTRESELKLRLRLVEEEANILGRKIVELEVENRGLKAELDDMREESSGGHQSREQSEALSELRQQLQLVEDEAELLRRNLADIEEENKKVTSELNKLKYKAGSHEAGSRHGGGADPAKVEALQEELKAARLQINELSGKVMQLQYENR--VLLSNMQR 579          
BLAST of Prefoldin vs. Ensembl Medaka
Match: ENSORLT00000043285.1 (microtubule crosslinking factor 1 [Source:NCBI gene;Acc:101174861])

HSP 1 Score: 105.916 bits (263), Expect = 4.671e-22
Identity = 119/430 (27.67%), Postives = 210/430 (48.84%), Query Frame = 1
Query: 1141 VRMEEIEQLCQDVMEENDMLKXXXXXXXXXXXXXHDHFQEDDTDTLRELKRDLETSNKNCRIFQFKLRKTERRYEQCENERGILEEKLNRLEAQLYSENDVNLIRGLEEELRVAKEVSVRLNSELELVDEKRSYFEEDNKHLKEELKDSETRRRSLEAELSKCRQEI-------EKLK---------SLDSSGALQIPDTASKRKNRNLESLSREPSFEEQSLQR------ELDAA------------KERETDLTEQLKFAEDDIRKLKRRFNDIEEENDSLSKKLETIMKS-----------TNIEDNEFDDNA--SVRALKIQVELLEQQNSTLRKKFVSIEKENINLSNELRQAK-------------------AKSNSGTEKSDDTLKDEKYKLLEQKINDLHSDVERLEKENRRLTLLNSLQQA 2232
            V  E++++  +D+  END LK+E EE++ E+EE+ D + E++   L+EL+R+L+ SNKNCRI Q++LRK E++                 L      + D +L+RGLE++L+VAK+VSVRL++ELE+V++KRS  E++N+ L++++ + E  +++L  EL + ++         E  K         S D    LQ     S    + +  L RE    EQ +Q+      ++D+               RE +L  +LK  E++   L R+  ++E EN SL  + E I              +++  + +  +A  S   L+  ++ +E++   LR+    IE  N  L++EL + K                    K  +G   S   +  E+ K    +IN+L   V +L+ EN    L++++Q+ 
Sbjct:  246 VTEEDLQREIEDLRSENDYLKDEVEELRAEMEEVRDCYLEEEVYQLQELRRELDRSNKNCRILQYRLRKAEQKS----------------LRVAQTGQVDGDLLRGLEQDLKVAKDVSVRLHNELEIVEDKRSRAEDENETLRQKIIEVEISKQALHNELERMKETALRRRGSREAFKDKKPSNQEDSADLRCQLQFAKEESSLMRKKMAKLGREKDELEQEMQKYKSVYGDIDSPLPLVECSGGGPHTTREAELRLRLKLVEEEANILGRKIVELEVENRSLRAENEDIRGQYERDFFGREPFSSMPSSPYAGDALESANELRRHLQFVEEEAELLRRSISEIEDHNRQLTSELNRFKFGPSGTSVHAGEEGNEGVLFKPGNGGSGSSPLMMMEELKSARMQINELSGKVMKLQYENH--VLMSNVQRC 657          
BLAST of Prefoldin vs. Ensembl Medaka
Match: ENSORLT00000004893.2 (microtubule crosslinking factor 1 [Source:NCBI gene;Acc:101174861])

HSP 1 Score: 105.531 bits (262), Expect = 5.314e-22
Identity = 119/430 (27.67%), Postives = 210/430 (48.84%), Query Frame = 1
Query: 1141 VRMEEIEQLCQDVMEENDMLKXXXXXXXXXXXXXHDHFQEDDTDTLRELKRDLETSNKNCRIFQFKLRKTERRYEQCENERGILEEKLNRLEAQLYSENDVNLIRGLEEELRVAKEVSVRLNSELELVDEKRSYFEEDNKHLKEELKDSETRRRSLEAELSKCRQEI-------EKLK---------SLDSSGALQIPDTASKRKNRNLESLSREPSFEEQSLQR------ELDAA------------KERETDLTEQLKFAEDDIRKLKRRFNDIEEENDSLSKKLETIMKS-----------TNIEDNEFDDNA--SVRALKIQVELLEQQNSTLRKKFVSIEKENINLSNELRQAK-------------------AKSNSGTEKSDDTLKDEKYKLLEQKINDLHSDVERLEKENRRLTLLNSLQQA 2232
            V  E++++  +D+  END LK+E EE++ E+EE+ D + E++   L+EL+R+L+ SNKNCRI Q++LRK E++                 L      + D +L+RGLE++L+VAK+VSVRL++ELE+V++KRS  E++N+ L++++ + E  +++L  EL + ++         E  K         S D    LQ     S    + +  L RE    EQ +Q+      ++D+               RE +L  +LK  E++   L R+  ++E EN SL  + E I              +++  + +  +A  S   L+  ++ +E++   LR+    IE  N  L++EL + K                    K  +G   S   +  E+ K    +IN+L   V +L+ EN    L++++Q+ 
Sbjct:  246 VTEEDLQREIEDLRSENDYLKDEVEELRAEMEEVRDCYLEEEVYQLQELRRELDRSNKNCRILQYRLRKAEQKS----------------LRVAQTGQVDGDLLRGLEQDLKVAKDVSVRLHNELEIVEDKRSRAEDENETLRQKIIEVEISKQALHNELERMKETALRRRGSREAFKDKKPSNQEDSADLRCQLQFAKEESSLMRKKMAKLGREKDELEQEMQKYKSVYGDIDSPLPLVECSGGGPHTTREAELRLRLKLVEEEANILGRKIVELEVENRSLRAENEDIRGQYERDFFGREPFSSMPSSPYAGDALESANELRRHLQFVEEEAELLRRSISEIEDHNRQLTSELNRFKFGPSGTSVHAGEEGNEGVLFKPGNGGSGSSPLMMMEELKSARMQINELSGKVMKLQYENH--VLMSNVQRC 657          
BLAST of Prefoldin vs. Ensembl Medaka
Match: ENSORLT00000029439.1 (microtubule crosslinking factor 1 [Source:NCBI gene;Acc:101174861])

HSP 1 Score: 105.145 bits (261), Expect = 6.384e-22
Identity = 119/430 (27.67%), Postives = 210/430 (48.84%), Query Frame = 1
Query: 1141 VRMEEIEQLCQDVMEENDMLKXXXXXXXXXXXXXHDHFQEDDTDTLRELKRDLETSNKNCRIFQFKLRKTERRYEQCENERGILEEKLNRLEAQLYSENDVNLIRGLEEELRVAKEVSVRLNSELELVDEKRSYFEEDNKHLKEELKDSETRRRSLEAELSKCRQEI-------EKLK---------SLDSSGALQIPDTASKRKNRNLESLSREPSFEEQSLQR------ELDAA------------KERETDLTEQLKFAEDDIRKLKRRFNDIEEENDSLSKKLETIMKS-----------TNIEDNEFDDNA--SVRALKIQVELLEQQNSTLRKKFVSIEKENINLSNELRQAK-------------------AKSNSGTEKSDDTLKDEKYKLLEQKINDLHSDVERLEKENRRLTLLNSLQQA 2232
            V  E++++  +D+  END LK+E EE++ E+EE+ D + E++   L+EL+R+L+ SNKNCRI Q++LRK E++                 L      + D +L+RGLE++L+VAK+VSVRL++ELE+V++KRS  E++N+ L++++ + E  +++L  EL + ++         E  K         S D    LQ     S    + +  L RE    EQ +Q+      ++D+               RE +L  +LK  E++   L R+  ++E EN SL  + E I              +++  + +  +A  S   L+  ++ +E++   LR+    IE  N  L++EL + K                    K  +G   S   +  E+ K    +IN+L   V +L+ EN    L++++Q+ 
Sbjct:  246 VTEEDLQREIEDLRSENDYLKDEVEELRAEMEEVRDCYLEEEVYQLQELRRELDRSNKNCRILQYRLRKAEQKS----------------LRVAQTGQVDGDLLRGLEQDLKVAKDVSVRLHNELEIVEDKRSRAEDENETLRQKIIEVEISKQALHNELERMKETALRRRGSREAFKDKKPSNQEDSADLRCQLQFAKEESSLMRKKMAKLGREKDELEQEMQKYKSVYGDIDSPLPLVECSGGGPHTTREAELRLRLKLVEEEANILGRKIVELEVENRSLRAENEDIRGQYERDFFGREPFSSMPSSPYAGDALESANELRRHLQFVEEEAELLRRSISEIEDHNRQLTSELNRFKFGPSGTSVHAGEEGNEGVLFKPGNGGSGSSPLMMMEELKSARMQINELSGKVMKLQYENH--VLMSNVQRC 657          
BLAST of Prefoldin vs. Planmine SMEST
Match: SMESG000016835.1 (SMESG000016835.1)

HSP 1 Score: 3509.54 bits (9099), Expect = 0.000e+0
Identity = 1946/1955 (99.54%), Postives = 1951/1955 (99.80%), Query Frame = 1
Query:  376 DGSGALTKKKECYTFEPQQWRRTVCKNCFRSLPDHPTEPSAGSGNNGKGISPRTSPLLGTKSVNAATPQLTAISGISKDPVLRKGETSPNNRRRPKSDEFKQKTPSPRESKRTMGSNTGRRSPANSPSSSVTRHSGSFSANRQNSTSSIDTKYVXXXXXXXXXXXXKYDEISXXXXXXXXXXXXXTHLNEDFLEDIEAYKNKTIHLERRIQHLDEEVRNYRERLKLPESDQANIDVSESMNSKHQEILAENEQLRVRMEEIEQLCQDVMEENDMLKXXXXXXXXXXXXXHDHFQEDDTDTLRELKRDLETSNKNCRIFQFKLRKTERRYEQCENERGILEEKLNRLEAQLYSENDVNLIRGLEEELRVAKEVSVRLNSELELVDEKRSYFEEDNKHLKEELKDSETRRRSLEAELSKCRQEIEKLKSLDSSGALQIPDTASKRKNRNLESLSREPSFEEQSLQRELDAAKERETDLTEQLKFAEDDIRKLKRRFNDIEEENDSLSKKLETIMKSTNIEDNEFDDNASVRALKIQVELLEQQNSTLRKKFVSIEKENINLSNELRQAKAKSNSGTEKSDDTLKDEKYKLLEQKINDLHSDVERLEKENRRLTLLNSLQQAAPGIKPKVSQPPYPVETTTDFIQNVQIQDLKSECNRLKEQIKQYDKQIKAIMSQIEQQYGSHLTDKKQLEYLSKYNETINTCRTQEKQIMQLNKQIEGLKEDICKYKEFYDKNYKSDLKSTKFGRGDAKSDLESASKSVXXXXXXXXXXXXXXXASKCEKTEFKVSDLSKTILEKDSIIEEMISDNGRREKELNNYIEQXXXXXXXXXXXXXCVETRANELQQQFDRMVSPDESVDXXXXXXXXXXXXXXXXENGSASVRATNQGKTCQFSAGSDDVFNEHYGYQIDAPGNLNDAEKIKFRFTCLERLLSEERKRTRIAEKQAEMALKDSVHSRVNEDSQLKKKEIEMLKTDXXXXXXXXXXXXQHIQDLKNRLDQTRKMNEALRTLLDKQDEGVSSSSLKTKDGSNKEQSIEISSYKKEVSALKNDIHQYAIKISESEKIREKLAKEIRNLQAEMKVREEQIYEQDDEMRAKDQELRTVKRLLDETQNTLKSQAQSNNITKDIEEKIQKNGELINKVEELNKTLQKYKTQIEEREIEKKQWETQQKILTDSITTRDERIQEKDDLINHLNQRLQNREKELTDFDILISQTNEKLEKNQEIIKNTQMLLSKKDVDFESLKAKTDDLQTSYDNITGNLHSVRKENEKLKTKIAEFEKEKSKPPPVPRISTSSAVDVDKLKMEISQLKKDKENLTTMLNKDKVSFSAARRDSETAKTESDSYMKAIQHQQYVTRVNLLTDNVTRLNRINIELKLQNEAIQNNMLEYQRKYKNIKEQYENEQESWTTERITLTSRMKEYEDRKSVITSLRKSLQEVSIKVANXXXXXXXXXXXXXXXXXXXTKFKNELQKKLSTYEDQQKLPKVLQRFGGKMTTRTTTESQLDKEKAELKVRLEAADKLISKLRGDIIEKDERFSHDKIELLKRSEETRINLELMIQNLTDQLVDMEGCKEQLFMMKERLFVVEESLERDKKVWNEERMMLQFKIEDNRMIIETWLTKIREEDTNSNSLQNEVIANLEKDIEKYLYSKDSVPYSHMRRKNDQESLDLLYCCEPRIQVPSSQNDSAIGSMPSSPASSLIGKSPFKSISLDWTNRMTRSQLTPEXXXXXXXXXXXXXXRNNRSVSPDHSRSTSITRKITNYPDPTPGFMLKPXXXXXXXXXXXKDPTDYTSRSFTLPGLRNNHNASRISPARQKFFELTDSKPSPKTEEKTIQDEKSGSTLTIPSITSEINRLIECADQVKIPESKSDNAKTKAEKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIDNFNKSEPIQKPIKSKSTSIAPSIQQLRKKFAQKXXXXXXXXXXXXQKL 6240
            DGSGALTKKKECYTFEPQQWRRTVCKNCFRSLPDHPTEPSAGSGNNGKGISPRTSPLLGTKSVNAATPQ TAISGISKDPVLRKGETSPNNRRRPKSDEFKQKTPSPRESKRTMGSNTGRRSPANSPSSSVTRHSGSFSANRQNSTSSIDTKYVEELENDFFDLEDKYDEISKEKAELEKELMEKTHLNEDFLEDIEAYKNKTIHLERRIQHLDEEVRNYRERLKLPESDQANIDVSESMNSKHQEILAENEQLRVRMEEIEQLCQDVMEENDMLKEEQEEMQREIEEMHDHFQEDDTDTLRELKRDLETSNKNCRIFQFKLRKTERRYEQCENERGILEEKLNRLEAQLYSENDVNLIRGLEEELRVAKEVSVRLNSELELVDEKRSYFEEDNKHLKEELKDSETRRRSLEAELSKCRQEIEKLKS DSSGALQIPDTASKRKNRNLESLSREPSFEEQSLQRELDAAKERETDLTEQLKFAEDDIRKLKRRFNDIEEENDSLSKKLETIMKSTNIEDNEFDDNASVRALKIQVELLEQQNSTLRKKFVSIEKENINLSNELRQAKAKS+SGTEKSDDTLKDEKYKLLEQKINDLHSDVERLEKENRRLTLLNSLQQAAPGIKPKVSQPPYPVETTTDFIQNVQIQDLKSECNRLKEQIKQYDKQIKAIMSQIEQQYGSHLTDKKQLEYLSKYNETINTCRTQEKQIMQLNKQIEGLKEDICKYKEFYDKNYKSDLKSTKFGRGDAKSDLESASKSVLLEEIICLEDEIDELASKCEKTEFKVSDLSKTILEKDSIIEEMISDNGRREKELNNYIEQLLTKNTLLSDLLSCVETRANELQQQFDRMVSPDESVDSSNRSSTTTTTTTTNTENGSASVRATNQGKTCQFSAGSDDVFNEHYGYQIDAPGNLNDAEKIKFRFTCLERLLSEERKRTRIAEKQAEMALKDSVHSRVNEDSQLKKKEIEMLKTDLEEKNEMLEEKEQHIQDLKNRLDQTRKMNEALRTLLDKQDEGVSSSSLKTKDGSNKEQSIEISSYKKEVSALKNDIHQYAIKISESEKIREKLAKEIRNLQAEMKVREEQIYEQDDEMRAKDQE RTVKRLLDETQNTLKSQAQSNNITKDIEEKIQKNGELINKVEELNKTLQKYKTQIEEREIEKKQWETQQKILTDSITTRDERIQEKDDLINHLNQRLQNREKELTDFDILISQTNEKLEKNQEIIKNTQMLLSKKDVDFESLKAKTDDLQTSYDNITGNLHSVRKENEKLKTKIAEFEKEKSKPPPVPRISTSSAVDVDKLKMEISQLKKDKENLTT+LNKDKVSFSAARRDSETAKTESDSYMKAIQHQQYVTRVNLLTDNVTRLNRINIELKLQNEAIQNNMLEYQRKYKNIKEQYENEQESWTTERITL+SRMKEYEDRKSVITSLRKSLQEVSIKVANLESQLSKEKQESEQKIEEITKFKNELQKKLSTYEDQQKLPKVLQRFGGKMTTRTTTES LDKEKAELKVRLEAADKLISKLRGDIIEKDERFSHDKIELLKRSEETRINLELMIQNLTDQLVDMEGCKEQLFMMKERLFVVEESLERDKKVWNEERMMLQFKIEDNRMIIETWLTKIREEDTNSNSLQNEVIANLEKDIEKYLYSKDSVPYSHMRRKNDQESLDLLYCCEPRIQVPSSQNDSAIGSMPSSPASSLIGKSPFKSISLDWTNRMTRSQLTPEISSSNQSINTSQFFR+NRSVSPDHSRSTSITRKITNYPDPTPGFMLKPSSRQSSVESVSKDPTDYTSRSFTLPGLRNNHNASRISPARQKFFELTDSKPSPKTEEKTIQDEKSGSTLTIPSITSEINRLIECADQVKIPESKS+NAKTKAEKPAASSSLSSALTTTTTTTTPISPTSVTTTTTAKLPIDNFNKSEPIQKPIKSKSTSIAPSIQQLRKKFAQKSTNSSSFDGSNSQKL
Sbjct:   10 DGSGALTKKKECYTFEPQQWRRTVCKNCFRSLPDHPTEPSAGSGNNGKGISPRTSPLLGTKSVNAATPQSTAISGISKDPVLRKGETSPNNRRRPKSDEFKQKTPSPRESKRTMGSNTGRRSPANSPSSSVTRHSGSFSANRQNSTSSIDTKYVEELENDFFDLEDKYDEISKEKAELEKELMEKTHLNEDFLEDIEAYKNKTIHLERRIQHLDEEVRNYRERLKLPESDQANIDVSESMNSKHQEILAENEQLRVRMEEIEQLCQDVMEENDMLKEEQEEMQREIEEMHDHFQEDDTDTLRELKRDLETSNKNCRIFQFKLRKTERRYEQCENERGILEEKLNRLEAQLYSENDVNLIRGLEEELRVAKEVSVRLNSELELVDEKRSYFEEDNKHLKEELKDSETRRRSLEAELSKCRQEIEKLKSFDSSGALQIPDTASKRKNRNLESLSREPSFEEQSLQRELDAAKERETDLTEQLKFAEDDIRKLKRRFNDIEEENDSLSKKLETIMKSTNIEDNEFDDNASVRALKIQVELLEQQNSTLRKKFVSIEKENINLSNELRQAKAKSSSGTEKSDDTLKDEKYKLLEQKINDLHSDVERLEKENRRLTLLNSLQQAAPGIKPKVSQPPYPVETTTDFIQNVQIQDLKSECNRLKEQIKQYDKQIKAIMSQIEQQYGSHLTDKKQLEYLSKYNETINTCRTQEKQIMQLNKQIEGLKEDICKYKEFYDKNYKSDLKSTKFGRGDAKSDLESASKSVLLEEIICLEDEIDELASKCEKTEFKVSDLSKTILEKDSIIEEMISDNGRREKELNNYIEQLLTKNTLLSDLLSCVETRANELQQQFDRMVSPDESVDSSNRSSTTTTTTTTNTENGSASVRATNQGKTCQFSAGSDDVFNEHYGYQIDAPGNLNDAEKIKFRFTCLERLLSEERKRTRIAEKQAEMALKDSVHSRVNEDSQLKKKEIEMLKTDLEEKNEMLEEKEQHIQDLKNRLDQTRKMNEALRTLLDKQDEGVSSSSLKTKDGSNKEQSIEISSYKKEVSALKNDIHQYAIKISESEKIREKLAKEIRNLQAEMKVREEQIYEQDDEMRAKDQEFRTVKRLLDETQNTLKSQAQSNNITKDIEEKIQKNGELINKVEELNKTLQKYKTQIEEREIEKKQWETQQKILTDSITTRDERIQEKDDLINHLNQRLQNREKELTDFDILISQTNEKLEKNQEIIKNTQMLLSKKDVDFESLKAKTDDLQTSYDNITGNLHSVRKENEKLKTKIAEFEKEKSKPPPVPRISTSSAVDVDKLKMEISQLKKDKENLTTLLNKDKVSFSAARRDSETAKTESDSYMKAIQHQQYVTRVNLLTDNVTRLNRINIELKLQNEAIQNNMLEYQRKYKNIKEQYENEQESWTTERITLSSRMKEYEDRKSVITSLRKSLQEVSIKVANLESQLSKEKQESEQKIEEITKFKNELQKKLSTYEDQQKLPKVLQRFGGKMTTRTTTESLLDKEKAELKVRLEAADKLISKLRGDIIEKDERFSHDKIELLKRSEETRINLELMIQNLTDQLVDMEGCKEQLFMMKERLFVVEESLERDKKVWNEERMMLQFKIEDNRMIIETWLTKIREEDTNSNSLQNEVIANLEKDIEKYLYSKDSVPYSHMRRKNDQESLDLLYCCEPRIQVPSSQNDSAIGSMPSSPASSLIGKSPFKSISLDWTNRMTRSQLTPEISSSNQSINTSQFFRSNRSVSPDHSRSTSITRKITNYPDPTPGFMLKPSSRQSSVESVSKDPTDYTSRSFTLPGLRNNHNASRISPARQKFFELTDSKPSPKTEEKTIQDEKSGSTLTIPSITSEINRLIECADQVKIPESKSNNAKTKAEKPAASSSLSSALTTTTTTTTPISPTSVTTTTTAKLPIDNFNKSEPIQKPIKSKSTSIAPSIQQLRKKFAQKSTNSSSFDGSNSQKL 1964          
BLAST of Prefoldin vs. Planmine SMEST
Match: SMESG000016835.1 (SMESG000016835.1)

HSP 1 Score: 3464.86 bits (8983), Expect = 0.000e+0
Identity = 1931/1955 (98.77%), Postives = 1936/1955 (99.03%), Query Frame = 1
Query:  376 DGSGALTKKKECYTFEPQQWRRTVCKNCFRSLPDHPTEPSAGSGNNGKGISPRTSPLLGTKSVNAATPQLTAISGISKDPVLRKGETSPNNRRRPKSDEFKQKTPSPRESKRTMGSNTGRRSPANSPSSSVTRHSGSFSANRQNSTSSIDTKYVXXXXXXXXXXXXKYDEISXXXXXXXXXXXXXTHLNEDFLEDIEAYKNKTIHLERRIQHLDEEVRNYRERLKLPESDQANIDVSESMNSKHQEILAENEQLRVRMEEIEQLCQDVMEENDMLKXXXXXXXXXXXXXHDHFQEDDTDTLRELKRDLETSNKNCRIFQFKLRKTERRYEQCENERGILEEKLNRLEAQLYSENDVNLIRGLEEELRVAKEVSVRLNSELELVDEKRSYFEEDNKHLKEELKDSETRRRSLEAELSKCRQEIEKLKSLDSSGALQIPDTASKRKNRNLESLSREPSFEEQSLQRELDAAKERETDLTEQLKFAEDDIRKLKRRFNDIEEENDSLSKKLETIMKSTNIEDNEFDDNASVRALKIQVELLEQQNSTLRKKFVSIEKENINLSNELRQAKAKSNSGTEKSDDTLKDEKYKLLEQKINDLHSDVERLEKENRRLTLLNSLQQAAPGIKPKVSQPPYPVETTTDFIQNVQIQDLKSECNRLKEQIKQYDKQIKAIMSQIEQQYGSHLTDKKQLEYLSKYNETINTCRTQEKQIMQLNKQIEGLKEDICKYKEFYDKNYKSDLKSTKFGRGDAKSDLESASKSVXXXXXXXXXXXXXXXASKCEKTEFKVSDLSKTILEKDSIIEEMISDNGRREKELNNYIEQXXXXXXXXXXXXXCVETRANELQQQFDRMVSPDESVDXXXXXXXXXXXXXXXXENGSASVRATNQGKTCQFSAGSDDVFNEHYGYQIDAPGNLNDAEKIKFRFTCLERLLSEERKRTRIAEKQAEMALKDSVHSRVNEDSQLKKKEIEMLKTDXXXXXXXXXXXXQHIQDLKNRLDQTRKMNEALRTLLDKQDEGVSSSSLKTKDGSNKEQSIEISSYKKEVSALKNDIHQYAIKISESEKIREKLAKEIRNLQAEMKVREEQIYEQDDEMRAKDQELRTVKRLLDETQNTLKSQAQSNNITKDIEEKIQKNGELINKVEELNKTLQKYKTQIEEREIEKKQWETQQKILTDSITTRDERIQEKDDLINHLNQRLQNREKELTDFDILISQTNEKLEKNQEIIKNTQMLLSKKDVDFESLKAKTDDLQTSYDNITGNLHSVRKENEKLKTKIAEFEKEKSKPPPVPRISTSSAVDVDKLKMEISQLKKDKENLTTMLNKDKVSFSAARRDSETAKTESDSYMKAIQHQQYVTRVNLLTDNVTRLNRINIELKLQNEAIQNNMLEYQRKYKNIKEQYENEQESWTTERITLTSRMKEYEDRKSVITSLRKSLQEVSIKVANXXXXXXXXXXXXXXXXXXXTKFKNELQKKLSTYEDQQKLPKVLQRFGGKMTTRTTTESQLDKEKAELKVRLEAADKLISKLRGDIIEKDERFSHDKIELLKRSEETRINLELMIQNLTDQLVDMEGCKEQLFMMKERLFVVEESLERDKKVWNEERMMLQFKIEDNRMIIETWLTKIREEDTNSNSLQNEVIANLEKDIEKYLYSKDSVPYSHMRRKNDQESLDLLYCCEPRIQVPSSQNDSAIGSMPSSPASSLIGKSPFKSISLDWTNRMTRSQLTPEXXXXXXXXXXXXXXRNNRSVSPDHSRSTSITRKITNYPDPTPGFMLKPXXXXXXXXXXXKDPTDYTSRSFTLPGLRNNHNASRISPARQKFFELTDSKPSPKTEEKTIQDEKSGSTLTIPSITSEINRLIECADQVKIPESKSDNAKTKAEKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIDNFNKSEPIQKPIKSKSTSIAPSIQQLRKKFAQKXXXXXXXXXXXXQKL 6240
            DGSGALTKKKECYTFEPQQWRRTVCKNCFRSLPDHPTEPSAGSGNNGKGISPRTSPLLGTKSVNAATPQ TAISGISKDPVLRKGETSPNNRRRPKSDEFKQKTPSPRESKRTMGSNTGRRSPANSPSSSVTRHSGSFSANRQNSTSSIDTKYVEELENDFFDLEDKYDEISKEKAELEKELMEKTHLNEDFLEDIEAYKNKTIHLERRIQHLDEEVRNYRERLKLPESDQANIDVSESMNSKHQEILAENEQLRVRMEEIEQLCQDVMEENDMLKEEQEEMQREIEEMHDHFQEDDTDTLRELKRDLETSNKNCRIFQFKLRKTERRYEQCENERGILEEKLNRLEAQLYSENDVNLIRGLEEELRVAKEVSVRLNSELELVDEKRSYFEEDNKHLKEELKDSETRRRSLEAELSKCRQEIEKLKS DSSGALQIPDTASKRKNRNLESLSREPSFEEQSLQRELDAAKERETDLTEQLKFAEDDIRKLKRRFNDIEEENDSLSKKLETIMKSTNIEDNEFDDNASVRALKIQVELLEQQNSTLRKKFVSIEKENINLSNELRQAKAKS+SGTEKSDDTLKDEKYKLLEQKINDLHSDVERLEKENRRLTLLNSLQQAAPGIKPKVSQPPYPVETTTDFIQNVQIQDLKSECNRLKEQIKQYDKQIKAIMSQIEQQYGSHLTDKKQLEYLSKYNETINTCRTQEKQIMQLNKQIEGLKEDICKYKEFYDKNYKSDLKSTKFGRGDAKSDLESASKSVLLEEIICLEDEIDELASKCEKTEFKVSDLSKTILEKDSIIEEMISDNGRREKELNNYIEQLLTKNTLLSDLLSCVETRANELQQQFDRMVSPDESVDSSNRSSTTTTTTTTNTENGSASVRATNQGKTCQFSAGSDDVFNEHYGYQIDAPGNLNDAEKIKFRFTCLERLLSEERKRTRIAEKQAEMALKDSVHSRVNEDSQLKKKEIEMLKTDLEEKNEMLEEKEQHIQDLKNRLDQTRKMNEALRTLLDKQDEGVSSSSLKTKDGSNKEQSIEISSYKKEVSALKNDIHQYAIKISESEKIREKLAKEIRNLQAEMKVREEQIYEQDDEMRAKDQE RTVKRLLDETQNTLKSQAQSNNITKDIEEKIQKNGELINKVEELNKTLQKYKTQIEEREIEKKQWETQQKILTDSITTRDERIQEKDDLINHLNQRLQNREKELTDFDILISQTNEKLEKNQEIIKNTQMLLSKKDVDFESLKAKTDDLQTSYDNITGNLHSVRKENEKLKTKIAEFEKEKSKPPPVPRISTSSAVDVDKLKMEISQLKKDKENLTT+LNKDKVSFSAARRDSETAKTESDSYMKAIQHQQYVTRVNLLTDNVTRLNRINIELKLQNEAIQNNMLEYQRKYKNIKEQYENEQESWTTERITL+SRMKEYEDRKSVITSLRKSLQEVSIKVANLESQLSKEKQESEQKIEEITKFKNELQKKLSTYEDQQKLPKVLQRFGGKMTTRTTTES LDKEKAELKVRLEAADKLISKLRGDIIEKDERFSHDKIELLKRSEETRINLELMIQNLTDQLVDMEGCKEQLFMMKERLFVVEESLERDKKVWNEERMMLQFKIEDNRMIIETWLTKIREEDTNSNSLQNEVIANLEKDIEKYLYSKDSVPYSHMRRK               IQVPSSQNDSAIGSMPSSPASSLIGKSPFKSISLDWTNRMTRSQLTPEISSSNQSINTSQFFR+NRSVSPDHSRSTSITRKITNYPDPTPGFMLKPSSRQSSVESVSKDPTDYTSRSFTLPGLRNNHNASRISPARQKFFELTDSKPSPKTEEKTIQDEKSGSTLTIPSITSEINRLIECADQVKIPESKS+NAKTKAEKPAASSSLSSALTTTTTTTTPISPTSVTTTTTAKLPIDNFNKSEPIQKPIKSKSTSIAPSIQQLRKKFAQKSTNSSSFDGSNSQKL
Sbjct:   10 DGSGALTKKKECYTFEPQQWRRTVCKNCFRSLPDHPTEPSAGSGNNGKGISPRTSPLLGTKSVNAATPQSTAISGISKDPVLRKGETSPNNRRRPKSDEFKQKTPSPRESKRTMGSNTGRRSPANSPSSSVTRHSGSFSANRQNSTSSIDTKYVEELENDFFDLEDKYDEISKEKAELEKELMEKTHLNEDFLEDIEAYKNKTIHLERRIQHLDEEVRNYRERLKLPESDQANIDVSESMNSKHQEILAENEQLRVRMEEIEQLCQDVMEENDMLKEEQEEMQREIEEMHDHFQEDDTDTLRELKRDLETSNKNCRIFQFKLRKTERRYEQCENERGILEEKLNRLEAQLYSENDVNLIRGLEEELRVAKEVSVRLNSELELVDEKRSYFEEDNKHLKEELKDSETRRRSLEAELSKCRQEIEKLKSFDSSGALQIPDTASKRKNRNLESLSREPSFEEQSLQRELDAAKERETDLTEQLKFAEDDIRKLKRRFNDIEEENDSLSKKLETIMKSTNIEDNEFDDNASVRALKIQVELLEQQNSTLRKKFVSIEKENINLSNELRQAKAKSSSGTEKSDDTLKDEKYKLLEQKINDLHSDVERLEKENRRLTLLNSLQQAAPGIKPKVSQPPYPVETTTDFIQNVQIQDLKSECNRLKEQIKQYDKQIKAIMSQIEQQYGSHLTDKKQLEYLSKYNETINTCRTQEKQIMQLNKQIEGLKEDICKYKEFYDKNYKSDLKSTKFGRGDAKSDLESASKSVLLEEIICLEDEIDELASKCEKTEFKVSDLSKTILEKDSIIEEMISDNGRREKELNNYIEQLLTKNTLLSDLLSCVETRANELQQQFDRMVSPDESVDSSNRSSTTTTTTTTNTENGSASVRATNQGKTCQFSAGSDDVFNEHYGYQIDAPGNLNDAEKIKFRFTCLERLLSEERKRTRIAEKQAEMALKDSVHSRVNEDSQLKKKEIEMLKTDLEEKNEMLEEKEQHIQDLKNRLDQTRKMNEALRTLLDKQDEGVSSSSLKTKDGSNKEQSIEISSYKKEVSALKNDIHQYAIKISESEKIREKLAKEIRNLQAEMKVREEQIYEQDDEMRAKDQEFRTVKRLLDETQNTLKSQAQSNNITKDIEEKIQKNGELINKVEELNKTLQKYKTQIEEREIEKKQWETQQKILTDSITTRDERIQEKDDLINHLNQRLQNREKELTDFDILISQTNEKLEKNQEIIKNTQMLLSKKDVDFESLKAKTDDLQTSYDNITGNLHSVRKENEKLKTKIAEFEKEKSKPPPVPRISTSSAVDVDKLKMEISQLKKDKENLTTLLNKDKVSFSAARRDSETAKTESDSYMKAIQHQQYVTRVNLLTDNVTRLNRINIELKLQNEAIQNNMLEYQRKYKNIKEQYENEQESWTTERITLSSRMKEYEDRKSVITSLRKSLQEVSIKVANLESQLSKEKQESEQKIEEITKFKNELQKKLSTYEDQQKLPKVLQRFGGKMTTRTTTESLLDKEKAELKVRLEAADKLISKLRGDIIEKDERFSHDKIELLKRSEETRINLELMIQNLTDQLVDMEGCKEQLFMMKERLFVVEESLERDKKVWNEERMMLQFKIEDNRMIIETWLTKIREEDTNSNSLQNEVIANLEKDIEKYLYSKDSVPYSHMRRK---------------IQVPSSQNDSAIGSMPSSPASSLIGKSPFKSISLDWTNRMTRSQLTPEISSSNQSINTSQFFRSNRSVSPDHSRSTSITRKITNYPDPTPGFMLKPSSRQSSVESVSKDPTDYTSRSFTLPGLRNNHNASRISPARQKFFELTDSKPSPKTEEKTIQDEKSGSTLTIPSITSEINRLIECADQVKIPESKSNNAKTKAEKPAASSSLSSALTTTTTTTTPISPTSVTTTTTAKLPIDNFNKSEPIQKPIKSKSTSIAPSIQQLRKKFAQKSTNSSSFDGSNSQKL 1949          
The following BLAST results are available for this feature:
BLAST of Prefoldin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SOGA34.981e-2330.34SOGA family member 3 [Source:HGNC Symbol;Acc:HGNC:... [more]
SOGA35.488e-2330.34SOGA family member 3 [Source:HGNC Symbol;Acc:HGNC:... [more]
AL096711.25.488e-2330.34novel protein[more]
MTCL11.005e-2028.30microtubule crosslinking factor 1 [Source:HGNC Sym... [more]
MTCL11.549e-1929.64microtubule crosslinking factor 1 [Source:HGNC Sym... [more]
back to top
BLAST of Prefoldin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tag-2412.987e-3432.31pep chromosome:WBcel235:X:11826093:11836162:1 gene... [more]
tag-2414.428e-3432.31pep chromosome:WBcel235:X:11824184:11836162:1 gene... [more]
tag-2414.993e-3432.31pep chromosome:WBcel235:X:11826093:11836162:1 gene... [more]
tag-2415.552e-3432.31pep chromosome:WBcel235:X:11824184:11836162:1 gene... [more]
tag-2416.863e-3432.31pep chromosome:WBcel235:X:11824184:11836162:1 gene... [more]
back to top
BLAST of Prefoldin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
CG183042.405e-2231.07gene:FBgn0031869 transcript:FBtr0332326[more]
CG183042.408e-2231.07gene:FBgn0031869 transcript:FBtr0306285[more]
CG183043.260e-1732.10gene:FBgn0031869 transcript:FBtr0079367[more]
CG183043.520e-1732.10gene:FBgn0031869 transcript:FBtr0332327[more]
back to top
BLAST of Prefoldin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
soga3a5.833e-2529.17SOGA family member 3a [Source:ZFIN;Acc:ZDB-GENE-10... [more]
soga3a5.833e-2529.17SOGA family member 3a [Source:ZFIN;Acc:ZDB-GENE-10... [more]
soga15.182e-2428.48suppressor of glucose, autophagy associated 1 [Sou... [more]
soga16.018e-2428.48suppressor of glucose, autophagy associated 1 [Sou... [more]
CR388032.19.619e-2328.04suppressor of glucose, autophagy associated 1 [Sou... [more]
back to top
BLAST of Prefoldin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rasa11.370e-2127.55RAS p21 protein activator (GTPase activating prote... [more]
rasa12.241e-2127.55RAS p21 protein activator (GTPase activating prote... [more]
rasa12.459e-2028.77RAS p21 protein activator (GTPase activating prote... [more]
SOGA11.782e-1928.50suppressor of glucose, autophagy associated 1 [Sou... [more]
SOGA11.802e-1828.62suppressor of glucose, autophagy associated 1 [Sou... [more]
back to top
BLAST of Prefoldin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Soga35.736e-2430.62SOGA family member 3 [Source:MGI Symbol;Acc:MGI:19... [more]
Mtcl11.036e-2332.33microtubule crosslinking factor 1 [Source:MGI Symb... [more]
Mtcl11.426e-2332.33microtubule crosslinking factor 1 [Source:MGI Symb... [more]
Soga15.485e-2330.32suppressor of glucose, autophagy associated 1 [Sou... [more]
Mtcl12.913e-2230.71microtubule crosslinking factor 1 [Source:MGI Symb... [more]
back to top
BLAST of Prefoldin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6NZL0|SOGA3_MOUSE4.012e-2330.62Protein SOGA3 OS=Mus musculus OX=10090 GN=Soga3 PE... [more]
sp|Q3UHU5|MTCL1_MOUSE7.250e-2332.33Microtubule cross-linking factor 1 OS=Mus musculus... [more]
sp|Q5TF21|SOGA3_HUMAN2.635e-2230.34Protein SOGA3 OS=Homo sapiens OX=9606 GN=SOGA3 PE=... [more]
sp|E1U8D0|SOGA1_MOUSE6.093e-2128.62Protein SOGA1 OS=Mus musculus OX=10090 GN=Soga1 PE... [more]
sp|Q9Y4B5|MTCL1_HUMAN4.829e-2028.30Microtubule cross-linking factor 1 OS=Homo sapiens... [more]
back to top
BLAST of Prefoldin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4E0S2525.887e-11739.95Prefoldin OS=Fasciola hepatica OX=6192 GN=D915_001... [more]
A0A4S2L0722.547e-11338.88Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4S2KZT44.656e-11338.88Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4S2L5I25.141e-11338.88Uncharacterized protein OS=Opisthorchis felineus O... [more]
H2KRN11.804e-11138.45Uncharacterized protein OS=Clonorchis sinensis OX=... [more]
back to top
BLAST of Prefoldin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
soga3a9.324e-2529.58SOGA family member 3a [Source:ZFIN;Acc:ZDB-GENE-10... [more]
soga12.474e-2329.39suppressor of glucose, autophagy associated 1 [Sou... [more]
ENSAMXT00000040582.11.993e-1829.72microtubule crosslinking factor 1 [Source:NCBI gen... [more]
ENSAMXT00000012328.22.257e-1829.72microtubule crosslinking factor 1 [Source:NCBI gen... [more]
ENSAMXT00000043669.12.701e-1829.72microtubule crosslinking factor 1 [Source:NCBI gen... [more]
back to top
BLAST of Prefoldin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
SOGA16.864e-2226.63suppressor of glucose, autophagy associated 1 [Sou... [more]
SOGA17.495e-2226.63suppressor of glucose, autophagy associated 1 [Sou... [more]
back to top
BLAST of Prefoldin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Prefoldin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Prefoldin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
soga3a1.790e-2429.44protein SOGA3-like [Source:NCBI gene;Acc:111948921... [more]
soga3a2.121e-2429.44protein SOGA3-like [Source:NCBI gene;Acc:111948921... [more]
ENSORLT00000043285.14.671e-2227.67microtubule crosslinking factor 1 [Source:NCBI gen... [more]
ENSORLT00000004893.25.314e-2227.67microtubule crosslinking factor 1 [Source:NCBI gen... [more]
ENSORLT00000029439.16.384e-2227.67microtubule crosslinking factor 1 [Source:NCBI gen... [more]
back to top
BLAST of Prefoldin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000016835.10.000e+099.54SMESG000016835.1[more]
SMESG000016835.10.000e+098.77SMESG000016835.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011827 ID=SMED30011827|Name=Prefoldin|organism=Schmidtea mediterranea sexual|type=transcript|length=6471bp
CGTGAATTTTCATAAATCGATCACAACTCTCACCAGATCCACCGTTAAAA
TGATAGCAGTAGGCGAACAACAGTTATAATTTCTTCATATTTAGTTTTCG
TCGATTAGGTCAGTTTCTAGAGAATATTCTTGTTTAGCAAGAATAACAAT
TCAATTTCGATTCAATTTCAATTTAAAAGTTCAAATTTGGCGTGGAAATA
GCTTTTTTTTGTTTTATCATTTGACGACGATTTAAACAAAGCAAGCTTTA
TTTGGAAAATACTCGCCGGCTTGTTTGCATTTGAACTTTGAGTCACCGAA
GATCAAATTTGTTTATTTTTACACAATCGTAGTAGATAGTCTAGTGCTAT
GGCATCGAATAACAATCGAGCACGCGATGGATCTGGTGCGTTGACGAAAA
AAAAGGAGTGCTATACGTTTGAACCTCAACAATGGAGACGAACGGTTTGC
AAAAATTGCTTTAGATCATTACCAGATCATCCAACTGAACCGTCAGCCGG
CAGCGGAAACAATGGAAAAGGTATCAGTCCAAGAACAAGTCCTCTATTGG
GAACTAAATCCGTAAACGCCGCTACTCCTCAATTGACAGCTATCAGTGGA
ATTTCTAAAGATCCTGTATTGAGAAAAGGGGAAACATCTCCGAATAATCG
CCGAAGACCGAAATCAGATGAATTCAAACAAAAAACCCCATCTCCAAGAG
AAAGCAAACGAACTATGGGTTCAAACACCGGCCGAAGAAGTCCAGCCAAC
AGTCCATCGTCAAGCGTAACTAGGCATTCGGGTTCGTTTTCTGCAAACAG
ACAAAACTCCACTTCAAGCATCGACACGAAATATGTGGAGGAATTGGAAA
ACGATTTCTTTGATTTAGAAGACAAATACGATGAAATTTCCAAAGAGAAA
GCTGAACTCGAAAAGGAACTAATGGAAAAAACCCATTTAAATGAAGACTT
TTTGGAAGATATTGAAGCGTATAAAAATAAAACAATTCATCTCGAAAGAA
GAATTCAGCATTTGGACGAAGAAGTTCGCAATTACAGAGAGCGACTCAAA
TTGCCAGAGAGCGATCAAGCGAATATTGACGTCAGCGAGTCTATGAATTC
AAAACACCAAGAGATTTTGGCCGAGAACGAGCAGCTGCGAGTTCGAATGG
AAGAAATCGAGCAACTCTGCCAAGACGTAATGGAAGAGAATGACATGTTG
AAGGAAGAACAAGAAGAAATGCAAAGGGAAATCGAAGAAATGCATGATCA
TTTTCAAGAAGACGATACGGATACGTTAAGGGAACTTAAGCGAGATCTGG
AAACGTCAAATAAAAACTGCCGAATATTCCAGTTCAAACTTAGAAAAACT
GAAAGGCGGTATGAGCAATGTGAAAATGAAAGAGGGATCTTGGAGGAAAA
GCTCAACCGATTAGAAGCTCAATTATATAGTGAAAACGATGTTAACTTAA
TCAGAGGCCTTGAAGAAGAGCTTCGTGTAGCAAAGGAAGTGTCTGTAAGA
CTCAATAGTGAATTGGAGCTAGTCGATGAAAAACGTTCATATTTCGAAGA
AGACAATAAACATTTAAAAGAAGAACTGAAAGATTCAGAAACAAGAAGAA
GAAGCCTGGAAGCAGAGCTTTCCAAATGCCGACAGGAAATTGAAAAACTC
AAATCCCTTGATTCTTCTGGAGCTCTTCAAATTCCAGACACAGCCTCAAA
GCGTAAAAACCGAAATCTCGAATCACTGAGTAGAGAACCAAGCTTCGAAG
AACAAAGTTTACAGAGGGAGTTAGACGCAGCTAAAGAAAGAGAAACCGAT
CTAACAGAGCAACTGAAATTTGCAGAAGACGACATTCGAAAATTAAAAAG
GAGATTTAATGATATTGAGGAGGAAAATGATTCTCTTTCTAAGAAACTCG
AAACAATAATGAAATCAACAAATATAGAAGATAACGAATTCGATGACAAC
GCTTCGGTGCGAGCATTGAAAATCCAAGTCGAGCTCCTTGAGCAACAGAA
CAGCACTCTAAGAAAGAAATTTGTTTCCATAGAAAAAGAAAATATTAATC
TGTCCAACGAACTACGCCAAGCCAAAGCGAAATCAAATTCAGGTACGGAA
AAATCAGATGACACTCTAAAAGATGAAAAATATAAACTACTAGAACAAAA
AATTAACGACTTACATTCTGACGTAGAAAGATTGGAAAAAGAAAACCGGC
GGTTGACATTATTGAATAGTTTACAGCAAGCAGCGCCTGGTATCAAACCT
AAAGTCTCTCAACCTCCGTATCCAGTCGAAACTACGACAGACTTCATCCA
GAATGTTCAAATTCAAGATTTAAAATCGGAATGTAATCGGCTGAAAGAAC
AAATCAAACAGTACGACAAACAGATCAAAGCCATCATGTCCCAGATCGAG
CAACAATACGGATCACATTTAACTGACAAAAAACAACTTGAATATTTATC
TAAATACAACGAAACCATAAACACTTGTCGGACGCAAGAAAAGCAAATAA
TGCAGCTTAATAAACAAATTGAAGGACTTAAAGAAGACATCTGCAAATAC
AAAGAATTTTACGACAAGAATTATAAATCAGACCTTAAGTCAACGAAATT
TGGTCGGGGTGACGCCAAATCTGATTTAGAAAGTGCCAGTAAATCTGTCT
TATTGGAAGAAATTATATGCCTTGAAGATGAAATAGATGAACTGGCTTCA
AAATGCGAGAAAACTGAGTTTAAAGTGTCAGATTTATCGAAAACAATTTT
AGAAAAAGATAGTATTATTGAAGAAATGATTTCGGATAATGGGAGAAGGG
AAAAGGAACTGAATAACTATATTGAGCAATTGCTGACCAAAAATACATTG
CTCAGCGATCTACTCAGTTGCGTTGAAACAAGAGCAAATGAGCTACAACA
ACAATTTGACAGAATGGTAAGTCCAGACGAGTCAGTTGACAGCAGTAACA
GGAGCAGCACTACGACAACTACTACGACAACTAATACAGAAAACGGATCT
GCAAGTGTCCGTGCTACCAACCAAGGTAAAACTTGCCAATTCAGTGCCGG
AAGTGATGACGTGTTCAATGAACATTACGGTTATCAAATCGATGCCCCCG
GCAATTTGAATGATGCAGAGAAAATTAAATTCCGATTCACTTGTCTGGAG
AGACTATTATCAGAGGAACGCAAGCGAACTAGAATAGCGGAAAAACAGGC
GGAAATGGCATTGAAAGACAGCGTGCACTCAAGAGTGAATGAGGACAGTC
AGCTTAAAAAGAAAGAAATAGAAATGCTAAAAACTGATTTGGAAGAGAAA
AATGAAATGCTTGAAGAAAAGGAACAACATATTCAAGATTTGAAAAACCG
ATTGGATCAGACGAGAAAAATGAATGAAGCTCTCAGAACATTGTTAGATA
AACAAGACGAAGGGGTCTCATCTAGCTCACTAAAGACCAAAGATGGGTCA
AATAAAGAACAATCCATTGAAATCAGCAGCTACAAGAAAGAGGTTTCTGC
ATTGAAAAATGATATTCATCAATACGCCATCAAAATTAGTGAATCCGAAA
AGATTCGTGAGAAACTGGCAAAAGAAATTCGAAACTTGCAAGCAGAAATG
AAAGTTAGAGAAGAACAAATTTATGAACAGGACGACGAGATGCGAGCGAA
AGATCAAGAATTGAGAACTGTGAAGAGATTACTTGATGAAACGCAAAATA
CTCTCAAATCTCAAGCACAATCAAATAACATCACAAAAGATATAGAGGAG
AAAATCCAAAAAAATGGAGAATTAATAAATAAAGTTGAAGAATTAAATAA
GACCTTACAAAAATATAAAACTCAAATTGAAGAGAGAGAAATTGAAAAAA
AACAATGGGAAACTCAGCAGAAAATTCTCACAGATTCGATTACGACCAGA
GATGAAAGGATACAAGAAAAAGATGACCTCATTAATCATCTAAATCAACG
ACTCCAAAATCGTGAGAAAGAACTTACCGACTTTGATATTCTTATTTCTC
AGACGAACGAAAAGCTAGAAAAGAACCAAGAAATCATCAAAAACACCCAA
ATGCTACTCTCAAAAAAAGATGTCGACTTTGAGTCGTTGAAGGCGAAAAC
TGATGACTTACAAACCAGTTACGACAACATTACTGGGAATCTGCATTCTG
TAAGAAAAGAAAATGAAAAGCTGAAAACCAAAATAGCTGAATTTGAAAAA
GAGAAATCAAAGCCTCCGCCGGTTCCGAGAATTTCGACTAGCAGTGCAGT
TGATGTTGACAAACTGAAAATGGAAATATCTCAACTTAAAAAGGATAAGG
AAAATTTAACGACCATGCTGAACAAAGACAAAGTCTCATTTTCAGCTGCT
CGTAGAGATTCCGAAACTGCTAAAACTGAATCCGATTCCTACATGAAGGC
AATTCAACACCAGCAATACGTGACCAGAGTGAACTTGCTGACTGATAATG
TCACAAGGCTCAACAGAATCAACATTGAATTGAAGCTACAAAATGAAGCC
ATTCAAAACAATATGCTTGAATACCAGAGAAAATACAAAAACATCAAGGA
ACAATATGAAAATGAACAAGAATCGTGGACAACCGAAAGAATCACTTTGA
CCTCGAGAATGAAAGAATACGAGGACCGAAAATCAGTTATCACAAGTTTA
AGGAAATCCTTACAAGAAGTTAGCATAAAGGTTGCGAACCTCGAGAGCCA
ATTGAGTAAAGAAAAACAAGAATCAGAACAGAAAATTGAGGAAATTACCA
AATTTAAAAATGAATTGCAGAAAAAGTTATCTACATATGAAGATCAACAG
AAATTACCGAAGGTTCTTCAAAGATTTGGCGGGAAAATGACAACCCGAAC
CACAACAGAATCGCAACTGGACAAAGAAAAAGCCGAGCTGAAAGTTCGTC
TAGAAGCAGCTGACAAATTAATAAGCAAATTAAGGGGAGATATCATAGAG
AAAGACGAAAGATTTAGTCACGATAAAATTGAGTTGCTCAAAAGGTCCGA
AGAAACTAGAATTAATCTTGAATTGATGATTCAAAATCTCACAGATCAAT
TAGTGGATATGGAGGGGTGCAAAGAACAATTGTTCATGATGAAAGAGAGA
CTGTTTGTTGTTGAGGAGTCACTTGAAAGAGACAAAAAAGTATGGAATGA
AGAAAGAATGATGCTTCAATTCAAAATCGAAGACAACAGAATGATAATAG
AAACTTGGCTGACTAAAATTCGCGAAGAAGACACAAACAGTAACTCTTTG
CAAAACGAAGTGATTGCAAACCTTGAGAAAGATATTGAAAAATATTTATA
TTCGAAAGACTCGGTTCCATATTCTCATATGAGGAGAAAGAATGATCAAG
AATCGTTGGACCTATTGTATTGTTGCGAACCTAGGATTCAAGTGCCATCG
TCTCAAAATGATTCAGCGATCGGCTCAATGCCATCAAGTCCTGCGTCAAG
TCTAATTGGTAAATCACCATTTAAGTCCATATCATTGGACTGGACAAACC
GAATGACCCGATCTCAACTGACCCCTGAAATTTCCAGTAGCAATCAGTCT
ATAAACACCAGTCAATTCTTTCGAAACAATCGATCAGTTTCACCCGATCA
TTCAAGATCTACCAGCATTACTAGAAAAATAACCAACTATCCAGACCCAA
CTCCAGGATTCATGCTTAAGCCATCATCTAGACAGAGTTCAGTGGAATCT
GTGAGCAAAGATCCCACTGATTATACTTCGAGATCATTTACACTTCCAGG
TTTAAGAAACAATCATAATGCTAGCAGAATCTCTCCAGCGAGACAGAAAT
TCTTCGAATTAACTGATTCCAAACCATCGCCGAAAACCGAGGAAAAAACG
ATCCAAGATGAAAAATCTGGTTCCACATTAACCATACCATCAATCACATC
TGAAATCAACAGGCTCATTGAATGTGCAGATCAAGTAAAAATTCCAGAAT
CCAAATCAGATAATGCAAAGACAAAAGCTGAAAAGCCAGCAGCATCCTCG
TCATTATCATCAGCATTAACAACAACGACAACCACAACAACACCAATATC
ACCGACATCTGTAACCACAACAACGACGGCAAAGCTTCCAATCGACAATT
TCAACAAATCAGAACCGATTCAAAAGCCAATCAAATCAAAGTCAACCTCA
ATAGCGCCGTCAATTCAACAATTACGAAAGAAATTTGCCCAAAAATCCAC
GAATTCTTCCAGTTTTGATGGTTCAAATTCACAGAAATTGTAAATTGAAA
AATGGTTTCATCTTACGTAATTTTGTGTGCATGATAAATACACTGATTTA
CAAATAGCAAATGTATTCACGGTGACTCTCCATCGCAATGTATCCGCTAA
TATCTGCTGGATTGTCAGCTAGAGTTTGTAAGTAGCTAATGTAGGTTGAA
AAATGTTTCTTAAAGATGTGCATTTTATTGTTTTAAACGTTTGACAGTGG
AAATATATTTTACTTTTTCTG
back to top

protein sequence of SMED30011827-orf-1

>SMED30011827-orf-1 ID=SMED30011827-orf-1|Name=SMED30011827-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1965bp
MASNNNRARDGSGALTKKKECYTFEPQQWRRTVCKNCFRSLPDHPTEPSA
GSGNNGKGISPRTSPLLGTKSVNAATPQLTAISGISKDPVLRKGETSPNN
RRRPKSDEFKQKTPSPRESKRTMGSNTGRRSPANSPSSSVTRHSGSFSAN
RQNSTSSIDTKYVEELENDFFDLEDKYDEISKEKAELEKELMEKTHLNED
FLEDIEAYKNKTIHLERRIQHLDEEVRNYRERLKLPESDQANIDVSESMN
SKHQEILAENEQLRVRMEEIEQLCQDVMEENDMLKEEQEEMQREIEEMHD
HFQEDDTDTLRELKRDLETSNKNCRIFQFKLRKTERRYEQCENERGILEE
KLNRLEAQLYSENDVNLIRGLEEELRVAKEVSVRLNSELELVDEKRSYFE
EDNKHLKEELKDSETRRRSLEAELSKCRQEIEKLKSLDSSGALQIPDTAS
KRKNRNLESLSREPSFEEQSLQRELDAAKERETDLTEQLKFAEDDIRKLK
RRFNDIEEENDSLSKKLETIMKSTNIEDNEFDDNASVRALKIQVELLEQQ
NSTLRKKFVSIEKENINLSNELRQAKAKSNSGTEKSDDTLKDEKYKLLEQ
KINDLHSDVERLEKENRRLTLLNSLQQAAPGIKPKVSQPPYPVETTTDFI
QNVQIQDLKSECNRLKEQIKQYDKQIKAIMSQIEQQYGSHLTDKKQLEYL
SKYNETINTCRTQEKQIMQLNKQIEGLKEDICKYKEFYDKNYKSDLKSTK
FGRGDAKSDLESASKSVLLEEIICLEDEIDELASKCEKTEFKVSDLSKTI
LEKDSIIEEMISDNGRREKELNNYIEQLLTKNTLLSDLLSCVETRANELQ
QQFDRMVSPDESVDSSNRSSTTTTTTTTNTENGSASVRATNQGKTCQFSA
GSDDVFNEHYGYQIDAPGNLNDAEKIKFRFTCLERLLSEERKRTRIAEKQ
AEMALKDSVHSRVNEDSQLKKKEIEMLKTDLEEKNEMLEEKEQHIQDLKN
RLDQTRKMNEALRTLLDKQDEGVSSSSLKTKDGSNKEQSIEISSYKKEVS
ALKNDIHQYAIKISESEKIREKLAKEIRNLQAEMKVREEQIYEQDDEMRA
KDQELRTVKRLLDETQNTLKSQAQSNNITKDIEEKIQKNGELINKVEELN
KTLQKYKTQIEEREIEKKQWETQQKILTDSITTRDERIQEKDDLINHLNQ
RLQNREKELTDFDILISQTNEKLEKNQEIIKNTQMLLSKKDVDFESLKAK
TDDLQTSYDNITGNLHSVRKENEKLKTKIAEFEKEKSKPPPVPRISTSSA
VDVDKLKMEISQLKKDKENLTTMLNKDKVSFSAARRDSETAKTESDSYMK
AIQHQQYVTRVNLLTDNVTRLNRINIELKLQNEAIQNNMLEYQRKYKNIK
EQYENEQESWTTERITLTSRMKEYEDRKSVITSLRKSLQEVSIKVANLES
QLSKEKQESEQKIEEITKFKNELQKKLSTYEDQQKLPKVLQRFGGKMTTR
TTTESQLDKEKAELKVRLEAADKLISKLRGDIIEKDERFSHDKIELLKRS
EETRINLELMIQNLTDQLVDMEGCKEQLFMMKERLFVVEESLERDKKVWN
EERMMLQFKIEDNRMIIETWLTKIREEDTNSNSLQNEVIANLEKDIEKYL
YSKDSVPYSHMRRKNDQESLDLLYCCEPRIQVPSSQNDSAIGSMPSSPAS
SLIGKSPFKSISLDWTNRMTRSQLTPEISSSNQSINTSQFFRNNRSVSPD
HSRSTSITRKITNYPDPTPGFMLKPSSRQSSVESVSKDPTDYTSRSFTLP
GLRNNHNASRISPARQKFFELTDSKPSPKTEEKTIQDEKSGSTLTIPSIT
SEINRLIECADQVKIPESKSDNAKTKAEKPAASSSLSSALTTTTTTTTPI
SPTSVTTTTTAKLPIDNFNKSEPIQKPIKSKSTSIAPSIQQLRKKFAQKS
TNSSSFDGSNSQKL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
PLANA:0000418head
PLANA:0000428musculature system
PLANA:0000478pharynx musculature
PLANA:0003116parenchymal cell
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 595..629
NoneNo IPR availableCOILSCoilCoilcoord: 1035..1097
NoneNo IPR availableCOILSCoilCoilcoord: 964..1015
NoneNo IPR availableCOILSCoilCoilcoord: 1188..1208
NoneNo IPR availableCOILSCoilCoilcoord: 703..730
NoneNo IPR availableCOILSCoilCoilcoord: 1132..1173
NoneNo IPR availableCOILSCoilCoilcoord: 655..682
NoneNo IPR availableCOILSCoilCoilcoord: 163..232
NoneNo IPR availableCOILSCoilCoilcoord: 1511..1531
NoneNo IPR availableCOILSCoilCoilcoord: 1303..1323
NoneNo IPR availableCOILSCoilCoilcoord: 368..388
NoneNo IPR availableCOILSCoilCoilcoord: 403..437
NoneNo IPR availableCOILSCoilCoilcoord: 765..792
NoneNo IPR availableCOILSCoilCoilcoord: 1547..1567
NoneNo IPR availableCOILSCoilCoilcoord: 1431..1483
NoneNo IPR availableCOILSCoilCoilcoord: 331..358
NoneNo IPR availableCOILSCoilCoilcoord: 1258..1285
NoneNo IPR availableCOILSCoilCoilcoord: 253..305
NoneNo IPR availableCOILSCoilCoilcoord: 1368..1409
NoneNo IPR availableCOILSCoilCoilcoord: 468..523
NoneNo IPR availableCOILSCoilCoilcoord: 537..578
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 118..159
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1822..1838
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1923..1964
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 94..117
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 853..890
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 44..159
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1725..1761
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1868..1916
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 442..469
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1015..1039
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1820..1847
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1868..1964
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..20
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 47..85
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 451..469
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1019..1039
NoneNo IPR availablePANTHERPTHR15742UNCHARACTERIZEDcoord: 92..1174