RING-type domain-containing protein

Overview
NameRING-type domain-containing protein
Smed IDSMED30011825
Length (bp)1501
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of RING-type domain-containing protein (SMED30011825) t-SNE clustered cells

Violin plots show distribution of expression levels for RING-type domain-containing protein (SMED30011825) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of RING-type domain-containing protein (SMED30011825) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for RING-type domain-containing protein (SMED30011825) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011825

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30011825h1SMcG0016124 dd_Smed_v4_12211_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30011825h1SMcG0016124 dd_Smed_v6_12211_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of RING-type domain-containing protein vs. Ensembl Human
Match: TRIM3 (tripartite motif containing 3 [Source:HGNC Symbol;Acc:HGNC:10064])

HSP 1 Score: 48.9062 bits (115), Expect = 7.076e-7
Identity = 28/86 (32.56%), Postives = 43/86 (50.00%), Query Frame = 3
Query:  255 EDLTKSEIIDKLGEILECSIHHGIMTNPKMLSCQHTFCYKCIKDYFKIIQPLLICPICRREENV--DGVEKLPPSYIHNKLMEILK 506
            ED    E+     + L CSI       PK+L C HTFC +C+++Y       L CP+CR+   +   GV  L  ++  + LME ++
Sbjct:    5 EDSPGPEVQPMDKQFLVCSICLDRYQCPKVLPCLHTFCERCLQNYIPAQSLTLSCPVCRQTSILPEQGVSALQNNFFISSLMEAMQ 90          
BLAST of RING-type domain-containing protein vs. Ensembl Human
Match: TRIM2 (tripartite motif containing 2 [Source:HGNC Symbol;Acc:HGNC:15974])

HSP 1 Score: 48.521 bits (114), Expect = 2.514e-6
Identity = 29/78 (37.18%), Postives = 43/78 (55.13%), Query Frame = 3
Query:  279 IDKLGEILECSIHHGIMTNPKMLSCQHTFCYKCIKDYFKIIQPLLICPICRREENVD--GVEKLPPSYIHNKLMEILK 506
            IDK  + L CSI      NPK+L C HTFC +C+++Y       L CP+CR+   +   GV  L  ++    LM++L+
Sbjct:   16 IDK--QFLICSICLERYKNPKVLPCLHTFCERCLQNYIPAHSLTLSCPVCRQTSILPEKGVAALQNNFFITNLMDVLQ 91          
BLAST of RING-type domain-containing protein vs. Ensembl Human
Match: TRIM2 (tripartite motif containing 2 [Source:HGNC Symbol;Acc:HGNC:15974])

HSP 1 Score: 48.521 bits (114), Expect = 2.514e-6
Identity = 29/78 (37.18%), Postives = 43/78 (55.13%), Query Frame = 3
Query:  279 IDKLGEILECSIHHGIMTNPKMLSCQHTFCYKCIKDYFKIIQPLLICPICRREENVD--GVEKLPPSYIHNKLMEILK 506
            IDK  + L CSI      NPK+L C HTFC +C+++Y       L CP+CR+   +   GV  L  ++    LM++L+
Sbjct:   16 IDK--QFLICSICLERYKNPKVLPCLHTFCERCLQNYIPAHSLTLSCPVCRQTSILPEKGVAALQNNFFITNLMDVLQ 91          
BLAST of RING-type domain-containing protein vs. Ensembl Human
Match: TRIM2 (tripartite motif containing 2 [Source:HGNC Symbol;Acc:HGNC:15974])

HSP 1 Score: 48.1358 bits (113), Expect = 3.261e-6
Identity = 29/78 (37.18%), Postives = 43/78 (55.13%), Query Frame = 3
Query:  279 IDKLGEILECSIHHGIMTNPKMLSCQHTFCYKCIKDYFKIIQPLLICPICRREENVD--GVEKLPPSYIHNKLMEILK 506
            IDK  + L CSI      NPK+L C HTFC +C+++Y       L CP+CR+   +   GV  L  ++    LM++L+
Sbjct:   16 IDK--QFLICSICLERYKNPKVLPCLHTFCERCLQNYIPAHSLTLSCPVCRQTSILPEKGVAALQNNFFITNLMDVLQ 91          
BLAST of RING-type domain-containing protein vs. Ensembl Human
Match: TRIM2 (tripartite motif containing 2 [Source:HGNC Symbol;Acc:HGNC:15974])

HSP 1 Score: 50.8322 bits (120), Expect = 5.529e-6
Identity = 29/78 (37.18%), Postives = 43/78 (55.13%), Query Frame = 3
Query:  279 IDKLGEILECSIHHGIMTNPKMLSCQHTFCYKCIKDYFKIIQPLLICPICRREENV--DGVEKLPPSYIHNKLMEILK 506
            IDK  + L CSI      NPK+L C HTFC +C+++Y       L CP+CR+   +   GV  L  ++    LM++L+
Sbjct:   16 IDK--QFLICSICLERYKNPKVLPCLHTFCERCLQNYIPAHSLTLSCPVCRQTSILPEKGVAALQNNFFITNLMDVLQ 91          
BLAST of RING-type domain-containing protein vs. Ensembl Celegans
Match: nhl-1 (RING finger protein nhl-1 [Source:UniProtKB/Swiss-Prot;Acc:Q03601])

HSP 1 Score: 60.8474 bits (146), Expect = 1.827e-9
Identity = 29/76 (38.16%), Postives = 42/76 (55.26%), Query Frame = 3
Query:  279 IDKLGEILECSIHHGIMTNPKMLSCQHTFCYKCIKDYFKIIQPLLICPICRREENV--DGVEKLPPSYIHNKLMEI 500
            ++K+ ++L C I       PK+L CQHTFCY C++     +   L CP CR E N+  DGV+   P+Y     +EI
Sbjct:   34 LEKIEQLLTCPICLDRYKQPKLLPCQHTFCYPCLESCADTLHRNLKCPECRAEHNIPYDGVKAFQPNYTLTGFLEI 109          
BLAST of RING-type domain-containing protein vs. Ensembl Celegans
Match: nhl-1 (RING finger protein nhl-1 [Source:UniProtKB/Swiss-Prot;Acc:Q03601])

HSP 1 Score: 60.4622 bits (145), Expect = 1.874e-9
Identity = 29/76 (38.16%), Postives = 42/76 (55.26%), Query Frame = 3
Query:  279 IDKLGEILECSIHHGIMTNPKMLSCQHTFCYKCIKDYFKIIQPLLICPICRREENV--DGVEKLPPSYIHNKLMEI 500
            ++K+ ++L C I       PK+L CQHTFCY C++     +   L CP CR E N+  DGV+   P+Y     +EI
Sbjct:   34 LEKIEQLLTCPICLDRYKQPKLLPCQHTFCYPCLESCADTLHRNLKCPECRAEHNIPYDGVKAFQPNYTLTGFLEI 109          
BLAST of RING-type domain-containing protein vs. Ensembl Zebrafish
Match: trim2a (tripartite motif containing 2a [Source:ZFIN;Acc:ZDB-GENE-050327-99])

HSP 1 Score: 53.9138 bits (128), Expect = 3.500e-7
Identity = 31/78 (39.74%), Postives = 43/78 (55.13%), Query Frame = 3
Query:  279 IDKLGEILECSIHHGIMTNPKMLSCQHTFCYKCIKDYFKIIQPLLICPICRREENV--DGVEKLPPSYIHNKLMEILK 506
            IDK  + L CSI      NPK+L C HTFC +C+++Y       L CP+CR+   +   GV  L  ++    LME+LK
Sbjct:   16 IDK--QFLICSICLDRYNNPKVLPCLHTFCERCLQNYIPSHSLTLSCPVCRQTSILPEKGVAALQSNFFITNLMEVLK 91          
BLAST of RING-type domain-containing protein vs. Ensembl Zebrafish
Match: trim59 (tripartite motif containing 59 [Source:ZFIN;Acc:ZDB-GENE-060724-2])

HSP 1 Score: 51.2174 bits (121), Expect = 1.912e-6
Identity = 28/75 (37.33%), Postives = 42/75 (56.00%), Query Frame = 3
Query:  276 IIDKLGEILECSIHHGIMTNPKMLSCQHTFCYKCIKDY------FKIIQPL---LICPICRR--EENVDGVEKLP 467
            ++D L E L CS+ + + T+P++L C HTFC  C++        F I +PL   L CP CR   E   +G++ LP
Sbjct:   19 VMDSLEEDLTCSVCYALFTDPRVLPCSHTFCKSCLESVLQVSVNFSIWRPLRLPLKCPNCRSVVELPTNGLDALP 93          
BLAST of RING-type domain-containing protein vs. Ensembl Zebrafish
Match: trim3b (tripartite motif containing 3b [Source:ZFIN;Acc:ZDB-GENE-070112-1132])

HSP 1 Score: 51.2174 bits (121), Expect = 2.233e-6
Identity = 30/78 (38.46%), Postives = 43/78 (55.13%), Query Frame = 3
Query:  279 IDKLGEILECSIHHGIMTNPKMLSCQHTFCYKCIKDYFKIIQPLLICPICRREENV--DGVEKLPPSYIHNKLMEILK 506
            IDK  + L CSI      NPK+L C HTFC +C+++Y       L CP+CR+   +   GV  L  ++    LME+L+
Sbjct:   20 IDK--QFLVCSICLDHYHNPKVLPCLHTFCERCLQNYIPPQSLTLSCPVCRQTSILPEKGVAALQNNFFITNLMEVLQ 95          
BLAST of RING-type domain-containing protein vs. Ensembl Zebrafish
Match: trim3b (tripartite motif containing 3b [Source:ZFIN;Acc:ZDB-GENE-070112-1132])

HSP 1 Score: 51.2174 bits (121), Expect = 2.332e-6
Identity = 30/78 (38.46%), Postives = 43/78 (55.13%), Query Frame = 3
Query:  279 IDKLGEILECSIHHGIMTNPKMLSCQHTFCYKCIKDYFKIIQPLLICPICRREENV--DGVEKLPPSYIHNKLMEILK 506
            IDK  + L CSI      NPK+L C HTFC +C+++Y       L CP+CR+   +   GV  L  ++    LME+L+
Sbjct:   20 IDK--QFLVCSICLDHYHNPKVLPCLHTFCERCLQNYIPPQSLTLSCPVCRQTSILPEKGVAALQNNFFITNLMEVLQ 95          
BLAST of RING-type domain-containing protein vs. Ensembl Zebrafish
Match: trim3a (tripartite motif containing 3a [Source:ZFIN;Acc:ZDB-GENE-080522-4])

HSP 1 Score: 50.8322 bits (120), Expect = 2.947e-6
Identity = 30/78 (38.46%), Postives = 43/78 (55.13%), Query Frame = 3
Query:  279 IDKLGEILECSIHHGIMTNPKMLSCQHTFCYKCIKDYFKIIQPLLICPICRREENV--DGVEKLPPSYIHNKLMEILK 506
            IDK  + L CSI      NPK+L C HTFC +C+++Y       L CP+CR+   +   GV  L  ++    LME+L+
Sbjct:   20 IDK--QFLVCSICLEHYHNPKVLPCLHTFCERCLQNYIPPQSLTLSCPVCRQTSILPEKGVAALQNNFFITNLMEVLQ 95          
BLAST of RING-type domain-containing protein vs. Ensembl Xenopus
Match: actr6 (ARP6 actin related protein 6 homolog [Source:Xenbase;Acc:XB-GENE-5860964])

HSP 1 Score: 51.2174 bits (121), Expect = 3.599e-6
Identity = 29/78 (37.18%), Postives = 43/78 (55.13%), Query Frame = 3
Query:  279 IDKLGEILECSIHHGIMTNPKMLSCQHTFCYKCIKDYFKIIQPLLICPICRREENV--DGVEKLPPSYIHNKLMEILK 506
            IDK  + L CSI      NPK+L C HTFC +C+++Y       L CP+CR+   +   GV  L  ++    LM++L+
Sbjct:   29 IDK--QFLICSICLDRYKNPKVLPCLHTFCERCLQNYIPAHSLTLSCPVCRQTSILPEKGVSALQNNFFITNLMDVLQ 104          
BLAST of RING-type domain-containing protein vs. Ensembl Xenopus
Match: actr6 (ARP6 actin related protein 6 homolog [Source:Xenbase;Acc:XB-GENE-5860964])

HSP 1 Score: 51.2174 bits (121), Expect = 3.635e-6
Identity = 29/78 (37.18%), Postives = 43/78 (55.13%), Query Frame = 3
Query:  279 IDKLGEILECSIHHGIMTNPKMLSCQHTFCYKCIKDYFKIIQPLLICPICRREENV--DGVEKLPPSYIHNKLMEILK 506
            IDK  + L CSI      NPK+L C HTFC +C+++Y       L CP+CR+   +   GV  L  ++    LM++L+
Sbjct:   16 IDK--QFLICSICLDRYKNPKVLPCLHTFCERCLQNYIPAHSLTLSCPVCRQTSILPEKGVSALQNNFFITNLMDVLQ 91          
BLAST of RING-type domain-containing protein vs. Ensembl Xenopus
Match: actr6 (ARP6 actin related protein 6 homolog [Source:Xenbase;Acc:XB-GENE-5860964])

HSP 1 Score: 50.8322 bits (120), Expect = 4.102e-6
Identity = 29/78 (37.18%), Postives = 43/78 (55.13%), Query Frame = 3
Query:  279 IDKLGEILECSIHHGIMTNPKMLSCQHTFCYKCIKDYFKIIQPLLICPICRREENV--DGVEKLPPSYIHNKLMEILK 506
            IDK  + L CSI      NPK+L C HTFC +C+++Y       L CP+CR+   +   GV  L  ++    LM++L+
Sbjct:   16 IDK--QFLICSICLDRYKNPKVLPCLHTFCERCLQNYIPAHSLTLSCPVCRQTSILPEKGVSALQNNFFITNLMDVLQ 91          
BLAST of RING-type domain-containing protein vs. Ensembl Mouse
Match: Trim2 (tripartite motif-containing 2 [Source:MGI Symbol;Acc:MGI:1933163])

HSP 1 Score: 48.521 bits (114), Expect = 1.259e-6
Identity = 29/78 (37.18%), Postives = 43/78 (55.13%), Query Frame = 3
Query:  279 IDKLGEILECSIHHGIMTNPKMLSCQHTFCYKCIKDYFKIIQPLLICPICRREENVD--GVEKLPPSYIHNKLMEILK 506
            IDK  + L CSI      NPK+L C HTFC +C+++Y       L CP+CR+   +   GV  L  ++    LM++L+
Sbjct:   16 IDK--QFLICSICLERYKNPKVLPCLHTFCERCLQNYIPAHSLTLSCPVCRQTSILPEKGVAALQNNFFITNLMDVLQ 91          
BLAST of RING-type domain-containing protein vs. Ensembl Mouse
Match: Trim2 (tripartite motif-containing 2 [Source:MGI Symbol;Acc:MGI:1933163])

HSP 1 Score: 50.8322 bits (120), Expect = 3.699e-6
Identity = 29/78 (37.18%), Postives = 43/78 (55.13%), Query Frame = 3
Query:  279 IDKLGEILECSIHHGIMTNPKMLSCQHTFCYKCIKDYFKIIQPLLICPICRREENV--DGVEKLPPSYIHNKLMEILK 506
            IDK  + L CSI      NPK+L C HTFC +C+++Y       L CP+CR+   +   GV  L  ++    LM++L+
Sbjct:   16 IDK--QFLICSICLERYKNPKVLPCLHTFCERCLQNYIPAHSLTLSCPVCRQTSILPEKGVAALQNNFFITNLMDVLQ 91          
BLAST of RING-type domain-containing protein vs. Ensembl Mouse
Match: Trim2 (tripartite motif-containing 2 [Source:MGI Symbol;Acc:MGI:1933163])

HSP 1 Score: 50.8322 bits (120), Expect = 3.699e-6
Identity = 29/78 (37.18%), Postives = 43/78 (55.13%), Query Frame = 3
Query:  279 IDKLGEILECSIHHGIMTNPKMLSCQHTFCYKCIKDYFKIIQPLLICPICRREENV--DGVEKLPPSYIHNKLMEILK 506
            IDK  + L CSI      NPK+L C HTFC +C+++Y       L CP+CR+   +   GV  L  ++    LM++L+
Sbjct:   16 IDK--QFLICSICLERYKNPKVLPCLHTFCERCLQNYIPAHSLTLSCPVCRQTSILPEKGVAALQNNFFITNLMDVLQ 91          
BLAST of RING-type domain-containing protein vs. Ensembl Mouse
Match: Trim2 (tripartite motif-containing 2 [Source:MGI Symbol;Acc:MGI:1933163])

HSP 1 Score: 50.8322 bits (120), Expect = 3.699e-6
Identity = 29/78 (37.18%), Postives = 43/78 (55.13%), Query Frame = 3
Query:  279 IDKLGEILECSIHHGIMTNPKMLSCQHTFCYKCIKDYFKIIQPLLICPICRREENV--DGVEKLPPSYIHNKLMEILK 506
            IDK  + L CSI      NPK+L C HTFC +C+++Y       L CP+CR+   +   GV  L  ++    LM++L+
Sbjct:   16 IDK--QFLICSICLERYKNPKVLPCLHTFCERCLQNYIPAHSLTLSCPVCRQTSILPEKGVAALQNNFFITNLMDVLQ 91          
BLAST of RING-type domain-containing protein vs. Ensembl Mouse
Match: Trim2 (tripartite motif-containing 2 [Source:MGI Symbol;Acc:MGI:1933163])

HSP 1 Score: 50.8322 bits (120), Expect = 3.699e-6
Identity = 29/78 (37.18%), Postives = 43/78 (55.13%), Query Frame = 3
Query:  279 IDKLGEILECSIHHGIMTNPKMLSCQHTFCYKCIKDYFKIIQPLLICPICRREENV--DGVEKLPPSYIHNKLMEILK 506
            IDK  + L CSI      NPK+L C HTFC +C+++Y       L CP+CR+   +   GV  L  ++    LM++L+
Sbjct:   16 IDK--QFLICSICLERYKNPKVLPCLHTFCERCLQNYIPAHSLTLSCPVCRQTSILPEKGVAALQNNFFITNLMDVLQ 91          
BLAST of RING-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q03601|NHL1_CAEEL (RING finger protein nhl-1 OS=Caenorhabditis elegans OX=6239 GN=nhl-1 PE=1 SV=2)

HSP 1 Score: 60.4622 bits (145), Expect = 2.384e-8
Identity = 29/76 (38.16%), Postives = 42/76 (55.26%), Query Frame = 3
Query:  279 IDKLGEILECSIHHGIMTNPKMLSCQHTFCYKCIKDYFKIIQPLLICPICRREENV--DGVEKLPPSYIHNKLMEI 500
            ++K+ ++L C I       PK+L CQHTFCY C++     +   L CP CR E N+  DGV+   P+Y     +EI
Sbjct:   34 LEKIEQLLTCPICLDRYKQPKLLPCQHTFCYPCLESCADTLHRNLKCPECRAEHNIPYDGVKAFQPNYTLTGFLEI 109          
BLAST of RING-type domain-containing protein vs. TrEMBL
Match: A0A267FKZ3 (RING-type domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig014891g1 PE=4 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 3.433e-15
Identity = 75/324 (23.15%), Postives = 147/324 (45.37%), Query Frame = 3
Query:  579 VQQNMVDNSHYQQIYPTEFENVRKIL-SQKNETDFS---LVTANNLNSESSQIVLVDSCTNQITVYST-SGE-STFSIYIDNEIVIPR----YIRVIQNSLYLTG--------------NRKDKGLTVSVFIQSDFHGNVIKRSE--FYVTDSSAFLGFDFNETKNLFYVCMPENKTIQLFDRFLEDYNHCFDLKENSPEFIAFNKQEKQLYISCPLNRRILIYNSET--YKTISTDEI---VPKMIFVTDDEKVLFLDEKANRIIWIKRINDHLLQQQLDLPYLRRDLHIKTFYALSLSMIFIATNDQIFLYQLDQNLSSSNR 1457
            ++ NM  NS Y+ +   +     ++L S + E +     L+   + +++ +++VL++SC+  + VYS+  G+     + I +     R    ++R++   +Y++G                    L+V   +Q D  G V+KR E      D   F GF  +  +    V  P ++ ++ F   L    H F  +   P+++ + ++ K L++SCP    ILI N  T  Y+ ++T +I   VP  I  T D++++F D +  R+ W+ R ++ +  Q+L   +L+    I     L    I + T  +I + +  + L    R
Sbjct:  330 IRHNMKRNSSYK-MKEIDMGTCAELLQSTRGELEIGAAGLLADADGSTDQAELVLLNSCSRSLLVYSSQEGQIKDLPVLIGDSNPGGRLQCHHMRLVNGLVYVSGVAQQQQQQQAADSTGAPTGWLSVVACLQLD--GQVVKRIERPGGSRDEPLFAGFFVDSRRGDMVVAQPSDQKVEFFTPCLGRTGHWFTFENLHPQYVTWTRERKMLWVSCPAEGHILIVNDRTGVYRKLTTTQIFDSVPAHIITTSDKRIIFTDNQRQRLFWVIRRSEFIFVQRLQ--FLQELDEITGIAPLGEDKILVCTRRRICVLKPVRKLRHRKR 648          
BLAST of RING-type domain-containing protein vs. TrEMBL
Match: A0A267DVM9 (RING-type domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig023823g1 PE=4 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 4.086e-15
Identity = 75/324 (23.15%), Postives = 147/324 (45.37%), Query Frame = 3
Query:  579 VQQNMVDNSHYQQIYPTEFENVRKIL-SQKNETDFS---LVTANNLNSESSQIVLVDSCTNQITVYST-SGE-STFSIYIDNEIVIPR----YIRVIQNSLYLTG--------------NRKDKGLTVSVFIQSDFHGNVIKRSE--FYVTDSSAFLGFDFNETKNLFYVCMPENKTIQLFDRFLEDYNHCFDLKENSPEFIAFNKQEKQLYISCPLNRRILIYNSET--YKTISTDEI---VPKMIFVTDDEKVLFLDEKANRIIWIKRINDHLLQQQLDLPYLRRDLHIKTFYALSLSMIFIATNDQIFLYQLDQNLSSSNR 1457
            ++ NM  NS Y+ +   +     ++L S + E +     L+   + +++ +++VL++SC+  + VYS+  G+     + I +     R    ++R++   +Y++G                    L+V   +Q D  G V+KR E      D   F GF  +  +    V  P ++ ++ F   L    H F  +   P+++ + ++ K L++SCP    ILI N  T  Y+ ++T +I   VP  I  T D++++F D +  R+ W+ R ++ +  Q+L   +L+    I     L    I + T  +I + +  + L    R
Sbjct:  322 IRHNMKRNSSYK-MKEIDMGTCAELLQSTRGELEIGAAGLLADADGSTDQAELVLLNSCSRSLLVYSSQEGQIKDLPVLIGDSNPGGRLQCHHMRLVNGLVYVSGVAQQQQQQQAADSTGAPTGWLSVVACLQLD--GQVVKRIERPGGSRDEPLFAGFFVDSRRGDMVVAQPSDQKVEFFTPCLGRTGHWFTFENLHPQYVTWTRERKMLWVSCPAEGHILIVNDRTGVYRKLTTTQIFDSVPAHIITTSDKRIIFTDNQRQRLFWVIRRSEFIFVQRLQ--FLQELDEITGIAPLGEDKILVCTRRRICVLKPVRKLRHRKR 640          
BLAST of RING-type domain-containing protein vs. TrEMBL
Match: A0A267GNM7 (RING-type domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig015500g1 PE=4 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 7.122e-15
Identity = 74/324 (22.84%), Postives = 143/324 (44.14%), Query Frame = 3
Query:  579 VQQNMVDNSHYQQIYPTEFENVRKILSQKNETDFS---LVTANNLNSESSQIVLVDSCTNQITVYSTS-GE-STFSIYIDNEIVIPR----YIRVIQNSLYLTG---------------NRKDKGLTVSVFIQSDFHGNVIKRSE--FYVTDSSAFLGFDFNETKNLFYVCMPENKTIQLFDRFLEDYNHCFDLKENSPEFIAFNKQEKQLYISCPLNRRILIYNSET--YKTISTDEI---VPKMIFVTDDEKVLFLDEKANRIIWIKRINDHLLQQQLDLPYLRRDLHIKTFYALSLSMIFIATNDQIFLYQLDQNLSSSNR 1457
            ++ NM  NS Y+            + S + E +     L+   + +++ +++VL++SC+  + VYS+  G+     + I +     R    ++R++   +Y++G                     L+V   +Q D  G V+KR E      D   F GF  +  +    V  P ++ ++ F   L    H F  +   P+++ + ++ K L++SCP    ILI N  T  Y+ ++T +I   VP  I  T D++++F D +  R+ W+ R ++ +  Q+L   +L+    I     L    I + T  +I + +  + L    R
Sbjct:  324 IRHNMKRNSSYKMKEIDMGACADLLQSTRGELEIGAAGLLADADGSTDQAELVLLNSCSRSLLVYSSQEGQIKDLPVLIGDSNPGGRLQCHHMRLVNGLVYVSGVAQQQQQQQQAADSTGAPTGWLSVVACLQLD--GQVVKRIERPGGSRDEPLFAGFFVDSRRGDMVVAQPSDQKVEFFTPCLGRTGHWFTFENLHPQYVTWTRERKMLWVSCPAEGHILIVNDRTGVYRKLTTTQIFDSVPAHIITTSDKRIIFTDNQRQRLFWVIRRSEFIFVQRLQ--FLQELDEITGIAPLGEDKILVCTRRRICVLKPVRKLRHRKR 643          
BLAST of RING-type domain-containing protein vs. TrEMBL
Match: A0A267ECL9 (RING-type domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig004309g1 PE=4 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 8.378e-14
Identity = 57/248 (22.98%), Postives = 112/248 (45.16%), Query Frame = 3
Query:  723 IVLVDSCTNQITVYSTSGE--STFSIYIDNEIVIPRYIRVIQNSLYLTGNRKDKGLT--VSVFIQSDFHGNVIKRSE----FYVTDSSAFLGFDFNETKNLFYVCMPENKTIQLFDRFLEDYNHCFDLKENSPEFIAFNKQEKQLYISCPLNRRILIYNSET--YKTISTDEI---VPKMIFVTDDEKVLFLDEKANRIIWIKRINDHLLQQQLDLPYLRRDLHIKTFYALSLSMIFIATNDQIFLYQ 1427
            ++L++SC++ + +YS+       F + +    +   Y+      +Y++G       T   S  +     G VI+R E       +D   F GF  +E +    V  P ++ ++     L    H F  +   P  + + ++ + L++SCP    ILI N  T  Y+ ++T +I   VP  I  T D++++F D +  R+ WI R ++ +  Q+L+  +L+    I     L    I + T  +++  +
Sbjct:  354 MILLNSCSHSLLLYSSQDGRLKDFPVVLGGHRMRCYYMTFSNGLVYVSGVVPSDSATRWTSAIVCVQLDGLVIRRLERPGAAAGSDEPLFAGFHVDERRGELVVAQPADQKVEFLTPALARTGHWFTFENLHPHHVTWTRERRMLWVSCPSEGHILIVNDRTGVYRKLTTTQIFDSVPAHIITTSDKRIIFTDNQRQRVFWIIRRSEFIFVQRLE--FLQELADITGIAPLGEDKILVCTKRKLYFLK 599          
BLAST of RING-type domain-containing protein vs. TrEMBL
Match: A0A267DTD7 (RING-type domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig004309g2 PE=4 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 1.376e-13
Identity = 57/248 (22.98%), Postives = 111/248 (44.76%), Query Frame = 3
Query:  723 IVLVDSCTNQITVYSTSGE--STFSIYIDNEIVIPRYIRVIQNSLYLTGNRKDKGLT--VSVFIQSDFHGNVIKRSE----FYVTDSSAFLGFDFNETKNLFYVCMPENKTIQLFDRFLEDYNHCFDLKENSPEFIAFNKQEKQLYISCPLNRRILIYNSET--YKTISTDEI---VPKMIFVTDDEKVLFLDEKANRIIWIKRINDHLLQQQLDLPYLRRDLHIKTFYALSLSMIFIATNDQIFLYQ 1427
            ++L++SC++ + +YS+       F + +    +   Y+      +Y++G       T   S        G VI+R E       +D   F GF  +E +    V  P ++ ++     L    H F  +   P  + + ++ + L++SCP    ILI N  T  Y+ ++T +I   VP  I  T D++++F D +  R+ WI R ++ +  Q+L+  +L+    I     L    I + T  +++  +
Sbjct:  354 MILLNSCSHSLLLYSSQDGRLKDFPVVLGGHRMRCYYMTFTNGLVYVSGVVPSDSATRWTSAIACVQLDGLVIRRLERPGAAAGSDEPLFAGFHVDERRGELVVAQPADQKVEFLTPALARTGHWFTFENLHPHHVTWTRERRMLWVSCPSEGHILIVNDRTGVYRKLTTTQIFDSVPAHIITTSDKRIIFTDNQRQRVFWIIRRSEFIFVQRLE--FLQELADITGIAPLGEDKILVCTKRKLYFLK 599          
BLAST of RING-type domain-containing protein vs. Ensembl Cavefish
Match: trim2a (tripartite motif containing 2 [Source:NCBI gene;Acc:103036279])

HSP 1 Score: 53.9138 bits (128), Expect = 2.881e-7
Identity = 31/78 (39.74%), Postives = 43/78 (55.13%), Query Frame = 3
Query:  279 IDKLGEILECSIHHGIMTNPKMLSCQHTFCYKCIKDYFKIIQPLLICPICRREENV--DGVEKLPPSYIHNKLMEILK 506
            IDK  + L CSI      NPK+L C HTFC +C+++Y       L CP+CR+   +   GV  L  ++    LME+LK
Sbjct:   16 IDK--QFLICSICLDRYDNPKVLPCLHTFCERCLQNYIPAHSLTLSCPVCRQTSILPEKGVAALQSNFFITNLMEVLK 91          
BLAST of RING-type domain-containing protein vs. Ensembl Cavefish
Match: trim2a (tripartite motif containing 2 [Source:NCBI gene;Acc:103036279])

HSP 1 Score: 53.9138 bits (128), Expect = 3.023e-7
Identity = 31/78 (39.74%), Postives = 43/78 (55.13%), Query Frame = 3
Query:  279 IDKLGEILECSIHHGIMTNPKMLSCQHTFCYKCIKDYFKIIQPLLICPICRREENV--DGVEKLPPSYIHNKLMEILK 506
            IDK  + L CSI      NPK+L C HTFC +C+++Y       L CP+CR+   +   GV  L  ++    LME+LK
Sbjct:   16 IDK--QFLICSICLDRYDNPKVLPCLHTFCERCLQNYIPAHSLTLSCPVCRQTSILPEKGVAALQSNFFITNLMEVLK 91          
BLAST of RING-type domain-containing protein vs. Ensembl Cavefish
Match: trim2a (tripartite motif containing 2 [Source:NCBI gene;Acc:103036279])

HSP 1 Score: 53.9138 bits (128), Expect = 3.023e-7
Identity = 31/78 (39.74%), Postives = 43/78 (55.13%), Query Frame = 3
Query:  279 IDKLGEILECSIHHGIMTNPKMLSCQHTFCYKCIKDYFKIIQPLLICPICRREENV--DGVEKLPPSYIHNKLMEILK 506
            IDK  + L CSI      NPK+L C HTFC +C+++Y       L CP+CR+   +   GV  L  ++    LME+LK
Sbjct:   16 IDK--QFLICSICLDRYDNPKVLPCLHTFCERCLQNYIPAHSLTLSCPVCRQTSILPEKGVAALQSNFFITNLMEVLK 91          
BLAST of RING-type domain-containing protein vs. Ensembl Cavefish
Match: trim2a (tripartite motif containing 2 [Source:NCBI gene;Acc:103036279])

HSP 1 Score: 53.9138 bits (128), Expect = 3.023e-7
Identity = 31/78 (39.74%), Postives = 43/78 (55.13%), Query Frame = 3
Query:  279 IDKLGEILECSIHHGIMTNPKMLSCQHTFCYKCIKDYFKIIQPLLICPICRREENV--DGVEKLPPSYIHNKLMEILK 506
            IDK  + L CSI      NPK+L C HTFC +C+++Y       L CP+CR+   +   GV  L  ++    LME+LK
Sbjct:   16 IDK--QFLICSICLDRYDNPKVLPCLHTFCERCLQNYIPAHSLTLSCPVCRQTSILPEKGVAALQSNFFITNLMEVLK 91          
BLAST of RING-type domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000055241.1 (pep primary_assembly:Astyanax_mexicanus-2.0:3:9979781:9985466:1 gene:ENSAMXG00000040777.1 transcript:ENSAMXT00000055241.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 47.3654 bits (111), Expect = 9.582e-7
Identity = 19/63 (30.16%), Postives = 36/63 (57.14%), Query Frame = 3
Query:  264 TKSEIIDKLGEILECSIHHGIMTNPKMLSCQHTFCYKCIKDYFKIIQPL--LICPICRREENV 446
            T +E++ +     +CS+   ++++P  + C H++C +CI+DY+  + P     CP CRR   V
Sbjct:    3 TPAELLSRSPSTKDCSVCLDLLSDPVTVPCGHSYCLRCIRDYWDQMGPAGGCFCPQCRRRFRV 65          
BLAST of RING-type domain-containing protein vs. Ensembl Yeast
Match: PSH1 (E3 ubiquitin ligase targeting centromere-binding protein Cse4p; mediates polyubiquitination and degradation of histone H3 variant Cse4p, preventing its mislocalization to euchromatin independent of Slx5p; ubiquitination of Cse4p may be antagonized by Scm3p [Source:SGD;Acc:S000005415])

HSP 1 Score: 51.2174 bits (121), Expect = 1.747e-7
Identity = 27/63 (42.86%), Postives = 32/63 (50.79%), Query Frame = 3
Query:  246 LFMEDLTKSEIIDKLGEILECSIHHGIMTNPKMLSCQHTFCYKCIKDYFKI-IQPLLICPICR 431
            L   D TK  I+ K+ E L CSI H  M  P M  C H +CY C+  +F    Q  L CP CR
Sbjct:   10 LHQNDGTKDAILYKIIESLVCSICHDYMFVPMMTPCGHNYCYGCLNTWFASNTQKELACPQCR 72          
BLAST of RING-type domain-containing protein vs. Ensembl Nematostella
Match: EDO47642 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLP9])

HSP 1 Score: 57.3806 bits (137), Expect = 9.418e-9
Identity = 27/76 (35.53%), Postives = 42/76 (55.26%), Query Frame = 3
Query:  300 LECSIHHGIMTNPKMLSCQHTFCYKCIK--DYFKIIQPLLICPICRREENV--DGVEKLPPSYIHNKLMEILKLKT 515
            L C   H + T PK+L C HTFC KC+   D        ++CP+CR+   +   GVE LP +++ N  ++ L +K+
Sbjct:   14 LNCRACHKVFTEPKILDCLHTFCQKCLGTHDILGAGTNSIVCPLCRKPTPIPESGVESLPSNFLLNNALDQLSVKS 89          
BLAST of RING-type domain-containing protein vs. Ensembl Nematostella
Match: EDO47311 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMQ9])

HSP 1 Score: 53.5286 bits (127), Expect = 1.352e-7
Identity = 27/77 (35.06%), Postives = 47/77 (61.04%), Query Frame = 3
Query:  282 DKLGEILECSIHHGIMTNPKMLSCQHTFCYKCIKDYFKIIQPLLICPICRREENV---DGVEKLPPSYIHNKLMEIL 503
            +K+ E L CS+       PKML C HTFC +C++   +  +  L+CP CR + +V   + ++KLP ++I N++++ L
Sbjct:   14 EKVREELTCSVCLEQFREPKMLPCFHTFCKECLEKTKQSFRGNLLCPTCRTKTSVTEHEMIQKLPNNFIVNRVLDAL 90          
BLAST of RING-type domain-containing protein vs. Ensembl Nematostella
Match: EDO47715 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLM1])

HSP 1 Score: 51.9878 bits (123), Expect = 4.600e-7
Identity = 28/80 (35.00%), Postives = 45/80 (56.25%), Query Frame = 3
Query:  279 IDKLGE-ILECSIHHGIMTNPKMLSCQHTFCYKCIKDYFKIIQPLLICPICRREENV--DGVEKLPPSYIHNKLMEILKL 509
            +DKL E +L+C I       PK+L C HTFC  C+K   +  + +++CP CR E  V  +GV  L  ++  N +++ L +
Sbjct:    6 VDKLSEHLLKCPICLETYRTPKVLPCLHTFCQHCLKGMIQSGENIIVCPTCRCEVCVPKEGVSALSTNFFINNMLDFLSV 85          
BLAST of RING-type domain-containing protein vs. Ensembl Nematostella
Match: EDO47716 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLM3])

HSP 1 Score: 49.2914 bits (116), Expect = 1.447e-6
Identity = 28/80 (35.00%), Postives = 45/80 (56.25%), Query Frame = 3
Query:  279 IDKLGE-ILECSIHHGIMTNPKMLSCQHTFCYKCIKDYFKIIQPLLICPICRREENV--DGVEKLPPSYIHNKLMEILKL 509
            +DKL E +L+C I       PK+L C HTFC  C+K   +  + +++CP CR E  V  +GV  L  ++  N +++ L +
Sbjct:    6 VDKLSEHLLKCPICLETYRTPKVLPCLHTFCQHCLKGMIQSGENIIVCPTCRCEVCVPKEGVSALSTNFFINNMLDFLSV 85          
BLAST of RING-type domain-containing protein vs. Ensembl Nematostella
Match: EDO37391 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFU8])

HSP 1 Score: 47.3654 bits (111), Expect = 2.287e-6
Identity = 22/59 (37.29%), Postives = 35/59 (59.32%), Query Frame = 3
Query:  297 ILECSIHHGIMTNPKMLSCQHTFCYKCIKDYFKIIQPLLICPICRREENV--DGVEKLP 467
            I++C +      +P++L CQH+FC KC+    K  + L++CP CRRE  +   GV+  P
Sbjct:    4 IIKCPVCLETFDDPRVLPCQHSFCKKCVTGVAKARRGLVVCPQCRRESWLPRKGVKGYP 62          
BLAST of RING-type domain-containing protein vs. Ensembl Medaka
Match: trim3a (tripartite motif-containing protein 3 [Source:NCBI gene;Acc:101175583])

HSP 1 Score: 52.7582 bits (125), Expect = 7.147e-7
Identity = 31/78 (39.74%), Postives = 43/78 (55.13%), Query Frame = 3
Query:  279 IDKLGEILECSIHHGIMTNPKMLSCQHTFCYKCIKDYFKIIQPLLICPICRREENV--DGVEKLPPSYIHNKLMEILK 506
            IDK  + L CSI      NPK+L C HTFC KC+++Y       L CP+CR+   +   GV  L  ++    LME+L+
Sbjct:   20 IDK--QFLVCSICLDRYHNPKVLPCLHTFCEKCLQNYIPPQSLTLSCPVCRQTSILPEKGVAALQNNFFITNLMEVLQ 95          
BLAST of RING-type domain-containing protein vs. Ensembl Medaka
Match: trim3a (tripartite motif-containing protein 3 [Source:NCBI gene;Acc:101175583])

HSP 1 Score: 52.7582 bits (125), Expect = 7.206e-7
Identity = 31/78 (39.74%), Postives = 43/78 (55.13%), Query Frame = 3
Query:  279 IDKLGEILECSIHHGIMTNPKMLSCQHTFCYKCIKDYFKIIQPLLICPICRREENV--DGVEKLPPSYIHNKLMEILK 506
            IDK  + L CSI      NPK+L C HTFC KC+++Y       L CP+CR+   +   GV  L  ++    LME+L+
Sbjct:   20 IDK--QFLVCSICLDRYHNPKVLPCLHTFCEKCLQNYIPPQSLTLSCPVCRQTSILPEKGVAALQNNFFITNLMEVLQ 95          
BLAST of RING-type domain-containing protein vs. Ensembl Medaka
Match: trim2a (tripartite motif containing 2 [Source:NCBI gene;Acc:101163547])

HSP 1 Score: 51.2174 bits (121), Expect = 1.991e-6
Identity = 29/78 (37.18%), Postives = 43/78 (55.13%), Query Frame = 3
Query:  279 IDKLGEILECSIHHGIMTNPKMLSCQHTFCYKCIKDYFKIIQPLLICPICRREENV--DGVEKLPPSYIHNKLMEILK 506
            IDK  + L CSI      NPK+L C HTFC +C+++Y       L CP+CR+   +   GV  L  ++    LM++L+
Sbjct:   16 IDK--QFLICSICLDRYENPKVLPCLHTFCERCLQNYIPAHSLTLSCPVCRQTSILPEKGVAALQSNFFITNLMDVLQ 91          
BLAST of RING-type domain-containing protein vs. Ensembl Medaka
Match: trim2a (tripartite motif containing 2 [Source:NCBI gene;Acc:101163547])

HSP 1 Score: 51.2174 bits (121), Expect = 1.991e-6
Identity = 29/78 (37.18%), Postives = 43/78 (55.13%), Query Frame = 3
Query:  279 IDKLGEILECSIHHGIMTNPKMLSCQHTFCYKCIKDYFKIIQPLLICPICRREENV--DGVEKLPPSYIHNKLMEILK 506
            IDK  + L CSI      NPK+L C HTFC +C+++Y       L CP+CR+   +   GV  L  ++    LM++L+
Sbjct:   16 IDK--QFLICSICLDRYENPKVLPCLHTFCERCLQNYIPAHSLTLSCPVCRQTSILPEKGVAALQSNFFITNLMDVLQ 91          
BLAST of RING-type domain-containing protein vs. Ensembl Medaka
Match: trim2a (tripartite motif containing 2 [Source:NCBI gene;Acc:101163547])

HSP 1 Score: 51.2174 bits (121), Expect = 1.991e-6
Identity = 29/78 (37.18%), Postives = 43/78 (55.13%), Query Frame = 3
Query:  279 IDKLGEILECSIHHGIMTNPKMLSCQHTFCYKCIKDYFKIIQPLLICPICRREENV--DGVEKLPPSYIHNKLMEILK 506
            IDK  + L CSI      NPK+L C HTFC +C+++Y       L CP+CR+   +   GV  L  ++    LM++L+
Sbjct:   16 IDK--QFLICSICLDRYENPKVLPCLHTFCERCLQNYIPAHSLTLSCPVCRQTSILPEKGVAALQSNFFITNLMDVLQ 91          
BLAST of RING-type domain-containing protein vs. Planmine SMEST
Match: SMESG000069649.1 (SMESG000069649.1)

HSP 1 Score: 789.645 bits (2038), Expect = 0.000e+0
Identity = 402/410 (98.05%), Postives = 404/410 (98.54%), Query Frame = 3
Query:  252 MEDLTKSEIIDKLGEILECSIHHGIMTNPKMLSCQHTFCYKCIKDYFKIIQPLLICPICRREENVDGVEKLPPSYIHNKLMEILKLKTKXXXXXXXXXXXXXXXWKIETVQQNMVDNSHYQQIYPTEFENVRKILSQKNETDFSLVTANNLNSESSQIVLVDSCTNQITVYSTSGESTFSIYIDNEIVIPRYIRVIQNSLYLTGNRKDKGLTVSVFIQSDFHGNVIKRSEFYVTDSSAFLGFDFNETKNLFYVCMPENKTIQLFDRFLEDYNHCFDLKENSPEFIAFNKQEKQLYISCPLNRRILIYNSETYKTISTDEIVPKMIFVTDDEKVLFLDEKANRIIWIKRINDHLLQQQLDLPYLRRDLHIKTFYALSLSMIFIATNDQIFLYQLDQNLSSSNRVSPFCNLS 1481
            M+DLTKSEIIDKLGEILECSIHHGIMTNPKMLSCQHTFCYKCIKDYFKIIQPLLICPICRREENVDGVEKLPPSYIHNKLMEILKLKTKSESN DDSDSENDSEWKIETVQQNMVDNSHYQQIY TEFENVR ILSQKNETDFSLVTANNLNSESSQIV VDSCTNQITVYSTSGESTFSIYIDNEIVIPRYIRVIQNSLYLTGNRKDKGLTVSVF+QSDFHGNVIKRSEFYVTDSSAFLGFDFNETKNLFYVCMPENKTIQLFDRFLEDYNHCFDLKENSPEFIAFNKQEKQLYISCPLNRRILIYNSETYKTISTDEIVPKMIFVTDDEKVLFLDEKANRIIWIKRINDHLLQQQL LPYLRRDLHIKTFY LSLSMIFIATNDQIFLYQLDQNLSSSNRVSPFCNLS
Sbjct:    1 MDDLTKSEIIDKLGEILECSIHHGIMTNPKMLSCQHTFCYKCIKDYFKIIQPLLICPICRREENVDGVEKLPPSYIHNKLMEILKLKTKSESNTDDSDSENDSEWKIETVQQNMVDNSHYQQIYLTEFENVRGILSQKNETDFSLVTANNLNSESSQIVFVDSCTNQITVYSTSGESTFSIYIDNEIVIPRYIRVIQNSLYLTGNRKDKGLTVSVFLQSDFHGNVIKRSEFYVTDSSAFLGFDFNETKNLFYVCMPENKTIQLFDRFLEDYNHCFDLKENSPEFIAFNKQEKQLYISCPLNRRILIYNSETYKTISTDEIVPKMIFVTDDEKVLFLDEKANRIIWIKRINDHLLQQQLYLPYLRRDLHIKTFYVLSLSMIFIATNDQIFLYQLDQNLSSSNRVSPFCNLS 410          
BLAST of RING-type domain-containing protein vs. Planmine SMEST
Match: SMESG000069646.1 (SMESG000069646.1)

HSP 1 Score: 207.223 bits (526), Expect = 2.347e-60
Identity = 118/320 (36.88%), Postives = 195/320 (60.94%), Query Frame = 3
Query:  570 IETVQQNMVDNSHYQQIYPTEF----ENVRKILSQKNETDFSLVTAN--NLNSESSQIVLVDSCTNQITVYSTSGESTFSIYIDNEIVIPRYIRVIQNSLYLTGNRKDKGLTV-SVFIQSDFHGNVIKRSEFYV----TDSSAFLGFDFNETKNLFYVCMPENKTIQLFD-RFLEDYNHCFDLKENSPEFIAFNKQEKQLYISCPLNRRILIYN--SETYKTISTDEI---VPKMIFVTDDEKVLFLDEKANRIIWIKRINDHLLQQQLDLPYLRRDLHIKTFYALSLSMIFIATNDQIFLYQLDQNLSSSNRVSPFCNL 1478
            IET+++NM+  S Y+ +         +N+ ++  + ++ +FS+   N    + + S +VLVDS ++Q+ VYS S   TF I + N+I+ P YIR+ Q +L LTG R D+   + S+F+Q    G ++++SE Y+     D    +GFD NE +  +Y+CMP + +++++   F+E + + ++  EN PE+IAF+  + QL+ISCP NRRILI +  S  ++  +T++I   +PKMIFVTDDEK++FLD   NR IWIKR N+++L Q+L+   + RD  IK F  L  S + +   ++I ++Q  +  S S R+   CN 
Sbjct:  202 IETIRENMLKYSQYEVVKRDGVHKICKNIHQLQKESSQFEFSIFDINISATHPKLSHLVLVDSKSHQLLVYSDSNIKTFHIVLKNDIIKPEYIRIYQGNLILTG-RLDRNEEIGSIFLQCSMCGKILRQSELYIWPNTPDLPMMMGFDINEKEEKYYLCMPNSGSVRIYSTNFIESHQY-YEFDENRPEYIAFSSTQNQLWISCPRNRRILILDLDSGIFRLFNTEQINKAIPKMIFVTDDEKIIFLDITGNRFIWIKRRNEYILTQKLNFLSINRDSTIKNFLVLPCSRVTVGVENEILVFQSTKYFSKSRRIFELCNF 519          

HSP 2 Score: 78.1814 bits (191), Expect = 3.638e-15
Identity = 37/82 (45.12%), Postives = 53/82 (64.63%), Query Frame = 3
Query:  267 KSEIID---KLGEILECSIHHGIMTNPKMLSCQHTFCYKCIKDYFKIIQPLLICPICRREENVDGVEKLPPSYIHNKLMEIL 503
            +SE  D   +L EI+ C IH GIM +P+ L CQH FCY C+K+Y KI    LICPICR +E  + ++KLP +    +L+ ++
Sbjct:   39 RSETFDNTRELEEIVTCCIHLGIMNDPRKLFCQHAFCYNCLKEYSKICVD-LICPICRVKEKTNDIDKLPSALTEKQLISVV 119          
BLAST of RING-type domain-containing protein vs. Planmine SMEST
Match: SMESG000020467.1 (SMESG000020467.1)

HSP 1 Score: 97.0561 bits (240), Expect = 3.530e-21
Identity = 75/292 (25.68%), Postives = 139/292 (47.60%), Query Frame = 3
Query:  570 IETVQQNMVDNSHYQQIYPTEFENVRKILSQKNETDFSLVTANNLNSESSQIVLVDSCTNQITVYSTSGE-STFSIYIDNEIVIPRYIRVIQNSLYLTGNRKDKGLTVSVF--IQSDFHGNVIKRSEFYVTD--SSAFLGFDFNETKNLFYVCMPENKTIQLFDRFLEDYNHCFDLKENSPEFIAFNKQEKQLYISCPLNRRILIYNSET--YKTISTDEI---VPKMIFVTDDEKVLFLDEKANRIIWIKRINDHLLQQQLDLPYLRRDLHIKTFYALSLSMIFIATNDQI 1415
            +ET+++NM   S Y+ +       V    S +N+   + +    LN E+  IV      N I V +       F+I ID+  V P ++++  N L+L+G  ++       +  IQS   G +I  S F  +   ++   GF  +       + +P+   I +    L + +H +   +  P FI  N+   +++ SCP + RI+I + ET  Y+ + TD+I   +P  I ++ D +V+FLD + NR+ W+++ ND +L Q+++        H K       +M+ I+  D +
Sbjct:  224 VETIRENMRKYSEYKLLRDVNHSIVNFHSSGRNKMIIADIKL--LNHEAEVIVWTSVHGNLIAVKTPDHSVHDFTIQIDSCEVKPIFLKIYNNDLFLSGYIENSATKEKHYYLIQSSLTGELIHTSVFNSSHDITTKIAGFHIDPGSGKILLAIPDACKIAILTSNLVETSHGYHFTDLHPSFITQNQDTAEIWASCPQDGRIIIIDEETGSYRQLGTDQIYNAIPSHITISGDNRVMFLDCRQNRVFWVRKRNDFILIQRINFI----GHHNKQLNGKMTAMVAISGTDTL 509          

HSP 2 Score: 51.2174 bits (121), Expect = 1.304e-6
Identity = 30/87 (34.48%), Postives = 50/87 (57.47%), Query Frame = 3
Query:  279 IDKLGEILECSIHHGIMTNPKMLSCQHTFCYKCIKDYFKIIQPLL----ICPICRREENVD--GVEKLPPSYIHNKLME-ILKLKTK 518
            + KL +++ C IH G+M +P++L C H FC  C+  Y  +I+  +     CP+CRR   +D   V  LPPS    +L + I++ K++
Sbjct:   45 MSKLEDLIMCPIHLGMMEDPRILPCGHAFCLNCL--YSCLIRMSISVNFSCPVCRRYCEIDQKTVCLLPPSIATKQLTDYIVETKSR 129          
BLAST of RING-type domain-containing protein vs. Planmine SMEST
Match: SMESG000064098.1 (SMESG000064098.1)

HSP 1 Score: 92.4337 bits (228), Expect = 1.204e-19
Identity = 63/221 (28.51%), Postives = 113/221 (51.13%), Query Frame = 3
Query:  783 TFSIYIDNEIVIPRYIRVIQNSLYLTGNRKDKGL-TVSVFIQSDFHGNVIKRSEFYVTDSSAFLGFDFNETKNLFYVCMPENKTIQLFDRFLEDYNHCFDLKENSPEFIAFNKQEKQLYISCPLNRRILIYN--SETYKTISTDEI---VPKMIFVTDDEKVLFLDEKANRIIWIKRINDHLLQQQLDLPYLRRDLHIKTFYALSLSMIFIATNDQIFLYQ 1427
            +F I ++N  + P +I+   N ++++G     GL   S  IQ   +G     S  Y   S  F GF F+ T N  +V  P    + L D  LE     F+    SP F+A + + +++++SCP + RI +Y+  ++ Y  ++T++I    P  I  T D ++LFLD   +R+ WI R N  L  Q +++   + ++ I T  ++S +MI  +  ++ F+ +
Sbjct:  309 SFFISVENSKIFPIFIKCFLNKIFVSGK---IGLDQSSCLIQLSLNGERENISPIY---SGLFGGFCFDLTNNSIFVAYPSRNQVILLDNSLEKELKVFEFGNLSPMFVAISFKTREIWVSCPNDGRIAVYDEMTDNYLHLATNQIYESTPTHIIETLDHRLLFLDVGKSRLFWIFRWNSCLYIQLINVNGSKEEIKINTVQSISENMILFSDGNKTFIAR 523          

HSP 2 Score: 62.7734 bits (151), Expect = 2.966e-10
Identity = 30/96 (31.25%), Postives = 50/96 (52.08%), Query Frame = 3
Query:  234 ILYKLFMEDLTKSEIIDKLGEILECSIHHGIMTNPKMLSCQHTFCYKCIKDY----FKIIQPLLICPICRREENVD--GVEKLPPSYIHNKLMEIL 503
            +  K+F +   +   I+ L ++L C IH G +  P+ L C H FC  C++ Y     +     + CP+CR    +D  G++ L PS++H +L E L
Sbjct:   37 VCSKVFHKSNNEFSSIENLEDLLTCPIHLGAIDEPRQLQCGHVFCLSCLESYASHGLETSPKQICCPLCRNHTQLDHKGIKSLAPSFLHKQLTEYL 132          
BLAST of RING-type domain-containing protein vs. Planmine SMEST
Match: SMESG000064098.1 (SMESG000064098.1)

HSP 1 Score: 92.0485 bits (227), Expect = 1.257e-19
Identity = 63/221 (28.51%), Postives = 113/221 (51.13%), Query Frame = 3
Query:  783 TFSIYIDNEIVIPRYIRVIQNSLYLTGNRKDKGL-TVSVFIQSDFHGNVIKRSEFYVTDSSAFLGFDFNETKNLFYVCMPENKTIQLFDRFLEDYNHCFDLKENSPEFIAFNKQEKQLYISCPLNRRILIYN--SETYKTISTDEI---VPKMIFVTDDEKVLFLDEKANRIIWIKRINDHLLQQQLDLPYLRRDLHIKTFYALSLSMIFIATNDQIFLYQ 1427
            +F I ++N  + P +I+   N ++++G     GL   S  IQ   +G     S  Y   S  F GF F+ T N  +V  P    + L D  LE     F+    SP F+A + + +++++SCP + RI +Y+  ++ Y  ++T++I    P  I  T D ++LFLD   +R+ WI R N  L  Q +++   + ++ I T  ++S +MI  +  ++ F+ +
Sbjct:  300 SFFISVENSKIFPIFIKCFLNKIFVSGK---IGLDQSSCLIQLSLNGERENISPIY---SGLFGGFCFDLTNNSIFVAYPSRNQVILLDNSLEKELKVFEFGNLSPMFVAISFKTREIWVSCPNDGRIAVYDEMTDNYLHLATNQIYESTPTHIIETLDHRLLFLDVGKSRLFWIFRWNSCLYIQLINVNGSKEEIKINTVQSISENMILFSDGNKTFIAR 514          

HSP 2 Score: 63.1586 bits (152), Expect = 2.566e-10
Identity = 30/96 (31.25%), Postives = 50/96 (52.08%), Query Frame = 3
Query:  234 ILYKLFMEDLTKSEIIDKLGEILECSIHHGIMTNPKMLSCQHTFCYKCIKDY----FKIIQPLLICPICRREENVD--GVEKLPPSYIHNKLMEIL 503
            +  K+F +   +   I+ L ++L C IH G +  P+ L C H FC  C++ Y     +     + CP+CR    +D  G++ L PS++H +L E L
Sbjct:   28 VCSKVFHKSNNEFSSIENLEDLLTCPIHLGAIDEPRQLQCGHVFCLSCLESYASHGLETSPKQICCPLCRNHTQLDHKGIKSLAPSFLHKQLTEYL 123          
The following BLAST results are available for this feature:
BLAST of RING-type domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRIM37.076e-732.56tripartite motif containing 3 [Source:HGNC Symbol;... [more]
TRIM22.514e-637.18tripartite motif containing 2 [Source:HGNC Symbol;... [more]
TRIM22.514e-637.18tripartite motif containing 2 [Source:HGNC Symbol;... [more]
TRIM23.261e-637.18tripartite motif containing 2 [Source:HGNC Symbol;... [more]
TRIM25.529e-637.18tripartite motif containing 2 [Source:HGNC Symbol;... [more]
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
nhl-11.827e-938.16RING finger protein nhl-1 [Source:UniProtKB/Swiss... [more]
nhl-11.874e-938.16RING finger protein nhl-1 [Source:UniProtKB/Swiss... [more]
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trim2a3.500e-739.74tripartite motif containing 2a [Source:ZFIN;Acc:ZD... [more]
trim591.912e-637.33tripartite motif containing 59 [Source:ZFIN;Acc:ZD... [more]
trim3b2.233e-638.46tripartite motif containing 3b [Source:ZFIN;Acc:ZD... [more]
trim3b2.332e-638.46tripartite motif containing 3b [Source:ZFIN;Acc:ZD... [more]
trim3a2.947e-638.46tripartite motif containing 3a [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
actr63.599e-637.18ARP6 actin related protein 6 homolog [Source:Xenba... [more]
actr63.635e-637.18ARP6 actin related protein 6 homolog [Source:Xenba... [more]
actr64.102e-637.18ARP6 actin related protein 6 homolog [Source:Xenba... [more]
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Trim21.259e-637.18tripartite motif-containing 2 [Source:MGI Symbol;A... [more]
Trim23.699e-637.18tripartite motif-containing 2 [Source:MGI Symbol;A... [more]
Trim23.699e-637.18tripartite motif-containing 2 [Source:MGI Symbol;A... [more]
Trim23.699e-637.18tripartite motif-containing 2 [Source:MGI Symbol;A... [more]
Trim23.699e-637.18tripartite motif-containing 2 [Source:MGI Symbol;A... [more]
back to top
BLAST of RING-type domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|Q03601|NHL1_CAEEL2.384e-838.16RING finger protein nhl-1 OS=Caenorhabditis elegan... [more]
back to top
BLAST of RING-type domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267FKZ33.433e-1523.15RING-type domain-containing protein OS=Macrostomum... [more]
A0A267DVM94.086e-1523.15RING-type domain-containing protein OS=Macrostomum... [more]
A0A267GNM77.122e-1522.84RING-type domain-containing protein OS=Macrostomum... [more]
A0A267ECL98.378e-1422.98RING-type domain-containing protein OS=Macrostomum... [more]
A0A267DTD71.376e-1322.98RING-type domain-containing protein OS=Macrostomum... [more]
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trim2a2.881e-739.74tripartite motif containing 2 [Source:NCBI gene;Ac... [more]
trim2a3.023e-739.74tripartite motif containing 2 [Source:NCBI gene;Ac... [more]
trim2a3.023e-739.74tripartite motif containing 2 [Source:NCBI gene;Ac... [more]
trim2a3.023e-739.74tripartite motif containing 2 [Source:NCBI gene;Ac... [more]
ENSAMXT00000055241.19.582e-730.16pep primary_assembly:Astyanax_mexicanus-2.0:3:9979... [more]
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
PSH11.747e-742.86E3 ubiquitin ligase targeting centromere-binding p... [more]
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO476429.418e-935.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO473111.352e-735.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO477154.600e-735.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO477161.447e-635.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO373912.287e-637.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trim3a7.147e-739.74tripartite motif-containing protein 3 [Source:NCBI... [more]
trim3a7.206e-739.74tripartite motif-containing protein 3 [Source:NCBI... [more]
trim2a1.991e-637.18tripartite motif containing 2 [Source:NCBI gene;Ac... [more]
trim2a1.991e-637.18tripartite motif containing 2 [Source:NCBI gene;Ac... [more]
trim2a1.991e-637.18tripartite motif containing 2 [Source:NCBI gene;Ac... [more]
back to top
BLAST of RING-type domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000069649.10.000e+098.05SMESG000069649.1[more]
SMESG000069646.12.347e-6036.88SMESG000069646.1[more]
SMESG000020467.13.530e-2125.68SMESG000020467.1[more]
SMESG000064098.11.204e-1928.51SMESG000064098.1[more]
SMESG000064098.11.257e-1928.51SMESG000064098.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011825 ID=SMED30011825|Name=RING-type domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1501bp
GGACATTTTGTCTCAATTCAATTTTTAAGAAATTTTTTTTCATCGATTTT
CAGTTTATTGTCTTTGCTTATTAGAGAAAACGATAATTATGGTAATTAAT
TATCATGATAAATATGTGGCATATCATGCATACATTCAAAATGCTGTGTG
CATCCAGTCAAATACAGTAGCCTTATGACGTATACATTACCTCGATATTG
ATGTTAATATTTTATTAGTTTTGAATACCGAAAATTCTCTACAAATTATT
TATGGAGGATTTAACAAAATCAGAAATAATAGACAAGTTGGGAGAAATCC
TCGAATGTTCTATTCATCACGGAATAATGACCAATCCCAAAATGCTTTCA
TGCCAGCATACATTTTGTTATAAATGTATAAAAGACTATTTTAAAATAAT
TCAACCTCTTTTAATTTGCCCGATATGTAGAAGAGAAGAAAATGTTGATG
GGGTGGAAAAGTTACCTCCGTCGTATATACACAATAAATTGATGGAGATA
TTAAAATTAAAAACAAAATCCGAATCAAATGCTGACGATAGCGACAGCGA
AAATGATTCAGAGTGGAAAATTGAAACCGTACAACAAAATATGGTTGACA
ATTCTCATTATCAACAGATTTATCCAACTGAATTTGAAAATGTTCGTAAG
ATTTTATCACAGAAAAATGAAACTGATTTTTCATTGGTTACTGCAAATAA
CCTAAATTCCGAATCCAGTCAAATTGTATTAGTTGATTCTTGTACCAATC
AAATTACTGTTTATTCCACTTCCGGCGAATCGACTTTCTCCATTTACATT
GACAATGAAATTGTGATTCCTCGGTACATTCGAGTTATTCAAAACAGTTT
ATATTTAACCGGTAACAGAAAAGATAAAGGTCTAACAGTTTCTGTTTTTA
TTCAAAGCGATTTTCATGGAAATGTCATTAAAAGATCAGAATTTTATGTC
ACCGACTCTTCCGCATTTTTAGGATTCGACTTCAACGAAACTAAGAATTT
ATTCTACGTCTGCATGCCGGAAAACAAAACGATTCAATTATTTGATAGAT
TTCTTGAAGATTATAATCATTGTTTCGACCTCAAAGAAAACTCACCGGAA
TTTATTGCTTTCAATAAACAAGAAAAACAGCTCTATATTTCCTGTCCTCT
TAATCGGCGCATTTTGATATATAATTCTGAAACTTATAAAACGATTTCAA
CTGACGAAATTGTGCCGAAAATGATTTTTGTCACCGATGATGAGAAGGTC
TTATTTCTCGATGAGAAAGCAAACAGAATTATTTGGATTAAAAGGATAAA
TGATCATTTGTTACAACAGCAGCTGGATCTGCCGTATTTACGAAGAGATT
TACACATTAAAACATTTTATGCTTTGTCTTTATCAATGATTTTTATTGCT
ACCAATGATCAGATTTTTCTCTATCAATTAGATCAGAATTTATCAAGTTC
TAATAGAGTTTCTCCGTTTTGTAATTTGTCGTAATGTTAAACTTTGATTT
G
back to top

protein sequence of SMED30011825-orf-1

>SMED30011825-orf-1 ID=SMED30011825-orf-1|Name=SMED30011825-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=411bp
MEDLTKSEIIDKLGEILECSIHHGIMTNPKMLSCQHTFCYKCIKDYFKII
QPLLICPICRREENVDGVEKLPPSYIHNKLMEILKLKTKSESNADDSDSE
NDSEWKIETVQQNMVDNSHYQQIYPTEFENVRKILSQKNETDFSLVTANN
LNSESSQIVLVDSCTNQITVYSTSGESTFSIYIDNEIVIPRYIRVIQNSL
YLTGNRKDKGLTVSVFIQSDFHGNVIKRSEFYVTDSSAFLGFDFNETKNL
FYVCMPENKTIQLFDRFLEDYNHCFDLKENSPEFIAFNKQEKQLYISCPL
NRRILIYNSETYKTISTDEIVPKMIFVTDDEKVLFLDEKANRIIWIKRIN
DHLLQQQLDLPYLRRDLHIKTFYALSLSMIFIATNDQIFLYQLDQNLSSS
NRVSPFCNLS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR013083Znf_RING/FYVE/PHD
IPR0110426-blade_b-propeller_TolB-like
IPR017907Znf_RING_CS
IPR001841Znf_RING
Vocabulary: molecular function
TermDefinition
GO:0008270zinc ion binding
GO:0005515protein binding
GO:0004842ubiquitin-protein transferase activity
GO:0016740transferase activity
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
GO:0005737cytoplasm
Vocabulary: biological process
TermDefinition
GO:0016567protein ubiquitination
GO:0043523regulation of neuron apoptotic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR011042Six-bladed beta-propeller, TolB-likeGENE3DG3DSA:2.120.10.30coord: 151..359
e-value: 1.5E-7
score: 32.8
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 3..120
e-value: 1.2E-14
score: 56.1
NoneNo IPR availablePANTHERPTHR25464:SF2E3 UBIQUITIN-PROTEIN LIGASE RNF152coord: 13..148
NoneNo IPR availablePANTHERPTHR25464FAMILY NOT NAMEDcoord: 13..148
NoneNo IPR availableCDDcd16449RING-HCcoord: 19..59
e-value: 1.75302E-9
score: 50.9289
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 11..85
NoneNo IPR availableSUPERFAMILYSSF750113-carboxy-cis,cis-mucoante lactonizing enzymecoord: 152..352
IPR017907Zinc finger, RING-type, conserved sitePROSITEPS00518ZF_RING_1coord: 34..43
IPR001841Zinc finger, RING-typePROSITEPS50089ZF_RING_2coord: 19..60
score: 10.571