slc15a-5

Overview
Nameslc15a-5 (AKN21491.1)
Smed IDSMED30011823
Length (bp)1852
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc15a-5 (SMED30011823) t-SNE clustered cells

Violin plots show distribution of expression levels for slc15a-5 (SMED30011823) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc15a-5 (SMED30011823) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc15a-5 (SMED30011823) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011823

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30011823SMESG000042513.1 PL08001B1H05ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
parenchymal cellSMED30011823SMESG000042513.1 dd_Smed_v4_8178_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc15a-5 vs. Ensembl Human
Match: SLC15A4 (solute carrier family 15 member 4 [Source:HGNC Symbol;Acc:HGNC:23090])

HSP 1 Score: 149.058 bits (375), Expect = 1.235e-37
Identity = 105/267 (39.33%), Postives = 152/267 (56.93%), Query Frame = 3
Query: 1002 ESTSDILFLDRSKIRFGGKFSEDDVEDVRKFSTTLILIAFIIPYWLLYFQMETTYMKQGFQLN----SGVTISSKNLIIPAAWLSMIDILTIMFLLPILVRFVYPYLRKKNLYPDFIFRIVFGMILAVISMIAAGILQIYVDNDIANNRTITRLIGGTYFNQSNISIYSQVPQYFIIGISESQTIVAGLELACTQVPTSMQAVTNXXXXXXXXXXXXXXTALL------------SFSNLINKEDKNHFYYFFVLAIIQTVFILLLL 1754
            +S+   LF D  K+  GG F+E+ VEDV+     + +   +IPYW +YFQM+TTY+ Q   L     S +T +   L  PAAWL+M D + I+ L+P+  + V P LR+  L P  + RI  GM   + S  AAGIL+    N +   +TI + IG   ++ +++S++ QVPQY +IGISE    +AGLE A +  P SMQ+   G+F+FFSG+GSF+G+ LL            S ++  N       YYFF+LA IQ   +LL L
Sbjct:  289 QSSKQSLF-DSCKMSHGGPFTEEKVEDVKALVKIVPVFLALIPYWTVYFQMQTTYVLQSLHLRIPEISNITTTPHTL--PAAWLTMFDAVLILLLIPLKDKLVDPILRRHGLLPSSLKRIAVGMFFVMCSAFAAGILESKRLN-LVKEKTINQTIGNVVYHAADLSLWWQVPQYLLIGISEIFASIAGLEFAYSAAPKSMQSAIMGLFFFFSGVGSFVGSGLLALVSIKAIGWMSSHTDFGNINGCYLNYYFFLLAAIQGATLLLFL 551          

HSP 2 Score: 78.1814 bits (191), Expect = 1.982e-14
Identity = 49/198 (24.75%), Postives = 90/198 (45.45%), Query Frame = 3
Query:   90 LLLAQMLERIVFYSISANFYFTLNSNPLQWTAVNTMSTTFLHSGFCFVFTMVGGILADTVIKKSTTVIIGYIFYI-AYVGFIIIFQENKDSD--SNNKLYSLCSHKTDKISHNIFDEACSNILIPTVIFCAIGSGLIKSVMASIGSDMAVKYWTYPSV-FFNMYYWSLNVGSLISFAAITFIQQNVSKFYGFLAPGIC 671
            +LL ++LER  FY I++N    LN  P  W          L  G  ++ +  GG LAD  + ++  +++    Y+   + F ++      +    + +L +  +   D  +       CS      ++   +G   +K+ +   G+D         +  FFN +YWS+N+G+++S   I +IQQNVS   G+  P +C
Sbjct:   40 VLLTELLERAAFYGITSNLVLFLNGAPFCWEGAQASEALLLFMGLTYLGSPFGGWLADARLGRARAILLSLALYLLGMLAFPLLAAPATRAALCGSARLLNCTAPGPDAAA-----RCCSPATFAGLVLVGLGVATVKANITPFGADQVKDRGPEATRRFFNWFYWSINLGAILSLGGIAYIQQNVSFVTGYAIPTVC 232          
BLAST of slc15a-5 vs. Ensembl Human
Match: SLC15A3 (solute carrier family 15 member 3 [Source:HGNC Symbol;Acc:HGNC:18068])

HSP 1 Score: 107.071 bits (266), Expect = 1.243e-23
Identity = 85/261 (32.57%), Postives = 143/261 (54.79%), Query Frame = 3
Query: 1053 GKFSEDDVEDVRKFSTTLILIAFIIPYWLLYFQMETTYMKQGFQL-----------NSGVTISSKN--LIIPAAWLSMIDILTIMFLLPILVRFVYPYLRKKNLYPDFIFRIVFGMILAVISMIAAGILQIYVDNDIANNRTITRLIGGTYFNQSNISIYSQVPQYFIIGISESQTIVAGLELACTQVPTSMQAVTNXXXXXXXXXXXXXXTALLSFSNLI-----------NKEDKNHFYYFFVLAIIQTVFILLLLPWI 1763
            G   ++D+ + +     L ++  ++PYW++YFQM++TY+ QG  L           N  V + ++     IP AWL + +++ ++ L+P+  R + P L +  L P  + ++  GM     S+I AG+L++   + I +N T+++ IG   +N + +SI+ Q+PQY +IGISE    + GLE A ++ P SMQ    GIF+  SG+GS LG++L++  +L            N  +     YFF+LA IQ V  LL + WI
Sbjct:  300 GASPQEDIANFQVLVKILPVMVTLVPYWMVYFQMQSTYVLQGLHLHIPNIFPANPANISVALRAQGSSYTIPEAWLLLANVVVVLILVPLKDRLIDPLLLRCKLLPSALQKMALGMFFGFTSVIVAGVLEMERLHYIHHNETVSQQIGEVLYNAAPLSIWWQIPQYLLIGISEIFASIPGLEFAYSEAPRSMQGAIMGIFFCLSGVGSLLGSSLVALLSLPGGWLHCPKDFGNINNCRMDLYFFLLAGIQAVTALLFV-WI 559          

HSP 2 Score: 70.0922 bits (170), Expect = 6.349e-12
Identity = 55/202 (27.23%), Postives = 96/202 (47.52%), Query Frame = 3
Query:   90 LLLAQMLERIVFYSISANFYFTLNSNPLQWTAVNTMSTTFLHSGFCFVFTMVGGILADTVIKKSTTVIIGYIFYIAYVGFI--IIFQENKDSDSN----NKLYSLC-SHKTDKISHNIFDEACSNILIPTVIFCAIGSGLIKSVMASIGSDMAVKYWTYPS-VFFNMYYWSLNVGSLISFAAITFIQQNVSKFYGFLAPGIC 671
            +LL +MLER  F+ ++AN    LNS    WT         +  G  ++   VGG LAD  + +   V +  + Y+A  G +    F + + S       + L   C S    + S + +   C+ +L   ++   + +  ++S + S G+D  +      +  FFN +YWS+N+G+++S   + FIQQN+S   G+  P  C
Sbjct:   38 VLLVEMLERAAFFGVTANLVLYLNSTNFNWTGEQATRAALVFLGASYLLAPVGGWLADVYLGRYRAVALSLLLYLAASGLLPATAFPDGRSSFCGEMPASPLGPACPSAGCPRSSPSPY---CAPVLYAGLLLLGLAASSVRSNLTSFGADQVMDLGRDATRRFFNWFYWSINLGAVLSLLVVAFIQQNISFLLGYSIPVGC 236          
BLAST of slc15a-5 vs. Ensembl Human
Match: SLC15A3 (solute carrier family 15 member 3 [Source:HGNC Symbol;Acc:HGNC:18068])

HSP 1 Score: 89.7373 bits (221), Expect = 2.080e-19
Identity = 77/248 (31.05%), Postives = 129/248 (52.02%), Query Frame = 3
Query: 1053 GKFSEDDVEDVRKFSTTLILIAFIIPYWLLYFQMETTYMKQGFQLNSGVTISSKNLIIPAAWLSMIDILTIMFLLPILVRFVYPYLRKKNLYPDFIFRIVFGMILAVISMIAAGILQIYVDNDIANNRTITRLIGGTYFNQSNISIYSQVPQYFIIGISESQTIVAGLELACTQVPTSMQAVTNXXXXXXXXXXXXXXTALLSFSNLI-----------NKEDKNHFYYFFVLAIIQTVFILLLLPWI 1763
            G   ++D+ + +     L ++  ++PYW++YFQ                        IP AWL + +++ ++ L+P+  R + P L +  L P  + ++  GM     S+I AG+L++   + I +N T+++ IG   +N + +SI+ Q+PQY +IGISE    + GLE A ++ P SMQ    GIF+  SG+GS LG++L++  +L            N  +     YFF+LA IQ V  LL + WI
Sbjct:    3 GASPQEDIANFQVLVKILPVMVTLVPYWMVYFQ------------------------IPEAWLLLANVVVVLILVPLKDRLIDPLLLRCKLLPSALQKMALGMFFGFTSVIVAGVLEMERLHYIHHNETVSQQIGEVLYNAAPLSIWWQIPQYLLIGISEIFASIPGLEFAYSEAPRSMQGAIMGIFFCLSGVGSLLGSSLVALLSLPGGWLHCPKDFGNINNCRMDLYFFLLAGIQAVTALLFV-WI 225          
BLAST of slc15a-5 vs. Ensembl Human
Match: SLC15A3 (solute carrier family 15 member 3 [Source:HGNC Symbol;Acc:HGNC:18068])

HSP 1 Score: 68.9366 bits (167), Expect = 1.038e-11
Identity = 55/202 (27.23%), Postives = 96/202 (47.52%), Query Frame = 3
Query:   90 LLLAQMLERIVFYSISANFYFTLNSNPLQWTAVNTMSTTFLHSGFCFVFTMVGGILADTVIKKSTTVIIGYIFYIAYVGFI--IIFQENKDSDSN----NKLYSLC-SHKTDKISHNIFDEACSNILIPTVIFCAIGSGLIKSVMASIGSDMAVKYWTYPS-VFFNMYYWSLNVGSLISFAAITFIQQNVSKFYGFLAPGIC 671
            +LL +MLER  F+ ++AN    LNS    WT         +  G  ++   VGG LAD  + +   V +  + Y+A  G +    F + + S       + L   C S    + S + +   C+ +L   ++   + +  ++S + S G+D  +      +  FFN +YWS+N+G+++S   + FIQQN+S   G+  P  C
Sbjct:   38 VLLVEMLERAAFFGVTANLVLYLNSTNFNWTGEQATRAALVFLGASYLLAPVGGWLADVYLGRYRAVALSLLLYLAASGLLPATAFPDGRSSFCGEMPASPLGPACPSAGCPRSSPSPY---CAPVLYAGLLLLGLAASSVRSNLTSFGADQVMDLGRDATRRFFNWFYWSINLGAVLSLLVVAFIQQNISFLLGYSIPVGC 236          
BLAST of slc15a-5 vs. Ensembl Human
Match: SLC15A4 (solute carrier family 15 member 4 [Source:HGNC Symbol;Acc:HGNC:23090])

HSP 1 Score: 59.3066 bits (142), Expect = 3.629e-9
Identity = 41/182 (22.53%), Postives = 78/182 (42.86%), Query Frame = 3
Query:  138 ANFYFTLNSNPLQWTAVNTMSTTFLHSGFCFVFTMVGGILADTVIKKSTTVIIGYIFYI-AYVGFIIIFQENKDSD--SNNKLYSLCSHKTDKISHNIFDEACSNILIPTVIFCAIGSGLIKSVMASIGSDMAVKYWTYPSV-FFNMYYWSLNVGSLISFAAITFIQQNVSKFYGFLAPGIC 671
            +N    LN  P  W          L  G  ++ +  GG LAD  + ++  +++    Y+   + F ++      +    + +L +  +   D  +       CS      ++   +G   +K+ +   G+D         +  FFN +YWS+N+G+++S   I +IQQNVS   G+  P +C
Sbjct:    2 SNLVLFLNGAPFCWEGAQASEALLLFMGLTYLGSPFGGWLADARLGRARAILLSLALYLLGMLAFPLLAAPATRAALCGSARLLNCTAPGPDAAAR-----CCSPATFAGLVLVGLGVATVKANITPFGADQVKDRGPEATRRFFNWFYWSINLGAILSLGGIAYIQQNVSFVTGYAIPTVC 178          
BLAST of slc15a-5 vs. Ensembl Zebrafish
Match: slc15a4 (solute carrier family 15 member 4 [Source:ZFIN;Acc:ZDB-GENE-040426-1047])

HSP 1 Score: 148.288 bits (373), Expect = 1.278e-37
Identity = 102/263 (38.78%), Postives = 152/263 (57.79%), Query Frame = 3
Query: 1026 LDRSKIRFGGKFSEDDVEDVRKFSTTLILIAFIIPYWLLYFQMETTYMKQGFQL-----NSGVTISSKNLI-IPAAWLSMIDILTIMFLLPILVRFVYPYLRKKNLYPDFIFRIVFGMILAVISMIAAGILQIYVDNDIANNRTITRLIGGTYFNQSNISIYSQVPQYFIIGISESQTIVAGLELACTQVPTSMQAVTNXXXXXXXXXXXXXXTALLSFSNL--------------INKEDKNHFYYFFVLAIIQTVFILLLL 1754
            LD +K+ +GG+FS++ VE+V+     L +   +IPYW +YFQM+TTY  Q   L     +   T S  N    PAAWL+M D + I+ L+P+  + V P L++K L P  + RI  GM   + S +AAGIL+    + +     I + +GG  +  +++ I+ QVPQY +IG+SE    +AGLE A +  P SMQ+   G+F+FFSGIGSF+G+ LL+  +L              IN+   N  YYFF+LA IQ + +L+ L
Sbjct:  295 LDGAKVTYGGRFSDEKVEEVKSLVKILPVFLALIPYWTVYFQMQTTYYLQSLHLTIPGADPNSTDSHPNTFRFPAAWLTMFDAVLILMLIPLKDKVVDPILKRKGLLPSSLKRIAVGMFFVMCSAVAAGILETKRLDIVRTRGPIPQSLGGVIYYAADLPIWWQVPQYVLIGVSEIFASIAGLEFAYSAAPRSMQSAIMGLFFFFSGIGSFVGSGLLAIVSLKAIGWMSSHQDFGNINECRLN--YYFFLLAAIQGITLLIFL 555          

HSP 2 Score: 79.7221 bits (195), Expect = 4.237e-15
Identity = 53/217 (24.42%), Postives = 99/217 (45.62%), Query Frame = 3
Query:   57 ILSTDKLGSMFLLLAQMLERIVFYSISANFYFTLNSNPLQWTAVNTMSTTFLHSGFCFVFTMVGGILADTVIKKSTTV-IIGYIFYIAYVGFIIIFQENKDSDSNNKLYSL------CSHKTDKISHNI----FDEACSNILIPTVIFCAIGSGLIKSVMASIGSDMAVKYWTYPS-VFFNMYYWSLNVGSLISFAAITFIQQNVSKFYGFLAPGIC 671
            + +  +L    +LLA+ LER+ FY I++N    LNS+P  W          +  G  ++ +  GG LAD  + K  T+ +   ++ +  + F  +  +N  +    +  +       C  +   +  N+        C   +   ++  A+G G +KS +   G+D         +  FFN +YW +N+G++ S   I +IQQN+S   G++ P +C
Sbjct:   25 VFNGRRLACAAILLAESLERMAFYGITSNLVLFLNSSPFYWEGTLASQGPLIFMGVTYLISPFGGWLADAYLGKFLTIALSLGLYLLGMLLFPFVASDNTRNYLCGEEMAFPVQPAECFPENGTVPANVTCVNRPSYCRPAIYSGLVLVALGVGAVKSNITPFGADQVKDRGPEATRRFFNWFYWCINLGAIFSLGGIAYIQQNISFSIGYIIPAVC 241          
BLAST of slc15a-5 vs. Ensembl Zebrafish
Match: SLC15A5 (si:ch211-190o6.3 [Source:ZFIN;Acc:ZDB-GENE-131121-351])

HSP 1 Score: 53.5286 bits (127), Expect = 2.431e-7
Identity = 48/193 (24.87%), Postives = 87/193 (45.08%), Query Frame = 3
Query: 1023 FLDRSKIRFGGKFSEDDVEDVRKFSTTLILIAFIIPYWLLYFQMETTYMKQGFQLNSGVTISSKNLIIPAAWLSMIDILTIMFLLPILVRFVYPYLRKKNLYPDFIFRIVFGMILAVISMIAAGILQIYVDNDIANNRTITRLIGGTYFNQSNISIYSQVPQYFIIGISESQTIVAGLELACTQVPTSMQAVT 1601
            +LDR+K   GG +SE  VE+V+       L    + Y     Q+ + Y  Q    N    +     ++P A + +I IL ++ L P+L      Y   K   P     I  G   A +S + AGI +I+  +     +T++    G     S+++ +   PQY ++G++E+    A   +A    P++++ V+
Sbjct:   16 WLDRAKENNGGCYSETSVENVKILVKLFPLFGLQLLYRACITQIPSGYYLQTMHSN----LKLNGFLLPVAVMKVISILPVLILAPLLELLNTYYQSPKKKLPSPATFITMGHGCAALSALLAGISEIHRKDYPEVEQTLS----GKVLQVSSMTCFQLTPQYILLGVAEAFVTPACSLIAFCLTPSNLRGVS 200          
BLAST of slc15a-5 vs. Ensembl Zebrafish
Match: SLC15A5 (si:ch211-190o6.3 [Source:ZFIN;Acc:ZDB-GENE-131121-351])

HSP 1 Score: 53.1434 bits (126), Expect = 3.146e-7
Identity = 48/193 (24.87%), Postives = 87/193 (45.08%), Query Frame = 3
Query: 1023 FLDRSKIRFGGKFSEDDVEDVRKFSTTLILIAFIIPYWLLYFQMETTYMKQGFQLNSGVTISSKNLIIPAAWLSMIDILTIMFLLPILVRFVYPYLRKKNLYPDFIFRIVFGMILAVISMIAAGILQIYVDNDIANNRTITRLIGGTYFNQSNISIYSQVPQYFIIGISESQTIVAGLELACTQVPTSMQAVT 1601
            +LDR+K   GG +SE  VE+V+       L    + Y     Q+ + Y  Q    N    +     ++P A + +I IL ++ L P+L      Y   K   P     I  G   A +S + AGI +I+  +     +T++    G     S+++ +   PQY ++G++E+    A   +A    P++++ V+
Sbjct:   16 WLDRAKENNGGCYSETSVENVKILVKLFPLFGLQLLYRACITQIPSGYYLQTMHSN----LKLNGFLLPVAVMKVISILPVLILAPLLELLNTYYQSPKKKLPSPATFITMGHGCAALSALLAGISEIHRKDYPEVEQTLS----GKVLQVSSMTCFQLTPQYILLGVAEAFVTPACSLIAFCLTPSNLRGVS 200          
BLAST of slc15a-5 vs. Ensembl Zebrafish
Match: SLC15A5 (si:ch211-190o6.3 [Source:ZFIN;Acc:ZDB-GENE-131121-351])

HSP 1 Score: 53.5286 bits (127), Expect = 6.541e-7
Identity = 48/193 (24.87%), Postives = 87/193 (45.08%), Query Frame = 3
Query: 1023 FLDRSKIRFGGKFSEDDVEDVRKFSTTLILIAFIIPYWLLYFQMETTYMKQGFQLNSGVTISSKNLIIPAAWLSMIDILTIMFLLPILVRFVYPYLRKKNLYPDFIFRIVFGMILAVISMIAAGILQIYVDNDIANNRTITRLIGGTYFNQSNISIYSQVPQYFIIGISESQTIVAGLELACTQVPTSMQAVT 1601
            +LDR+K   GG +SE  VE+V+       L    + Y     Q+ + Y  Q    N    +     ++P A + +I IL ++ L P+L      Y   K   P     I  G   A +S + AGI +I+  +     +T++    G     S+++ +   PQY ++G++E+    A   +A    P++++ V+
Sbjct:  279 WLDRAKENNGGCYSETSVENVKILVKLFPLFGLQLLYRACITQIPSGYYLQTMHSN----LKLNGFLLPVAVMKVISILPVLILAPLLELLNTYYQSPKKKLPSPATFITMGHGCAALSALLAGISEIHRKDYPEVEQTLS----GKVLQVSSMTCFQLTPQYILLGVAEAFVTPACSLIAFCLTPSNLRGVS 463          
BLAST of slc15a-5 vs. Ensembl Xenopus
Match: slc9a3r1 (SLC9A3 regulator 1 [Source:Xenbase;Acc:XB-GENE-487362])

HSP 1 Score: 153.68 bits (387), Expect = 2.571e-39
Identity = 103/255 (40.39%), Postives = 150/255 (58.82%), Query Frame = 3
Query: 1026 LDRSKIRFGGKFSEDDVEDVRKFSTTLILIAFIIPYWLLYFQMETTYMKQGFQLNSGVTISSKNLIIPAAWLSMIDILTIMFLLPILVRFVYPYLRKKNLYPDFIFRIVFGMILAVISMIAAGILQIYVDNDIANNRTITRLIGGTYFNQSNISIYSQVPQYFIIGISESQTIVAGLELACTQVPTSMQAVTNXXXXXXXXXXXXXXTALLSF------------SNLINKEDKNHFYYFFVLAIIQTVFILLLL 1754
            LD +K   GG F ED VEDV+     + +   +IPYW +YFQM+TTY+ Q   L     I + N  +PAAWL+M D + I+ L+P+  + V P+L+K+ L P  + RI  GM   + S++AAGIL+     +I  N  I + IGG  +  +N++++ Q+PQY +IGISE    +AGLE A +  P SMQ+   G+F+FFSGIGSF+G+ LL+             S+L N       YYFF+LA +Q   ++L L
Sbjct:  301 LDFAKASRGGPFREDKVEDVKSLVKIIPVFLALIPYWTVYFQMQTTYVLQSLHLKI-PPIFNNNHTLPAAWLTMFDAVLILILIPLKDKMVDPFLKKRGLLPSPLKRIAVGMFFVMCSVLAAGILE-SKRLEIVKNDKIQQQIGGVTYYAANLAVWWQLPQYILIGISEIFASIAGLEFAYSAAPKSMQSAIMGLFFFFSGIGSFVGSGLLALVSIPQIGWMSNHSDLGNINGCTLNYYFFLLAAVQAATLILFL 553          

HSP 2 Score: 79.337 bits (194), Expect = 6.147e-15
Identity = 50/217 (23.04%), Postives = 95/217 (43.78%), Query Frame = 3
Query:   57 ILSTDKLGSMFLLLAQMLERIVFYSISANFYFTLNSNPLQWTAVNTMSTTFLHSGFCFVFTMVGGILADTVIKKSTTVIIGYIFYIAYVGFIIIFQENKDSDSNNKLYSLCSHKTDKISHNIFDEACSNILIPTVIFCA-----------IGSGLIKSVMASIGSDMAVKYWTYPSV-FFNMYYWSLNVGSLISFAAITFIQQNVSKFYGFLAPGIC 671
            + +   L    +LL+++LER+ FY I++N    LN     W          L  G  ++ +   G LAD ++ +   ++   + Y+  +G ++    +           +   + D  S +    +    L P+  +CA           +G G +K+ +   G+D         +  FFN +YWS+N+G++IS   I ++QQNV    G++ P +C
Sbjct:   26 VFAGRGLACAAVLLSELLERVAFYGITSNLVLFLNGQIFGWEGTQASQALLLFMGITYLVSPFAGWLADALLGRFFIILGSMVLYL--LGMLLFPMISYSGTRTAFCGDIPWARIDNCSRSNTSSSPDTCLDPSRRYCAPAVFLGLIIVGLGVGSVKANITPFGADQVKDRGPEATRRFFNWFYWSINLGAIISLGGIAYVQQNVDFLTGYIIPTVC 240          
BLAST of slc15a-5 vs. Ensembl Mouse
Match: Slc15a4 (solute carrier family 15, member 4 [Source:MGI Symbol;Acc:MGI:2140796])

HSP 1 Score: 155.992 bits (393), Expect = 3.719e-40
Identity = 105/265 (39.62%), Postives = 153/265 (57.74%), Query Frame = 3
Query: 1002 ESTSDILFLDRSKIRFGGKFSEDDVEDVRKFSTTLILIAFIIPYWLLYFQMETTYMKQGFQLN--SGVTISSKNLIIPAAWLSMIDILTIMFLLPILVRFVYPYLRKKNLYPDFIFRIVFGMILAVISMIAAGILQIYVDNDIANNRTITRLIGGTYFNQSNISIYSQVPQYFIIGISESQTIVAGLELACTQVPTSMQAVTNXXXXXXXXXXXXXXTALL------------SFSNLINKEDKNHFYYFFVLAIIQTVFILLLL 1754
            +S+   LF D  K+  GG F+ED VEDV+     + +   +IPYW +YFQM+TTY  Q   L      +I++ +  +PAAWL+M D + I+ L+P+  + V P LR+  L P  + RI  GM   + S  AAGIL+     D+   +TI + IGG  ++ +++ I+ Q+PQY +IGISE    +AGLE A +  P SMQ+   G+F+FFSGIGSF+G+ LL            S ++  N    +  YYFF+LA IQ   +LL L
Sbjct:  290 QSSKHSLF-DSCKMSRGGPFTEDKVEDVKALVKIVPVFLALIPYWTVYFQMQTTYALQSLHLKIPEISSITTTHHTLPAAWLTMFDAVLILLLIPLKDKLVDPVLRRHGLLPSSLKRIAVGMFFVMCSAFAAGILE-SKRLDLVKEKTINQTIGGVVYHAADLPIWWQIPQYVLIGISEIFASIAGLEFAYSAAPKSMQSAIMGLFFFFSGIGSFVGSGLLALVSLKAIGWMSSHTDFGNINSCHLHYYFFLLAAIQGATLLLFL 552          

HSP 2 Score: 87.4261 bits (215), Expect = 1.641e-17
Identity = 54/203 (26.60%), Postives = 93/203 (45.81%), Query Frame = 3
Query:   90 LLLAQMLERIVFYSISANFYFTLNSNPLQWTAVNTMSTTFLHSGFCFVFTMVGGILADTVIKKSTTVIIGYIFYIAYVGFIIIFQENKD-----SDSNNKLYSLCSHKTDKISHNIFDEA---CSNILIPTVIFCAIGSGLIKSVMASIGSDMAVKYWTYPSV-FFNMYYWSLNVGSLISFAAITFIQQNVSKFYGFLAPGIC 671
            +LLA++LER  FY ++AN    LN  P  W          L  G  ++ +  GG LAD  + ++  +++    Y+  +    +    +       D   +L   CS      S +  + A   C+      ++   +G   +K+ +   G+D         +  FFN +YWS+N+G+++S   I +IQQNVS F G+L P +C
Sbjct:   33 VLLAELLERAAFYGVTANLVLFLNGAPFDWEGAQASQALLLFMGLTYLGSPFGGWLADARLGRARAILLSLALYLLGLLAFPLLAAPRSRSFLCGDPRPELVRNCSAPFPNGSASCPENAARRCAPATFAGLVLVGLGVATVKANITPFGADQVKDRGPEATRRFFNWFYWSINLGAILSLGGIAYIQQNVSFFTGYLIPTVC 235          
BLAST of slc15a-5 vs. Ensembl Mouse
Match: Slc15a3 (solute carrier family 15, member 3 [Source:MGI Symbol;Acc:MGI:1929691])

HSP 1 Score: 119.013 bits (297), Expect = 1.005e-27
Identity = 83/278 (29.86%), Postives = 138/278 (49.64%), Query Frame = 3
Query: 1053 GKFSEDDVEDVRKFSTTLILIAFIIPYWLLYFQMETTYMKQG--------FQLNSGVTI----SSKNLIIPAAWLSMIDILTIMFLLPILVRFVYPYLRKKNLYPDFIFRIVFGMILAVISMIAAGILQIYVDNDIANNRTITRLIGGTYFNQSNISIYSQVPQYFIIGISESQTIVAGLELACTQVPTSMQAVTNX---XXXXXXXXXXXXXTALLSF--------SNLINKEDKNHFYYFFVLAIIQTVFILLLLPWI-WKIRRNKKIHVITTSST 1814
            G   ++D+ + +     L ++  ++PYW++YFQM++TY+ QG        F+ N  +++     S N  IP AWL + ++  I+ L+P+    + P L +  L P  + ++  GM     S+I AG+L+      IA N+T+ +LIG   +  + +SI+ Q+PQY +IG+SE    + GLE A ++ P SMQ    G          +      ALLSF         +  N  +     YFF+LA I+ V  +L L WI  +  R ++      SS+
Sbjct:  298 GPSPQEDMANFQVLVKILPVMVTLVPYWMVYFQMQSTYVLQGLHLHIPNIFRTNPNISLLLRSDSSNYRIPEAWLLLANVAVILILIPVKDHLIDPLLLRCKLLPSSLQKMALGMFFGFTSIIVAGVLEKERLQYIAANQTVPQLIGKDLYYAAPLSIWWQIPQYLLIGVSEIFASIPGLEFAYSEAPRSMQGAIMGIFFCLSGVGSLLGSGLVALLSFPGGWMYCPKDFGNINNCQMDRYFFLLAGIEAVTAVLFL-WIAGRYERTRQDPASQRSSS 574          

HSP 2 Score: 68.1662 bits (165), Expect = 1.729e-11
Identity = 51/199 (25.63%), Postives = 93/199 (46.73%), Query Frame = 3
Query:   90 LLLAQMLERIVFYSISANFYFTLNSNPLQWTAVNTMSTTFLHSGFCFVFTMVGGILADTVIKKSTTVIIGYIFYIAYVGFIIIFQENKDSDSNNKLYSLCSHKTD----------KISHNIFDEACSNILIPTVIFCAIGSGLIKSVMASIGSDMAVKYWTYPS-VFFNMYYWSLNVGSLISFAAITFIQQNVSKFYGF 653
            +LL QMLER  F+ +++N    LNS    W        T L  G  ++   VGG LAD  + +  T+ +  + Y+A  G ++       + +N+   S C    +              +     C+  L   ++  A+ +  ++S + S G+D  +      +  FFN +YWS+N+G+++S   + FI+QN+S  +G+
Sbjct:   38 VLLVQMLERAAFFGVTSNLVLYLNSLNFNWDGQQASRATLLFLGASYLLAPVGGWLADVYLGRFLTISLSLLLYLAASGLLL------TTITNDGRRSFCGEMPELPLEPACPSSSCQGSWSSPYCATTLYLVLLLLALAASSVRSTLTSFGADQVMDLGRDATRRFFNWFYWSINLGAILSLLVVAFIEQNISFLWGY 230          
BLAST of slc15a-5 vs. Ensembl Mouse
Match: Slc15a4 (solute carrier family 15, member 4 [Source:MGI Symbol;Acc:MGI:2140796])

HSP 1 Score: 97.8265 bits (242), Expect = 2.953e-23
Identity = 49/124 (39.52%), Postives = 71/124 (57.26%), Query Frame = 3
Query: 1029 DRSKIRFGGKFSEDDVEDVRKFSTTLILIAFIIPYWLLYFQMETTYMKQGFQLN--SGVTISSKNLIIPAAWLSMIDILTIMFLLPILVRFVYPYLRKKNLYPDFIFRIVFGMILAVISMIAAG 1394
            D  K+  GG F+ED VEDV+     + +   +IPYW +YFQM+TTY  Q   L      +I++ +  +PAAWL+M D + I+ L+P+  + V P LR+  L P  + RI  GM   + S  AAG
Sbjct:    8 DSCKMSRGGPFTEDKVEDVKALVKIVPVFLALIPYWTVYFQMQTTYALQSLHLKIPEISSITTTHHTLPAAWLTMFDAVLILLLIPLKDKLVDPVLRRHGLLPSSLKRIAVGMFFVMCSAFAAG 131          
BLAST of slc15a-5 vs. Ensembl Mouse
Match: Slc15a4 (solute carrier family 15, member 4 [Source:MGI Symbol;Acc:MGI:2140796])

HSP 1 Score: 87.4261 bits (215), Expect = 1.995e-18
Identity = 54/203 (26.60%), Postives = 93/203 (45.81%), Query Frame = 3
Query:   90 LLLAQMLERIVFYSISANFYFTLNSNPLQWTAVNTMSTTFLHSGFCFVFTMVGGILADTVIKKSTTVIIGYIFYIAYVGFIIIFQENKD-----SDSNNKLYSLCSHKTDKISHNIFDEA---CSNILIPTVIFCAIGSGLIKSVMASIGSDMAVKYWTYPSV-FFNMYYWSLNVGSLISFAAITFIQQNVSKFYGFLAPGIC 671
            +LLA++LER  FY ++AN    LN  P  W          L  G  ++ +  GG LAD  + ++  +++    Y+  +    +    +       D   +L   CS      S +  + A   C+      ++   +G   +K+ +   G+D         +  FFN +YWS+N+G+++S   I +IQQNVS F G+L P +C
Sbjct:   33 VLLAELLERAAFYGVTANLVLFLNGAPFDWEGAQASQALLLFMGLTYLGSPFGGWLADARLGRARAILLSLALYLLGLLAFPLLAAPRSRSFLCGDPRPELVRNCSAPFPNGSASCPENAARRCAPATFAGLVLVGLGVATVKANITPFGADQVKDRGPEATRRFFNWFYWSINLGAILSLGGIAYIQQNVSFFTGYLIPTVC 235          
BLAST of slc15a-5 vs. Ensembl Mouse
Match: Slc15a4 (solute carrier family 15, member 4 [Source:MGI Symbol;Acc:MGI:2140796])

HSP 1 Score: 67.3958 bits (163), Expect = 1.177e-13
Identity = 34/80 (42.50%), Postives = 47/80 (58.75%), Query Frame = 3
Query: 1050 GGKFSEDDVEDVRKFSTTLILIAFIIPYWLLYFQMETTYMKQGFQLN----SGVTISSKNLIIPAAWLSMIDILTIMFLL 1277
            GG F+ED VEDV+     + +   +IPYW +YFQM+TTY  Q   L     S +T +   L  PAAWL+M D + I+ L+
Sbjct:    4 GGPFTEDKVEDVKALVKIVPVFLALIPYWTVYFQMQTTYALQSLHLKIPEISSITTTHHTL--PAAWLTMFDAVLILLLI 81          
BLAST of slc15a-5 vs. UniProt/SwissProt
Match: sp|A6QQL0|S15A4_BOVIN (Solute carrier family 15 member 4 OS=Bos taurus OX=9913 GN=SLC15A4 PE=2 SV=2)

HSP 1 Score: 193.741 bits (491), Expect = 7.043e-53
Identity = 169/581 (29.09%), Postives = 264/581 (45.44%), Query Frame = 3
Query:   90 LLLAQMLERIVFYSISANFYFTLNSNPLQWTAVNTMSTTFLHSGFCFVFTMVGGILADTVIKKSTTVIIGYIFYI-AYVGFIIIFQENKDSDSNNKLYSLCSHKTDKISHNIFDEACSNI----LIPTVI----FCAIGSGLIKSVMASIGSDMAVKYWTYPSV-FFNMYYWSLNVGSLISFAAITFIQQNVSKFYGFLAPGICXXXXXXXXXXXXPYYVVVPKSSKSTLNLVYRVYFEAFQXXXXXXXXXXXXVTNTATDDPINSTTQASFKTNDINTFYQQRADYPSLNAGYFXXXXXXXXETSTIVETTMSESTSDILFLDRSKIRFGGKFSEDDVEDVRKFSTTLILIAFIIPYWLLYFQMETTYMKQGFQLN--SGVTISSKNLIIPAAWLSMIDILTIMFLLPILVRFVYPYLRKKNLYPDFIFRIVFGMILAVISMIAAGILQIYVDNDIANNRTITRLIGGTYFNQSNISIYSQVPQYFIIGISESQTIVAGLELACTQVPTSMQAVTNXXXXXXXXXXXXXXTALLSFSNL--------------INKEDKNHFYYFFVLAIIQTVFILLLL 1754
            +LL ++LER  FY ++AN    LN     W          L  G  ++ +  GG LAD  + ++  +++    Y+   + F ++      S       +LC         N     C++       P V+       +G G +K+ +   G+D         +  FFN +YWS+N+G+++S   I +IQQNVS   G+  P +C+ ++FV+FL G  +++  P    S    ++R+   + +                    P     + S     I  F Q                                 S+   LF D  K+  GG F ED VEDV+     + +   +IPYW +YFQM+TTY+ Q   L      +I++     PAAWL+M D + I+ L+P+  + V P L++  L P  + RI  GM   + S  AAGIL+     D+   +TI + IG   +  +++ I+ QVPQY +IG+SE    +AGLE A +  P SMQ+   G+F+FFSG+GSF+G+ LL+  +L              IN    N  YYFF+LA IQ   +LL L
Sbjct:   29 VLLTELLERAAFYGVTANLVLFLNGTAFGWEGAEASQALLLFMGLTYLVSPFGGWLADARLGRARAILLSLALYLLGMLAFPLLAAPATRS-------ALCGAPGPTNVRNCSAPPCTDTPTRYCAPAVLSALALVGLGVGAVKANITPFGADQVKDRGPEATRRFFNWFYWSINLGAIVSLGGIAYIQQNVSFVTGYAIPAVCIGVAFVVFLCGQTFFITKPPDG-SAFTDMFRILVYSCR--------------------PQKRIREHSPSGEGIGVFQQ---------------------------------SSKHSLF-DSCKMSRGGPFPEDKVEDVKALVKIVPVFLALIPYWTVYFQMQTTYVLQSLHLKIPEISSITTNPHTFPAAWLTMFDAVLILLLIPLKDKLVDPILKRNGLLPSSLKRIAVGMFFVMCSAFAAGILE-SKRLDLVKEKTINQTIGNVVYYAADLPIWWQVPQYVLIGVSEIFASIAGLEFAYSAAPKSMQSAIMGLFFFFSGVGSFVGSGLLALVSLKAIGWMSSHTDFGNINGCYLN--YYFFLLAAIQGATLLLFL 544          
BLAST of slc15a-5 vs. UniProt/SwissProt
Match: sp|O09014|S15A4_RAT (Solute carrier family 15 member 4 OS=Rattus norvegicus OX=10116 GN=Slc15a4 PE=1 SV=1)

HSP 1 Score: 156.762 bits (395), Expect = 1.256e-39
Identity = 111/287 (38.68%), Postives = 161/287 (56.10%), Query Frame = 3
Query: 1002 ESTSDILFLDRSKIRFGGKFSEDDVEDVRKFSTTLILIAFIIPYWLLYFQMETTYMKQGFQLN--SGVTISSKNLIIPAAWLSMIDILTIMFLLPILVRFVYPYLRKKNLYPDFIFRIVFGMILAVISMIAAGILQIYVDNDIANNRTITRLIGGTYFNQSNISIYSQVPQYFIIGISESQTIVAGLELACTQVPTSMQAVTNXXXXXXXXXXXXXXTALL------------SFSNLINKEDKNHFYYFFVLAIIQTVFILLLLPWIWKIRRNKKIHVITTSSTLT 1820
            +S+   LF D  K+  GG F+ED VEDV+     + +   +IPYW +YFQM+TTY+ Q   L      +I++ +  +PAAWL+M D + I+ L+P+  + V P LR+  L P  + RI  GM     S  AAGIL+     D+   +TI + IGG  ++ +++ I+ Q+PQY +IGISE    +AGLE A +  P SMQ+   G+F+FFSGIGSF+G+ LL            S ++  N    +  YYFF+LA IQ   +LL L    K  R +      T+ST T
Sbjct:  288 QSSKHSLF-DSCKMSRGGPFTEDKVEDVKALVKIVPVFLALIPYWTVYFQMQTTYVLQSLHLKIPEISSITTTHHTLPAAWLTMFDAVLILLLIPLKDKLVDPVLRRHGLLPSSLKRIAVGMFFVTCSAFAAGILE-SKRLDLVKEKTINQTIGGVVYHAADLPIWWQIPQYVLIGISEIFASIAGLEFAYSAAPKSMQSAIMGLFFFFSGIGSFVGSGLLALVSLKAIGWMSSHTDFGNINSCHLHYYFFLLAAIQGATLLLFLIVSVKYDRQRARTDGGTASTRT 572          

HSP 2 Score: 88.1965 bits (217), Expect = 5.851e-17
Identity = 55/203 (27.09%), Postives = 94/203 (46.31%), Query Frame = 3
Query:   90 LLLAQMLERIVFYSISANFYFTLNSNPLQWTAVNTMSTTFLHSGFCFVFTMVGGILADTVIKKSTTVIIGYIFYI-AYVGFIIIFQENKDS----DSNNKLYSLCSHKTDKISHNIFDEA---CSNILIPTVIFCAIGSGLIKSVMASIGSDMAVKYWTYPSV-FFNMYYWSLNVGSLISFAAITFIQQNVSKFYGFLAPGIC 671
            +LLA++LER  FY ++AN    LN  P  W          L  G  ++ +  GG LAD  + ++  +++    Y+   + F ++      S    D + +L   CS      +    D A   C+      ++   +G   +K+ +   G+D         +  FFN +YWS+N+G+++S   I +IQQNVS   G+L P +C
Sbjct:   31 VLLAELLERAAFYGVTANLVLFLNGAPFNWEGAQASQALLLFMGLTYLGSPFGGWLADARLGRARAILLSLALYLLGMLAFPLLAAPRSRSFLCGDPHPELVRNCSAPFPNGTAVCPDAAARRCAPATFAGLVLVGLGVATVKANITPFGADQVKDRGPEATRRFFNWFYWSINLGAILSLGGIAYIQQNVSFLTGYLIPTVC 233          
BLAST of slc15a-5 vs. UniProt/SwissProt
Match: sp|Q91W98|S15A4_MOUSE (Solute carrier family 15 member 4 OS=Mus musculus OX=10090 GN=Slc15a4 PE=1 SV=1)

HSP 1 Score: 155.992 bits (393), Expect = 2.601e-39
Identity = 105/265 (39.62%), Postives = 153/265 (57.74%), Query Frame = 3
Query: 1002 ESTSDILFLDRSKIRFGGKFSEDDVEDVRKFSTTLILIAFIIPYWLLYFQMETTYMKQGFQLN--SGVTISSKNLIIPAAWLSMIDILTIMFLLPILVRFVYPYLRKKNLYPDFIFRIVFGMILAVISMIAAGILQIYVDNDIANNRTITRLIGGTYFNQSNISIYSQVPQYFIIGISESQTIVAGLELACTQVPTSMQAVTNXXXXXXXXXXXXXXTALL------------SFSNLINKEDKNHFYYFFVLAIIQTVFILLLL 1754
            +S+   LF D  K+  GG F+ED VEDV+     + +   +IPYW +YFQM+TTY  Q   L      +I++ +  +PAAWL+M D + I+ L+P+  + V P LR+  L P  + RI  GM   + S  AAGIL+     D+   +TI + IGG  ++ +++ I+ Q+PQY +IGISE    +AGLE A +  P SMQ+   G+F+FFSGIGSF+G+ LL            S ++  N    +  YYFF+LA IQ   +LL L
Sbjct:  290 QSSKHSLF-DSCKMSRGGPFTEDKVEDVKALVKIVPVFLALIPYWTVYFQMQTTYALQSLHLKIPEISSITTTHHTLPAAWLTMFDAVLILLLIPLKDKLVDPVLRRHGLLPSSLKRIAVGMFFVMCSAFAAGILE-SKRLDLVKEKTINQTIGGVVYHAADLPIWWQIPQYVLIGISEIFASIAGLEFAYSAAPKSMQSAIMGLFFFFSGIGSFVGSGLLALVSLKAIGWMSSHTDFGNINSCHLHYYFFLLAAIQGATLLLFL 552          

HSP 2 Score: 87.4261 bits (215), Expect = 1.148e-16
Identity = 54/203 (26.60%), Postives = 93/203 (45.81%), Query Frame = 3
Query:   90 LLLAQMLERIVFYSISANFYFTLNSNPLQWTAVNTMSTTFLHSGFCFVFTMVGGILADTVIKKSTTVIIGYIFYIAYVGFIIIFQENKD-----SDSNNKLYSLCSHKTDKISHNIFDEA---CSNILIPTVIFCAIGSGLIKSVMASIGSDMAVKYWTYPSV-FFNMYYWSLNVGSLISFAAITFIQQNVSKFYGFLAPGIC 671
            +LLA++LER  FY ++AN    LN  P  W          L  G  ++ +  GG LAD  + ++  +++    Y+  +    +    +       D   +L   CS      S +  + A   C+      ++   +G   +K+ +   G+D         +  FFN +YWS+N+G+++S   I +IQQNVS F G+L P +C
Sbjct:   33 VLLAELLERAAFYGVTANLVLFLNGAPFDWEGAQASQALLLFMGLTYLGSPFGGWLADARLGRARAILLSLALYLLGLLAFPLLAAPRSRSFLCGDPRPELVRNCSAPFPNGSASCPENAARRCAPATFAGLVLVGLGVATVKANITPFGADQVKDRGPEATRRFFNWFYWSINLGAILSLGGIAYIQQNVSFFTGYLIPTVC 235          
BLAST of slc15a-5 vs. UniProt/SwissProt
Match: sp|Q68F72|S15A4_XENLA (Solute carrier family 15 member 4 OS=Xenopus laevis OX=8355 GN=slc15a4 PE=2 SV=1)

HSP 1 Score: 152.91 bits (385), Expect = 2.766e-38
Identity = 103/255 (40.39%), Postives = 149/255 (58.43%), Query Frame = 3
Query: 1026 LDRSKIRFGGKFSEDDVEDVRKFSTTLILIAFIIPYWLLYFQMETTYMKQGFQLNSGVTISSKNLIIPAAWLSMIDILTIMFLLPILVRFVYPYLRKKNLYPDFIFRIVFGMILAVISMIAAGILQIYVDNDIANNRTITRLIGGTYFNQSNISIYSQVPQYFIIGISESQTIVAGLELACTQVPTSMQAVTNXXXXXXXXXXXXXXTALLSF------------SNLINKEDKNHFYYFFVLAIIQTVFILLLL 1754
            LD +K   GG F ED VEDV+     + +   +IPYW +YFQM+TTY+ Q   L     I + N  +PAAWL+M D + I+ L+P+  + V P+L+K+ L P  + RI  GM   + S++AAGIL+     +I     I + IG   +  +N++++ Q+PQY +IGISE    +AGLE A +  P SMQ+V  G+F+FFSGIGSF+G+ LL+             S+L N       YYFF+LA +Q   +LL L
Sbjct:  300 LDMAKASHGGPFREDKVEDVKALVKIIPVFLALIPYWTVYFQMQTTYVLQSLHLRI-PQIFNNNHTLPAAWLTMFDAVLILILIPLKDKLVDPFLKKRGLLPSPLKRIAVGMFFVMCSVLAAGILE-SERLEIVKRDKIQQQIGNVTYYAANLTVWWQLPQYILIGISEIFASIAGLEFAYSAAPKSMQSVIMGLFFFFSGIGSFVGSGLLALVSIPQIGWMSNHSDLGNINGCTLNYYFFLLAAVQAATLLLFL 552          

HSP 2 Score: 85.8853 bits (211), Expect = 3.282e-16
Identity = 54/222 (24.32%), Postives = 94/222 (42.34%), Query Frame = 3
Query:   57 ILSTDKLGSMFLLLAQMLERIVFYSISANFYFTLNSNPLQWTAVNTMSTTFLHSGFCFVFTMVGGILADTVIKKSTTVIIGYIFYI----------------AYVGFIIIFQENKDSDSNNKLYSLCSHKTDKISHNIFDEACSNILIPTVIFCAIGSGLIKSVMASIGSDMAVKYWTYPSV-FFNMYYWSLNVGSLISFAAITFIQQNVSKFYGFLAPGIC 671
            + S   L    +LL+++LER+ FY I++N    LN     W          L  G  ++ +   G LAD ++ +   ++   + Y+                A+ G I   Q    S SN      C   + +         C+  L   +I   +G G +K+ +   G+D         +  FFN +YWS+N+G++IS   + ++QQNV    G++ P +C
Sbjct:   26 VFSGRGLACAAVLLSELLERVAFYGITSNLVLFLNGQIFGWEGTQASQALLLFMGITYLVSPFAGWLADALLGRFYVILGSMVLYLLGMLLFPMVSYSGTRTAFCGDIQWAQIENCSRSNASSDDTCPEPSRRY--------CAPALFLGLIIVGLGVGSVKANITPFGADQVKDRGPEATRRFFNWFYWSINLGAIISLGGVAYVQQNVEFLIGYIIPAVC 239          
BLAST of slc15a-5 vs. UniProt/SwissProt
Match: sp|Q8N697|S15A4_HUMAN (Solute carrier family 15 member 4 OS=Homo sapiens OX=9606 GN=SLC15A4 PE=1 SV=1)

HSP 1 Score: 149.058 bits (375), Expect = 5.928e-37
Identity = 105/267 (39.33%), Postives = 152/267 (56.93%), Query Frame = 3
Query: 1002 ESTSDILFLDRSKIRFGGKFSEDDVEDVRKFSTTLILIAFIIPYWLLYFQMETTYMKQGFQLN----SGVTISSKNLIIPAAWLSMIDILTIMFLLPILVRFVYPYLRKKNLYPDFIFRIVFGMILAVISMIAAGILQIYVDNDIANNRTITRLIGGTYFNQSNISIYSQVPQYFIIGISESQTIVAGLELACTQVPTSMQAVTNXXXXXXXXXXXXXXTALL------------SFSNLINKEDKNHFYYFFVLAIIQTVFILLLL 1754
            +S+   LF D  K+  GG F+E+ VEDV+     + +   +IPYW +YFQM+TTY+ Q   L     S +T +   L  PAAWL+M D + I+ L+P+  + V P LR+  L P  + RI  GM   + S  AAGIL+    N +   +TI + IG   ++ +++S++ QVPQY +IGISE    +AGLE A +  P SMQ+   G+F+FFSG+GSF+G+ LL            S ++  N       YYFF+LA IQ   +LL L
Sbjct:  289 QSSKQSLF-DSCKMSHGGPFTEEKVEDVKALVKIVPVFLALIPYWTVYFQMQTTYVLQSLHLRIPEISNITTTPHTL--PAAWLTMFDAVLILLLIPLKDKLVDPILRRHGLLPSSLKRIAVGMFFVMCSAFAAGILESKRLN-LVKEKTINQTIGNVVYHAADLSLWWQVPQYLLIGISEIFASIAGLEFAYSAAPKSMQSAIMGLFFFFSGVGSFVGSGLLALVSIKAIGWMSSHTDFGNINGCYLNYYFFLLAAIQGATLLLFL 551          

HSP 2 Score: 78.1814 bits (191), Expect = 9.519e-14
Identity = 49/198 (24.75%), Postives = 90/198 (45.45%), Query Frame = 3
Query:   90 LLLAQMLERIVFYSISANFYFTLNSNPLQWTAVNTMSTTFLHSGFCFVFTMVGGILADTVIKKSTTVIIGYIFYI-AYVGFIIIFQENKDSD--SNNKLYSLCSHKTDKISHNIFDEACSNILIPTVIFCAIGSGLIKSVMASIGSDMAVKYWTYPSV-FFNMYYWSLNVGSLISFAAITFIQQNVSKFYGFLAPGIC 671
            +LL ++LER  FY I++N    LN  P  W          L  G  ++ +  GG LAD  + ++  +++    Y+   + F ++      +    + +L +  +   D  +       CS      ++   +G   +K+ +   G+D         +  FFN +YWS+N+G+++S   I +IQQNVS   G+  P +C
Sbjct:   40 VLLTELLERAAFYGITSNLVLFLNGAPFCWEGAQASEALLLFMGLTYLGSPFGGWLADARLGRARAILLSLALYLLGMLAFPLLAAPATRAALCGSARLLNCTAPGPDAAA-----RCCSPATFAGLVLVGLGVATVKANITPFGADQVKDRGPEATRRFFNWFYWSINLGAILSLGGIAYIQQNVSFVTGYAIPTVC 232          
BLAST of slc15a-5 vs. TrEMBL
Match: A0A0H3YIZ0 (Slc15a-5 OS=Schmidtea mediterranea OX=79327 GN=slc15a-5 PE=2 SV=1)

HSP 1 Score: 1087.02 bits (2810), Expect = 0.000e+0
Identity = 591/591 (100.00%), Postives = 591/591 (100.00%), Query Frame = 3
Query:   51 MKILSTDKLGSMFLLLAQMLERIVFYSISANFYFTLNSNPLQWTAVNTMSTTFLHSGFCFVFTMVGGILADTVIKKSTTVIIGYIFYIAYVGFIIIFQENKDSDSNNKLYSLCSHKTDKISHNIFDEACSNILIPTVIFCAIGSGLIKSVMASIGSDMAVKYWTYPSVFFNMYYWSLNVGSLISFAAITFIQQNVSKFYGFLAPGICXXXXXXXXXXXXPYYVVVPKSSKSTLNLVYRVYFEAFQXXXXXXXXXXXXVTNTATDDPINSTTQASFKTNDINTFYQQRADYPSLNAGYFXXXXXXXXETSTIVETTMSESTSDILFLDRSKIRFGGKFSEDDVEDVRKFSTTLILIAFIIPYWLLYFQMETTYMKQGFQLNSGVTISSKNLIIPAAWLSMIDILTIMFLLPILVRFVYPYLRKKNLYPDFIFRIVFGMILAVISMIAAGILQIYVDNDIANNRTITRLIGGTYFNQSNISIYSQVPQYFIIGISESQTIVAGLELACTQVPTSMQAVTNXXXXXXXXXXXXXXTALLSFSNLINKEDKNHFYYFFVLAIIQTVFILLLLPWIWKIRRNKKIHVITTSSTLTN 1823
            MKILSTDKLGSMFLLLAQMLERIVFYSISANFYFTLNSNPLQWTAVNTMSTTFLHSGFCFVFTMVGGILADTVIKKSTTVIIGYIFYIAYVGFIIIFQENKDSDSNNKLYSLCSHKTDKISHNIFDEACSNILIPTVIFCAIGSGLIKSVMASIGSDMAVKYWTYPSVFFNMYYWSLNVGSLISFAAITFIQQNVSKFYGFLAPGICLFLSFVLFLLGLPYYVVVPKSSKSTLNLVYRVYFEAFQKKFSKKKNLSEKVTNTATDDPINSTTQASFKTNDINTFYQQRADYPSLNAGYFNDSDNSSDETSTIVETTMSESTSDILFLDRSKIRFGGKFSEDDVEDVRKFSTTLILIAFIIPYWLLYFQMETTYMKQGFQLNSGVTISSKNLIIPAAWLSMIDILTIMFLLPILVRFVYPYLRKKNLYPDFIFRIVFGMILAVISMIAAGILQIYVDNDIANNRTITRLIGGTYFNQSNISIYSQVPQYFIIGISESQTIVAGLELACTQVPTSMQAVTNGIFWFFSGIGSFLGTALLSFSNLINKEDKNHFYYFFVLAIIQTVFILLLLPWIWKIRRNKKIHVITTSSTLTN
Sbjct:    1 MKILSTDKLGSMFLLLAQMLERIVFYSISANFYFTLNSNPLQWTAVNTMSTTFLHSGFCFVFTMVGGILADTVIKKSTTVIIGYIFYIAYVGFIIIFQENKDSDSNNKLYSLCSHKTDKISHNIFDEACSNILIPTVIFCAIGSGLIKSVMASIGSDMAVKYWTYPSVFFNMYYWSLNVGSLISFAAITFIQQNVSKFYGFLAPGICLFLSFVLFLLGLPYYVVVPKSSKSTLNLVYRVYFEAFQKKFSKKKNLSEKVTNTATDDPINSTTQASFKTNDINTFYQQRADYPSLNAGYFNDSDNSSDETSTIVETTMSESTSDILFLDRSKIRFGGKFSEDDVEDVRKFSTTLILIAFIIPYWLLYFQMETTYMKQGFQLNSGVTISSKNLIIPAAWLSMIDILTIMFLLPILVRFVYPYLRKKNLYPDFIFRIVFGMILAVISMIAAGILQIYVDNDIANNRTITRLIGGTYFNQSNISIYSQVPQYFIIGISESQTIVAGLELACTQVPTSMQAVTNGIFWFFSGIGSFLGTALLSFSNLINKEDKNHFYYFFVLAIIQTVFILLLLPWIWKIRRNKKIHVITTSSTLTN 591          
BLAST of slc15a-5 vs. TrEMBL
Match: K1RF99 (Solute carrier family 15 member 4 OS=Crassostrea gigas OX=29159 GN=CGI_10015896 PE=4 SV=1)

HSP 1 Score: 261.536 bits (667), Expect = 8.415e-75
Identity = 194/646 (30.03%), Postives = 342/646 (52.94%), Query Frame = 3
Query:   72 KLGSMFLLLAQMLERIVFYSISANFYFTLNSNPLQWTAVNTMSTTFLHSGFCFVFTMVGGILADTVIKKSTTVIIGYIFY-IAYVGFIIIFQENKDSDSNN---KLYSLCSH-----KTDKISH----NIFDEACSNILIPTVIFCAIGSGLIKSVMASIGSDMAVKYWTYPSV-FFNMYYWSLNVGSLISFAAITFIQQNVSKFYGFLAPGICXXXXXXXXXXXXPYYVVVPKSSKSTLNLVYRVYFEAFQXXXXXXXXXXXXVTNTATDDPINSTTQASFKTNDINTFYQQRADYPSLNAGYFXXXXXXXXETSTIVETTMSESTSDILFLDRSKIRFGGKFSEDDVEDVRKFSTTLILIAFIIPYWLLYFQMETTYMKQGFQLNSGVT------------------ISSKNLIIPAAWLSMIDILTIMFLLPILVRFVYPYLRKKNLYPDFIFRIVFGMILAVISMIAAGILQIY-------VDNDIANNRTITRLIGGTYFNQSNISIYSQVPQYFIIGISESQTIVAGLELACTQVPTSMQAVTNXXXXXXXXXXXXXXTALL-----------SFSNLINKEDKN---------HF-YYFFVLAIIQ--TVFILLLLPWIWKIRRNKKIHVITTSSTLTN 1823
            K+    +LL   LER+ FYS++ N    LNS+P +W + N +  TF+  G  +V + +GGI+ADT++ K  T+++ ++ Y + YV   ++  E K+   N+    L ++C       K DK+S     ++ +E C+ ++   +   ++GSG+ +SV+A  G+D         S+ FFN YYWS+N+G+L++ + +T++QQ++S F GFL+  I L +S ++F+ G   YV +PK+  S L  ++++ FE+ Q+                                   T ++QR +          + ++ S ++S I E   +E++    FLD++K R+GG F E  VEDV++    L +   ++PYW++YFQM+TT+  QG  +   ++                   S+K   + AAW S+ D++ ++ LLP+  R +YPYL+K++++   + RI  GM+ A I+++ AGI++++         N+   + TI + IG T +  +++S++ Q+PQY +IGISE  T VA LE A    P SM+ +  G F+ F+GIGS LGT  +            F N+  +   N         H  YYFF LA+++   +F+ +++  I K+  ++ +  +T +STL N
Sbjct:   26 KVAQGSILLTVALERLAFYSLTGNLVLFLNSDPFEWRSYNALYCTFIFLGISYVLSFLGGIIADTLLGKFKTLLLAFVIYLVGYVFLPVVTFEEKNKLLNSTELGLPNICGRDNDEKKGDKMSMISKLSLIEENCAGLIFGILTIISVGSGIFRSVIAPFGADQVRGEGPQTSLAFFNWYYWSINLGTLVALSGVTYVQQDISFFLGFLSSNISLGVSCLVFIAGCWSYVYLPKTG-SILTNIFKILFESCQR----------------------------------RTLHRQREN----------NVEHISADSSDIPELKSTENSPS--FLDKAKCRYGGSFHETAVEDVKQLLKILCVFLTLLPYWMVYFQMQTTFELQGLHMKLDISNVEKYKICHDMNSSSYSPESTKKSTLVAAWFSLFDVVFLIILLPLFDRVIYPYLKKRDMHVGIVCRISVGMMFATIAVLVAGIVELFRLRAVWKFPNEECCSYTINQTIGHTVYRAADMSVFWQIPQYALIGISEVFTSVAALEFAYQMAPKSMKGIIMGFFYLFTGIGSLLGTGTMFAFKDTWFFQEDFGNINCRMGCNTTGTFTKACHLDYYFFFLAVLEFTGMFVFIIVAKILKL--SQHLVPVTKTSTLDN 622          
BLAST of slc15a-5 vs. TrEMBL
Match: A0A210QH82 (Solute carrier family 15 member 4 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT16618 PE=3 SV=1)

HSP 1 Score: 230.72 bits (587), Expect = 6.595e-63
Identity = 165/571 (28.90%), Postives = 272/571 (47.64%), Query Frame = 3
Query:   72 KLGSMFLLLAQMLERIVFYSISANFYFTLNSNPLQWTAVNTMSTTFLHSGFCFVFTMVGGILADTVIKKSTTVIIGYIFYIAYVGFIII----------FQENKDSDSNNKLYSLCSHKTDKISHN-----------IFDEACSNILIPTVIFCAIGSGLIKSVMASIGSDMAVKYWTYPSVFFNMYYWSLNVGSLISFAAITFIQQNVSKFYGFLAPGICXXXXXXXXXXXXPYYVVVPKSSKSTLNLVYRVYFEAFQXXXXXXXXXXXXVTNTATDDPINSTTQASFKTNDINTFYQQRADYPSLNAGYFXXXXXXXXETSTIVETTMSESTSDI---------LFLDRSKIRFGGKFSEDDVEDVRKFSTTLILIAFIIPYWLLYFQMETTYMKQGFQL--------NSGVTISSKNLI--------------IPAAWLSMIDILTIMFLLPILVRFVYPYLRKKNLYPDFIFRIVFGMILAVISMIAAGILQ------IYV-DND---IANNRTITRLIGGTYFNQSNISIYSQVPQYFIIGISESQTIVAGLELACTQVPTSMQAV 1598
            KLG   +LL  + ER+VFYS++ N     N  P  WTA N +  ++  +G  F+ +  GG L DTV+ +  T+++ +  Y   VG+I +           QEN  +  ++K  SL       + HN            F E CS      +   A+G+G+ ++ M   G D A       + FFN YYWS+N+GSL + + IT++QQ  S F G+L   +CL ++F+LFL G   Y+  P++ ++ L  V  V  EA  ++                                     + R    SL A            + + +E++MSE T  I           LD +K ++GG F+   VEDV+K    + +   ++PYW++YFQM+TT++ QG  +        N   +I   N+               I AAW S+ D++ ++ L+P++ R +YPYL ++      + RI  GM+ A ++++ AG+++      IY+ D+D      N TI + IG   F+ +N++++ Q+PQY +IG+SE  T VAG++ A    P SM+ +
Sbjct:   32 KLGKGTILLTVVFERLVFYSLTGNMVLYFNLGPYNWTAYNALLASYFFTGISFLTSFAGGFLGDTVLGRYKTLMLSFFVYC--VGYIFLPVLSYNDYKHTQENTTNSRHDKTESLSPVCWPLLQHNGNAPSKDSMPGPFKEPCSLTAYLVLFVIAVGTGIFRANMPPFGGDQAQTRGDGHTTFFNWYYWSVNIGSLFALSVITWVQQRHSFFLGYLTAAVCLGVAFLLFLTGSCSYINRPRA-RTVLQNVCSVVKEAIHRR-------------------------------------RHRNPESSLRA-----------HSDSTIESSMSEQTDSIEINPSNTPECCLDYAKFQYGGSFNNSQVEDVKKLGKIICVFLTLVPYWMVYFQMQTTFLLQGLHMKLSLNSATNCNKSICHSNVTLHEAVGQPHEHSTPIVAAWFSLFDVVFVILLIPLVDRVLYPYLARRGRPITMVTRISIGMVFACLAVLLAGVVENQRLKHIYLCDHDGQQFCTNFTIQQKIGNENFDAANMTVFWQIPQYALIGVSEVFTCVAGIDFAYQMAPRSMKGI 551          
BLAST of slc15a-5 vs. TrEMBL
Match: A0A3M7SSZ3 (Solute carrier family 15 member 4 OS=Brachionus plicatilis OX=10195 GN=BpHYR1_023220 PE=3 SV=1)

HSP 1 Score: 223.787 bits (569), Expect = 1.154e-60
Identity = 197/586 (33.62%), Postives = 307/586 (52.39%), Query Frame = 3
Query:   93 LLAQMLERIVFYSISANFYFTLNSNPLQWTAVNTMSTTFLHSGFCFVFTMVGGILADTVIKKSTTVIIGYIFYI-AYVGFIIIFQENKDSD---SNNKLYSLCSHKTD-----KISHNIFDEACSNILIPTVIFCAIGSGLIKSVMASIGSDMAV-KYWTYPSVFFNMYYWSLNVGSLISFAAITFIQQNVSKFYGFLAPGICXXXXXXXXXXXXPYYVVVPKSSKSTLNLVYRVYFEAFQXXXXXXXXXXXXVTNTATDDPINSTTQASFKTNDINTFYQQRAD-YPSLNAGYFXXXXXXXXETSTIVETTMSESTSDILFLDRSKIRFGGKFSEDDVEDVRKFSTTLILIAFIIPYWLLYFQMETTYMKQGFQL---NSGVTISSKNLIIPAAWLSMIDILTIMFLLPILVRFVYPYLRK--KNLYPDFIFRIVFGMILAVISMIAAGILQIYVDNDIANN---RTITRLIGGTYFNQSNISIYSQVPQYFIIGISESQTIVAGLELACTQVPTSMQAVTNXXXXXXXXXXXXXXTALLS------FSNLINKEDKN----HF-YYFFVLAIIQT----VFILL 1748
            LL   LER  FY +  N+   LN  PL W + N      +  G   + +++GG +AD+ + K TT+ + ++ YI  Y  F  +   NK  D   SN+   +      D     K    +  E CS I+I TV+   +  G I++ +   G+D    +  T    +FN  YWS+N+GSL++++ + +IQQN S F GF  P   L LSFVLFL+G   Y+    + KS +  V R+  EAF+    +K      +     +  + S ++            Q+R D Y + N                  E     S   I FLD +KIRFGG+F++ DV+DV+     L+L A +IPYW+LYFQ+ET+Y+ QG  +   +   TI     +IPAAWLS+ D +T++F++P++   VYP++R+  KNL  +   R+VFGM L+ +S+I+AGIL+    N I  +    T+ ++I  T +  +N++I  Q+PQY + G+ E    V  L  A ++ P SMQ++  G+F+FFSG GS  G+A+L       ++N  N +D N     F YYF+ LA++Q     +FIL+
Sbjct:   65 LLVYTLERFAFYGLICNYILYLNKQPLDWKSFNASLILLIFFGVLNITSVIGGWVADSFLGKYTTICLSFVGYIVGYAAFPYLSFYNKIPDVCYSNSSRSNWSRIDEDFPFFVKPDRPLIQETCSWIIILTVVVIGLSVGFIRANLGPFGADQVTSRGQTMVFKYFNWLYWSINLGSLLAYSVLAYIQQNKSFFLGFTIPFFSLVLSFVLFLIGSFSYIK-NDAEKSVITKVIRIIQEAFRSVKRQKNF----IKQKERERKMLSESEDE----------QERFDTYSTENE-----------------EDDSGTSYKTISFLDNAKIRFGGRFADSDVDDVKSLKRILLLFALLIPYWILYFQIETSYIIQGLHMKLFSRSETIGIPAFMIPAAWLSIADNVTVLFMIPLMDSLVYPFMRRRFKNLSIEST-RLVFGMSLSALSVISAGILESVRHNLITEDPQANTVVQIIDNTSYVAANLNILWQIPQYTLTGLGEVFCSVTCLYYAYSEAPKSMQSMIMGLFYFFSGAGSLAGSAILVLFKKIIYTNSKNIDDINCSSCRFNYYFYSLALVQMAGIGIFILV 617          
BLAST of slc15a-5 vs. TrEMBL
Match: R7UDG9 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_167732 PE=3 SV=1)

HSP 1 Score: 220.705 bits (561), Expect = 6.511e-60
Identity = 182/588 (30.95%), Postives = 288/588 (48.98%), Query Frame = 3
Query:   90 LLLAQMLERIVFYSISANFYFTLNSNPLQWTAVNTMSTTFLHSGFCFVFTMVGGILADTVIKKSTTVIIGYIFYIA-YVGFIIIFQENKDSDSNNKLYSLCSHKT-------DKISHNIFD---------EACSNILIPTVIFCAIGSGLIKSVMASIGSDMAVKYWTYPSV--FFNMYYWSLNVGSLISFAAITFIQQNVSKFYGFLAPGICXXXXXXXXXXXXPYYVVVPKSSKSTLNLVYRVYFEAFQXXXXXXXXXXXXVTNTATDDPINSTTQASFKTNDINTFYQQRADYPSLNAGYFXXXXXXXXETSTIVETTMSESTSDILFLDRSKIRFGGKFSEDDVEDVRKFSTTLILIAFIIPYWLLYFQMETTYMKQGFQL-------NSGVTISSKNLIIPAAWLSMIDILTIMFLLPILVRFVYPYLRKKNLYPDFIFRIVFGMILAVISMIAAGILQ-----IYVDNDIANNRTITRLIGGTYFNQSNISIYSQVPQYFIIGISESQTIVAGLELACTQVPTSMQAVTNXXXXXXXXXXXXXXTAL-LSFSNL---------INKEDKNHFYYFFVLAIIQ 1730
            +L + + ERI FYSI +N    LN +PL W + N +   F+ +G  ++  + GG +AD+++ K  T+++ +  YI  YV   ++      S    +    CS          D I     D         E C+ ++   +   AIG+G +K+ +A  G+D  VK     S   FFN +YWS+N+G+L++     F+QQ +S F+G++ PG+ L +  +LF+ G  +YV+ P S  S L+ + ++ F+  +               +A +  I +++ +   + D           P                                  LDR+K+RFGG F ++ V+DVR     L++   IIPYW++YFQMETT++ QG  +       +S  +       +PAAWLS+ DI+ ++ L+P++ R VYP L ++  +     RI  GMI  V ++  AG L+     IY  N   N     + IG TY+  + I+I  Q+PQY +IG+SE    VA LELA +  P SMQ +  G+FWF  G+GS LGT L L+F N+         IN +  +  YYFF LA +Q
Sbjct:   16 ILGSVIFERIAFYSIVSNLVMFLNQDPLHWMSYNAVMALFVFTGLSYMTALFGGWIADSILGKFKTIVLFFFVYIGGYVCMPLLHPYPNPSSKPQEAPQWCSQSNLSLNSSGDNIPWTPIDGNRYRAPYEETCAWLVWLGLGIMAIGNGGVKANIAPFGADQ-VKMLGSTSTRGFFNWFYWSINLGALVALGLFAFVQQELSFFWGYVVPGMLLCVGTILFICGFCFYVMKPPSG-SILSNIVKIIFQGCRL--------------SARNKKITTSSSSGVHSMD-----------PPEGC------------------------------LDRAKLRFGGSFHDNCVDDVRSLGRVLLVFLAIIPYWIVYFQMETTFIVQGLHMKLDFDKNDSKKSQEITTFKLPAAWLSLFDIIFLIVLIPLMDRVVYPALDRRGHHLSLRGRIFIGMIFGVFAVGCAGGLESWRMHIYWLNGTENVH--WQEIGNTYYRAAGINILWQIPQYTLIGVSEVFASVASLELAYSTAPKSMQGIIMGLFWFTQGLGSILGTLLTLAFHNVWFFDWDEGDINCQQCHLDYYFFFLAGVQ 544          
BLAST of slc15a-5 vs. Ensembl Cavefish
Match: slc15a4 (solute carrier family 15 member 4 [Source:NCBI gene;Acc:103028949])

HSP 1 Score: 147.517 bits (371), Expect = 1.863e-37
Identity = 105/266 (39.47%), Postives = 157/266 (59.02%), Query Frame = 3
Query: 1023 FLDRSKIRFGGKFSEDDVEDVRKFSTTLILIAFIIPYWLLYFQMETTYMKQGFQL-----NSGVTIS-SKNLIIPAAWLSMIDILTIMFLLPILVRFVYPYLRKKNLYPDFIFRIVFGMILAVISMIAAGILQIYVDNDIAN--NRTITRLIGGTYFNQSNISIYSQVPQYFIIGISESQTIVAGLELACTQVPTSMQAVTNXXXXXXXXXXXXXXTALLSFSNL--------------INKEDKNHFYYFFVLAIIQTVFILLLL 1754
             LD +K+ +GGKF E+ V++V+     L +   +IPYW +YFQM+TTY  Q   L      + VT S +     PAAWL+M D + I+ L+P+  + V P LR++ L P  + RI  GM   + S +AAGIL+     +I N  +  I++++GG  +  +++ I+ Q+PQY +IGISE    +AGLE A +  P SMQ+   G+F+FFSGIGSF+G+ LL+F ++              IN+   N  +YFF+LA IQ V +LL L
Sbjct:  293 LLDGAKVTYGGKFPEEKVDEVKSLMKILPVFLALIPYWTVYFQMQTTYYLQSLHLRIPGSEANVTDSQTMRFKFPAAWLTMFDAVLILMLIPLKDKLVDPILRRRGLLPSSLKRIAVGMFFVMCSAVAAGILETK-RLEIVNSPHGVISQVLGGVTYYAADLPIWWQIPQYVLIGISEIFASIAGLEFAYSAAPRSMQSAIMGLFFFFSGIGSFVGSGLLAFVSVKFIGWMSSHKDFGNINECKLN--FYFFLLAGIQGVTLLLFL 555          

HSP 2 Score: 94.7449 bits (234), Expect = 5.282e-20
Identity = 58/217 (26.73%), Postives = 104/217 (47.93%), Query Frame = 3
Query:   57 ILSTDKLGSMFLLLAQMLERIVFYSISANFYFTLNSNPLQWTAVNTMSTTFLHSGFCFVFTMVGGILADTVIKKSTTVIIGYIFYI-AYVGFIIIFQENKDSDSNNKLYSL------CSHKTDKISHNI----FDEACSNILIPTVIFCAIGSGLIKSVMASIGSDMAVKYWTYPS-VFFNMYYWSLNVGSLISFAAITFIQQNVSKFYGFLAPGIC 671
            I    +L    +LLA+ LER+ FY I++N    LNS+P  W A        +  G  ++ +  GG LAD  + K  T+ +  + Y+   + F  +  E+  +    +  +       C + +  +  NI        C NI+   ++  A+G G +KS +   G+D         +  FFN +YW +N+G+++S   I +IQQN++ + G++ P +C
Sbjct:   25 IFKGRRLACAAILLAESLERMAFYGITSNLVLFLNSSPFYWEATMASQAPLVFMGVTYLISPFGGWLADAFLGKFLTIALSLVLYLTGMLLFPFVASESSRTGLCGEEMAFPVQPVECFNMSGTLPANITCLPRKPYCGNIVYIGLVLVALGVGAVKSNITPFGADQVKDRGPEATRRFFNWFYWCINLGAIMSLGVIAYIQQNMNFWLGYIIPAVC 241          
BLAST of slc15a-5 vs. Ensembl Cavefish
Match: slc15a4 (solute carrier family 15 member 4 [Source:NCBI gene;Acc:103028949])

HSP 1 Score: 139.813 bits (351), Expect = 8.306e-35
Identity = 77/200 (38.50%), Postives = 118/200 (59.00%), Query Frame = 3
Query: 1023 FLDRSKIRFGGKFSEDDVEDVRKFSTTLILIAFIIPYWLLYFQMETTYMKQGFQL-----NSGVTIS-SKNLIIPAAWLSMIDILTIMFLLPILVRFVYPYLRKKNLYPDFIFRIVFGMILAVISMIAAGILQIYVDNDIAN--NRTITRLIGGTYFNQSNISIYSQVPQYFIIGISESQTIVAGLELACTQVPTSMQAV 1598
             LD +K+ +GGKF E+ V++V+     L +   +IPYW +YFQM+TTY  Q   L      + VT S +     PAAWL+M D + I+ L+P+  + V P LR++ L P  + RI  GM   + S +AAGIL+     +I N  +  I++++GG  +  +++ I+ Q+PQY +IGISE    +AGLE A +  P SMQ+ 
Sbjct:  293 LLDGAKVTYGGKFPEEKVDEVKSLMKILPVFLALIPYWTVYFQMQTTYYLQSLHLRIPGSEANVTDSQTMRFKFPAAWLTMFDAVLILMLIPLKDKLVDPILRRRGLLPSSLKRIAVGMFFVMCSAVAAGILETK-RLEIVNSPHGVISQVLGGVTYYAADLPIWWQIPQYVLIGISEIFASIAGLEFAYSAAPRSMQSA 491          

HSP 2 Score: 94.7449 bits (234), Expect = 5.470e-20
Identity = 58/217 (26.73%), Postives = 104/217 (47.93%), Query Frame = 3
Query:   57 ILSTDKLGSMFLLLAQMLERIVFYSISANFYFTLNSNPLQWTAVNTMSTTFLHSGFCFVFTMVGGILADTVIKKSTTVIIGYIFYI-AYVGFIIIFQENKDSDSNNKLYSL------CSHKTDKISHNI----FDEACSNILIPTVIFCAIGSGLIKSVMASIGSDMAVKYWTYPS-VFFNMYYWSLNVGSLISFAAITFIQQNVSKFYGFLAPGIC 671
            I    +L    +LLA+ LER+ FY I++N    LNS+P  W A        +  G  ++ +  GG LAD  + K  T+ +  + Y+   + F  +  E+  +    +  +       C + +  +  NI        C NI+   ++  A+G G +KS +   G+D         +  FFN +YW +N+G+++S   I +IQQN++ + G++ P +C
Sbjct:   25 IFKGRRLACAAILLAESLERMAFYGITSNLVLFLNSSPFYWEATMASQAPLVFMGVTYLISPFGGWLADAFLGKFLTIALSLVLYLTGMLLFPFVASESSRTGLCGEEMAFPVQPVECFNMSGTLPANITCLPRKPYCGNIVYIGLVLVALGVGAVKSNITPFGADQVKDRGPEATRRFFNWFYWCINLGAIMSLGVIAYIQQNMNFWLGYIIPAVC 241          
BLAST of slc15a-5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005298.1 (pep scaffold:Pmarinus_7.0:GL477384:58393:77162:-1 gene:ENSPMAG00000004819.1 transcript:ENSPMAT00000005298.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 89.7373 bits (221), Expect = 1.409e-20
Identity = 73/220 (33.18%), Postives = 120/220 (54.55%), Query Frame = 3
Query: 1131 YWLLYFQMETTYMKQGFQL------NSGVTISSKNLIIPAAWLSMIDILTIMFLLPILVRFVYPYLRKKNLYPDFIFRIVFGMILAVISMIAAGILQIYVDNDIANNRTITRLIGGTYFNQSNISIYSQVPQYFIIGISESQTIVAGLELACTQVPTSMQAVTNXXXXXXXXXXXXXXTALLSFSNL--INKEDK-------NHFY---YFFVLAIIQTV 1736
            Y  +  QM+TTY  Q   L      N+  +    N   P AW ++ D L ++  +P+  R V+ +L ++   P  + R+  GMI ++ S +AAG+L+    N +     + + IG + +  + ++++ Q+PQ+ ++G+SE  T + GLE A +  P  MQ+   G+F+FFSGIGSF+G+ LLS  +L  I   D        NH +   YFF+LA IQ+V
Sbjct:    4 YHTILIQMQTTYQLQSLHLQIPKIFNTSSSGFPHNF--PTAWFTLFDALLLLAFIPVADRVVFVWLARRGFRPSPVLRMAVGMIFSLSSAVAAGLLESERLNRVYRKEVVKQCIGHSEYEAARLTVWWQLPQFLLVGLSELLTSIGGLEFAYSAAPKHMQSAVMGLFFFFSGIGSFMGSGLLSLVSLPSIGWMDSHKDSGSINHCHLDFYFFLLAGIQSV 221          
BLAST of slc15a-5 vs. Ensembl Yeast
Match: PTR2 (Integral membrane peptide transporter; mediates transport of di- and tri-peptides; conserved protein that contains 12 transmembrane domains; PTR2 expression is regulated by the N-end rule pathway via repression by Cup9p [Source:SGD;Acc:S000001801])

HSP 1 Score: 58.9214 bits (141), Expect = 1.443e-9
Identity = 45/184 (24.46%), Postives = 85/184 (46.20%), Query Frame = 3
Query: 1074 VEDVRKFSTTLILIAFIIPYWLLYFQMETTYMKQG--FQLNSGVTISSKNLIIPAAWLSMIDILTIMFLLPILVRFVYPYLRK-KNLYPDFIFRIVFGMILAVISMIAAGILQIYVDNDIANNRTITRLIGGTYFNQ-------SNISIYSQVPQYFIIGISESQTIVAGLELACTQVPTSMQA 1595
            V+++++      +  F   YW  Y  M ++++ Q    +L+           IP  +L   D + ++  +PI  +FVYP++R+   L P  I +I FG +    +M  A +LQ +V               G ++N+       +++ +  Q+P Y +I  SE    + GLE A ++ P SM++
Sbjct:  342 VDEIKRALAACKVFIFYPIYWTQYGTMISSFITQASMMELHG----------IPNDFLQAFDSIALIIFIPIFEKFVYPFIRRYTPLKP--ITKIFFGFMFGSFAMTWAAVLQSFVYK------------AGPWYNEPLGHNTPNHVHVCWQIPAYVLISFSEIFASITGLEYAYSKAPASMKS 501          
BLAST of slc15a-5 vs. Ensembl Nematostella
Match: EDO37372 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFZ9])

HSP 1 Score: 147.517 bits (371), Expect = 3.855e-38
Identity = 90/246 (36.59%), Postives = 144/246 (58.54%), Query Frame = 3
Query: 1023 FLDRSKIRFGGKFSEDDVEDVRKFSTTLILIAFIIPYWLLYFQMETTYMKQGFQLNSGVTISSKNLIIPAAWLSMIDILTIMFLLPILVRFVYPYLRKKNLYPDFIFRIVFGMILAVISMIAAGILQIYVDNDIANNRTITRLIGGTYFNQSNISIYSQVPQYFIIGISESQTIVAGLELACTQVPTSMQAVTNXXXXXXXXXXXXXXTALLSFSNLINKEDKNHFY--------YFFVLAIIQTV 1736
            +LDR+ I++GG F + DVE+V+      ++    IPYW++YFQM +T++ QG  +N  + IS  +  IPAAWL++ D++ ++ L+P++ + +YP+L ++ L    + RI  G + AV +M+ AG ++ Y   ++   RT+ + I    F  +++SI  Q+PQY +IG+SE    V GLE A  + P SMQ+   G+F+F   IGS LG AL SF+  +       FY        YFF+L  I  V
Sbjct:  262 WLDRAMIKYGGTFLDTDVEEVKTLRKISLIFLAQIPYWMIYFQMNSTFLNQGLHMNL-IDISEGSH-IPAAWLTVTDVIFVLLLIPVMDKLIYPWLDRRGLRVSVLMRISIGFLFAVAAMVVAGGVE-YKRRNVEMLRTVNQTINQKTFIAADLSIMYQIPQYGLIGVSEVFASVGGLEFAYREAPPSMQSFVMGLFFFVQSIGSLLGAALYSFAGHVLHWTTESFYTVGPHLDCYFFLLGAIMLV 504          

HSP 2 Score: 55.4546 bits (132), Expect = 3.959e-8
Identity = 63/246 (25.61%), Postives = 112/246 (45.53%), Query Frame = 3
Query:   90 LLLAQMLERIVFYSISANFYFTLNSN-PLQWTAVNTMSTT---------FLHSGFCFVFTMVGGILADTVIKKSTTVIIGYIFYIAYVG--FIIIFQENKDSDSNNKLYSLCSHKTDKISHNIFDEACSNILIPTVIFCAIGSGLIKSVMASIGSDM--AVKYWTYPSVFFNMYYWSLNVGSLISFAAITFIQQNVSKFYGFLAPGICXXXXXXXXXXXXPYYVVVPKSSKSTLNLVYRVYFEAFQ 785
            ++LA +LER  +Y I +N    L +     + ++   ++T         F ++G  +  + VGG + D+       +    + YI   G  F+I       S S N                 + E    + I T++  +IG G  K+ +++ G++   +    TY   FFN YYW++NV S +++  + +IQ N   FYG+L    C+ L+ VLF +   +Y + P +S + L  V  V  EA++
Sbjct:   11 IILAVLLERTTYYGILSNLVVFLTTEMDFAFGSLGVGNSTISNGIIVSVFAYTGMAWFMSTVGGFIGDSYSGHYNAIYGSLLIYILGSGSLFMITVLLKYSSSSLND----------------YKELSVGLTIGTLLVLSIGEGTYKANISAFGAEQLSSDDSKTYRQ-FFNWYYWAINVASFLAYMLLAYIQVNWGFFYGYLISLCCILLACVLFCIPQSHYNIKP-ASGNILKKVCGVIREAYR 238          
BLAST of slc15a-5 vs. Ensembl Nematostella
Match: EDO47131 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNF0])

HSP 1 Score: 125.561 bits (314), Expect = 2.272e-30
Identity = 63/210 (30.00%), Postives = 121/210 (57.62%), Query Frame = 3
Query:  990 TTMSESTSDILFLDRSKIRFGGKFSEDDVEDVRKFSTTLILIAFIIPYWLLYFQMETTYMKQGFQLNSGVTISSKNLIIPAAWLSMIDILTIMFLLPILVRFVYPYLRKKNLYPDFIFRIVFGMILAVISMIAAGILQI-----YVDNDIANNRTITRLIGGTYFNQSNISIYSQVPQYFIIGISESQTIVAGLELACTQVPTSMQAVTN 1604
            T++ ++ S + +LDR+ +++GG F   +V +V+           +IPYW++Y Q+ TTY+ QG  L++   +    L++PAAW+S+++I  ++ +LP++ + +YP   + N     ++ + FGM+LAV S+  AG L++     + +N   N  T  ++    Y      +I  Q+PQY ++G+SE    + GLE+  +  P++ Q+VT+
Sbjct:  295 TSLHKAKSKMTWLDRASVQYGGTFLNSEVCEVKSLGKAFAFSLCLIPYWMIYSQLYTTYILQGLHLHADFGV----LVVPAAWMSLLEIAVVLIMLPLMEKIIYPVCIQCNFSLPLLWSVTFGMLLAVASVAMAGYLEMEKADYFTENGFTNQTTSCKV----YHVVKGFNILWQMPQYALLGMSEVFASMTGLEIVYSLCPSTPQSVTS 496          

HSP 2 Score: 55.0694 bits (131), Expect = 6.835e-8
Identity = 50/204 (24.51%), Postives = 98/204 (48.04%), Query Frame = 3
Query:   54 KILSTDKLGSMFLLLAQMLERIVFYSISANFYFTLNSNPLQWTAVNTMSTTFLHSGFCFVFTMVGGILADTVIKKSTTVIIGYIFYIAYVGFIIIFQENKDSDSNNKLYSLCSHKTDKISHNIFDEACSNILIPTVIFCAIGSGLIKSVMASIGSDM---AVKYWTYPSVFFNMYYWSLNVGSLISFAAITFIQQ-NVSKFYGF 653
            + L   +L    L+LA++ ER  +Y I+ NF   L++    W+         +++   +    +GG+LAD    + +T+I G + Y  Y+G +++       D  +K        +D+ S  I        L+  ++  A G G +KS +++  ++         ++  +F  +Y++S NV +L   AA+T+IQQ ++S  YG+
Sbjct:   49 RKLRMRRLPIACLILAEVCERFAYYGITINFVLFLDN--FGWSMFAAAGGVLVYTSVAWFMCALGGLLADGRFGRHSTIISGLLVY--YIGSVLLVLLAVWLDYRHK------EPSDQDSIPILP-----WLVLIMLSVAAGEGAVKSNLSAFSAEQFQGESPSGSWKGIFTCLYWFS-NVIALFGLAAVTYIQQTDLSWTYGY 236          
BLAST of slc15a-5 vs. Ensembl Nematostella
Match: EDO33176 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSZ4])

HSP 1 Score: 120.168 bits (300), Expect = 1.006e-28
Identity = 90/262 (34.35%), Postives = 144/262 (54.96%), Query Frame = 3
Query: 1008 TSDILFLDRSKIRFGGKFSEDDVEDVRKFSTTLILIAFIIPYWLLYFQMETTYMKQG--FQLNSGVTISSKNLIIPAAWLSMIDILTIMFLLPILVRFVYPYLRKKNLYPDFIFRIVFGMILAVISMIAAGILQIYVDNDIANNRTITRLIGGTYFNQSNISIYSQVPQYFIIGISESQTIVAGLELACTQVPTSMQAVTNXXXXXXXXXXXXXXTALLSFSNLINKEDKNHF----------YYFFVLAIIQTV-FILLLL 1754
            +  I +LDR+K  +GG FS   VE+V+     L + A  I YW LY QM+T+Y+ Q     L+ G+        +PAA LS+ DI+ ++ L+P++ + VYP LR   +    + R+  GM+ A  S+  AG+++I       + +  T  +     N S++SI+ QVPQ+ +IG SE  T + GLE A +Q P  +Q +  GIF   SG+G++L +AL   +N++   DK+ +           YFF+LAI+    FI+ +L
Sbjct:  281 SEGIHWLDRAKESYGGAFSYHRVENVKSLIRLLPVFAMFIIYWTLYSQMQTSYLIQAEYMMLDYGIQ-------LPAASLSIFDIVCVLLLIPLMDKVVYPLLRYCGVRFTPLRRVGVGMLFAAASVAVAGLVEIERKRMFRDGQWHTSTMFNKTHNVSDMSIFYQVPQFMLIGTSEVFTSITGLEFAYSQAPRCLQGLVMGIFLVTSGLGNYLASAL---TNIVTSVDKSWYPTDPNTGHLENYFFLLAILMVANFIIYIL 532          

HSP 2 Score: 70.8626 bits (172), Expect = 7.494e-13
Identity = 65/230 (28.26%), Postives = 113/230 (49.13%), Query Frame = 3
Query:   81 SMFLLLAQMLERIVFYSISANFYFTLNSNPLQWTAVNTMSTTFLHSGFCFVFTMVGGILADTVIKKSTTVIIGYIFYIAYVGFIIIFQENKDSDSNNKLYSLCSHKTDKISHNIFDEACSNILIPTVIFCAIGSGLIKSVMASIGSD-MAVKYWTYPSVFFNMYYWSLNVGSLISFAAITFIQQNVSKFYGFLAPGICXXXXXXXXXXXXPYYVVVPKSSKSTLNLVYRV 767
            ++ +LL ++ ER+ FY I+AN       + L +      +   L  G C+   + GG LADT + +   +   Y   + Y    ++F     + +   + ++   +T  +S ++     S+I+   VI  A G+G IK+ ++  G+D +  K       FFN +YW +N+GS +SF  I ++QQ  + FYG+    I + +  V+F+ G  +YVV P    S L   YRV
Sbjct:   46 TLCILLTELCERLTFYGITANL-VPFCEDSLGFKRPMPSTVNLLFQGTCYFIPVFGGWLADTFMGRYNVI---YGSCLVYFFGTVLFAAG--ACTTGDILNIFGKQTKYLSSSL--RKASSIVALVVI--AFGTGGIKANVSPFGADQVQGKGPRAVQKFFNWFYWFINIGSFLSFTLIVWVQQKYTFFYGYAVTAISMMIGTVVFMTGRNWYVVRPPGG-SVLTDTYRV 264          
BLAST of slc15a-5 vs. Ensembl Medaka
Match: slc15a4 (solute carrier family 15 member 4 [Source:NCBI gene;Acc:101165813])

HSP 1 Score: 160.999 bits (406), Expect = 4.116e-42
Identity = 104/259 (40.15%), Postives = 157/259 (60.62%), Query Frame = 3
Query: 1023 FLDRSKIRFGGKFSEDDVEDVRKFSTTLILIAFIIPYWLLYFQMETTYMKQGFQL---NSGVTISSKNLIIPAAWLSMIDILTIMFLLPILVRFVYPYLRKKNLYPDFIFRIVFGMILAVISMIAAGILQIYVDNDIANNRTITRLIGGTYFNQSNISIYSQVPQYFIIGISESQTIVAGLELACTQVPTSMQAVTNXXXXXXXXXXXXXXTALLSFSNLI------------NKEDKNHFYYFFVLAIIQTVFILLLL 1754
             LD +K+ +GGKF E+ VE+V+    TL +   +IPYW +YFQM+TTY+ QG  L    +   I++++   PAAWL+M D + I+ L+P+  + V P L+++ L P  + RI  GM   + S +AAGIL+      + +N TI +++G   +  +++ I+ QVPQY +IGISE    +AGLE A +  P SMQ+   G+F+FFSGIGSF+G+ LL+  +L             N  D +  YYFF+LA IQ V +L+ L
Sbjct:  284 LLDSAKVTYGGKFPEEKVEEVKALLKTLPVFFALIPYWTVYFQMQTTYVLQGLHLRIPGTSSNITTESHQFPAAWLTMFDAVLILMLIPLKDKVVDPVLKRRGLLPSSLKRIAVGMFFVMCSAVAAGILETKRLEIVKSNGTINQVLGNVIYYVADLPIWWQVPQYVLIGISEIFASIAGLEFAYSAAPKSMQSAIMGLFFFFSGIGSFVGSGLLAIVSLKAIGWMSSQKDFGNINDCSLHYYFFLLAGIQGVTLLVFL 542          

HSP 2 Score: 90.5077 bits (223), Expect = 1.168e-18
Identity = 58/217 (26.73%), Postives = 100/217 (46.08%), Query Frame = 3
Query:   57 ILSTDKLGSMFLLLAQMLERIVFYSISANFYFTLNSNPLQWTAVNTMSTTFLHSGFCFVFTMVGGILADTVIKKSTTVIIGYIFYIAYVGFIII-FQENKDSD----SNNKLYSL----CSHKTDKISHNIF--DEACSNILIPTVIFCAIGSGLIKSVMASIGSDMAVKYWTYPS-VFFNMYYWSLNVGSLISFAAITFIQQNVSKFYGFLAPGIC 671
            +    +L    +LLA+ LERI FY I++N    LN +P  W          +  G  ++ +  GG LAD  + K  T+    + Y  ++G I   F  N+D+          + +    CS+ T   +      D  C  ++   ++  A+G G +KS +   G+D         +  FFN +YW +N+G+++S   + +IQQN S   G++ P +C
Sbjct:   25 VFQGRRLACAAVLLAESLERIAFYGITSNLVLFLNGSPFYWEGTKASQAPLMFMGITYLISPFGGWLADAYLGKFVTIASSLVLY--FIGMIFFPFIANEDTRIHLCGEESAFPVQPAECSNSTPPKNVTCLYRDPYCGPLIYTGLLLIALGVGTLKSNITPFGADQVKDRGPEATRRFFNWFYWCINLGAILSLGFVAYIQQNFSFELGYIIPTVC 239          
BLAST of slc15a-5 vs. Ensembl Medaka
Match: slc15a4 (solute carrier family 15 member 4 [Source:NCBI gene;Acc:101165813])

HSP 1 Score: 160.229 bits (404), Expect = 7.585e-42
Identity = 106/263 (40.30%), Postives = 157/263 (59.70%), Query Frame = 3
Query: 1023 FLDRSKIRFGGKFSEDDVEDVRKFSTTLILIAFIIPYWLLYFQMETTYMKQGFQL-----NSGVTISSKNLII--PAAWLSMIDILTIMFLLPILVRFVYPYLRKKNLYPDFIFRIVFGMILAVISMIAAGILQIYVDNDIANNRTITRLIGGTYFNQSNISIYSQVPQYFIIGISESQTIVAGLELACTQVPTSMQAVTNXXXXXXXXXXXXXXTALLSFSNLI------------NKEDKNHFYYFFVLAIIQTVFILLLL 1754
             LD +K+ +GGKF E+ VE+V+    TL +   +IPYW +YFQM+TTY+ QG  L     +S +T  S  +    PAAWL+M D + I+ L+P+  + V P L+++ L P  + RI  GM   + S +AAGIL+      + +N TI +++G   +  +++ I+ QVPQY +IGISE    +AGLE A +  P SMQ+   G+F+FFSGIGSF+G+ LL+  +L             N  D +  YYFF+LA IQ V +L+ L
Sbjct:  292 LLDSAKVTYGGKFPEEKVEEVKALLKTLPVFFALIPYWTVYFQMQTTYVLQGLHLRIPGTSSNITTESHQMTFQFPAAWLTMFDAVLILMLIPLKDKVVDPVLKRRGLLPSSLKRIAVGMFFVMCSAVAAGILETKRLEIVKSNGTINQVLGNVIYYVADLPIWWQVPQYVLIGISEIFASIAGLEFAYSAAPKSMQSAIMGLFFFFSGIGSFVGSGLLAIVSLKAIGWMSSQKDFGNINDCSLHYYFFLLAGIQGVTLLVFL 554          

HSP 2 Score: 90.5077 bits (223), Expect = 1.345e-18
Identity = 58/217 (26.73%), Postives = 100/217 (46.08%), Query Frame = 3
Query:   57 ILSTDKLGSMFLLLAQMLERIVFYSISANFYFTLNSNPLQWTAVNTMSTTFLHSGFCFVFTMVGGILADTVIKKSTTVIIGYIFYIAYVGFIII-FQENKDSD----SNNKLYSL----CSHKTDKISHNIF--DEACSNILIPTVIFCAIGSGLIKSVMASIGSDMAVKYWTYPS-VFFNMYYWSLNVGSLISFAAITFIQQNVSKFYGFLAPGIC 671
            +    +L    +LLA+ LERI FY I++N    LN +P  W          +  G  ++ +  GG LAD  + K  T+    + Y  ++G I   F  N+D+          + +    CS+ T   +      D  C  ++   ++  A+G G +KS +   G+D         +  FFN +YW +N+G+++S   + +IQQN S   G++ P +C
Sbjct:   25 VFQGRRLACAAVLLAESLERIAFYGITSNLVLFLNGSPFYWEGTKASQAPLMFMGITYLISPFGGWLADAYLGKFVTIASSLVLY--FIGMIFFPFIANEDTRIHLCGEESAFPVQPAECSNSTPPKNVTCLYRDPYCGPLIYTGLLLIALGVGTLKSNITPFGADQVKDRGPEATRRFFNWFYWCINLGAILSLGFVAYIQQNFSFELGYIIPTVC 239          
BLAST of slc15a-5 vs. Ensembl Medaka
Match: slc15a4 (solute carrier family 15 member 4 [Source:NCBI gene;Acc:101165813])

HSP 1 Score: 160.229 bits (404), Expect = 7.585e-42
Identity = 106/263 (40.30%), Postives = 157/263 (59.70%), Query Frame = 3
Query: 1023 FLDRSKIRFGGKFSEDDVEDVRKFSTTLILIAFIIPYWLLYFQMETTYMKQGFQL-----NSGVTISSKNLII--PAAWLSMIDILTIMFLLPILVRFVYPYLRKKNLYPDFIFRIVFGMILAVISMIAAGILQIYVDNDIANNRTITRLIGGTYFNQSNISIYSQVPQYFIIGISESQTIVAGLELACTQVPTSMQAVTNXXXXXXXXXXXXXXTALLSFSNLI------------NKEDKNHFYYFFVLAIIQTVFILLLL 1754
             LD +K+ +GGKF E+ VE+V+    TL +   +IPYW +YFQM+TTY+ QG  L     +S +T  S  +    PAAWL+M D + I+ L+P+  + V P L+++ L P  + RI  GM   + S +AAGIL+      + +N TI +++G   +  +++ I+ QVPQY +IGISE    +AGLE A +  P SMQ+   G+F+FFSGIGSF+G+ LL+  +L             N  D +  YYFF+LA IQ V +L+ L
Sbjct:  292 LLDSAKVTYGGKFPEEKVEEVKALLKTLPVFFALIPYWTVYFQMQTTYVLQGLHLRIPGTSSNITTESHQMTFQFPAAWLTMFDAVLILMLIPLKDKVVDPVLKRRGLLPSSLKRIAVGMFFVMCSAVAAGILETKRLEIVKSNGTINQVLGNVIYYVADLPIWWQVPQYVLIGISEIFASIAGLEFAYSAAPKSMQSAIMGLFFFFSGIGSFVGSGLLAIVSLKAIGWMSSQKDFGNINDCSLHYYFFLLAGIQGVTLLVFL 554          

HSP 2 Score: 90.5077 bits (223), Expect = 1.345e-18
Identity = 58/217 (26.73%), Postives = 100/217 (46.08%), Query Frame = 3
Query:   57 ILSTDKLGSMFLLLAQMLERIVFYSISANFYFTLNSNPLQWTAVNTMSTTFLHSGFCFVFTMVGGILADTVIKKSTTVIIGYIFYIAYVGFIII-FQENKDSD----SNNKLYSL----CSHKTDKISHNIF--DEACSNILIPTVIFCAIGSGLIKSVMASIGSDMAVKYWTYPS-VFFNMYYWSLNVGSLISFAAITFIQQNVSKFYGFLAPGIC 671
            +    +L    +LLA+ LERI FY I++N    LN +P  W          +  G  ++ +  GG LAD  + K  T+    + Y  ++G I   F  N+D+          + +    CS+ T   +      D  C  ++   ++  A+G G +KS +   G+D         +  FFN +YW +N+G+++S   + +IQQN S   G++ P +C
Sbjct:   25 VFQGRRLACAAVLLAESLERIAFYGITSNLVLFLNGSPFYWEGTKASQAPLMFMGITYLISPFGGWLADAYLGKFVTIASSLVLY--FIGMIFFPFIANEDTRIHLCGEESAFPVQPAECSNSTPPKNVTCLYRDPYCGPLIYTGLLLIALGVGTLKSNITPFGADQVKDRGPEATRRFFNWFYWCINLGAILSLGFVAYIQQNFSFELGYIIPTVC 239          
BLAST of slc15a-5 vs. Ensembl Medaka
Match: slc15a4 (solute carrier family 15 member 4 [Source:NCBI gene;Acc:101165813])

HSP 1 Score: 140.969 bits (354), Expect = 2.874e-35
Identity = 99/256 (38.67%), Postives = 145/256 (56.64%), Query Frame = 3
Query: 1023 FLDRSKIRFGGKFSEDDVEDVRKFSTTLILIAFIIPYWLLYFQMETTYMKQGFQLNSGVTISSKNLIIPAAWLSMIDILTIMFLLPILVRFVYPYLRKKNLYPDFIFRIVFGMILAVISMIAAGILQIYVDNDIANNRTITRLIGGTYFNQSNISIYSQVPQYFIIGISESQTIVAGLELACTQVPTSMQAVTNXXXXXXXXXXXXXXTALLSFSNLI------------NKEDKNHFYYFFVLAIIQTVFILLLL 1754
             LD +K+ +GGKF E+ VE+V+    TL +   +IPYW +YFQM        FQ              PAAWL+M D + I+ L+P+  + V P L+++ L P  + RI  GM   + S +AAGIL+      + +N TI +++G   +  +++ I+ QVPQY +IGISE    +AGLE A +  P SMQ+   G+F+FFSGIGSF+G+ LL+  +L             N  D +  YYFF+LA IQ V +L+ L
Sbjct:  292 LLDSAKVTYGGKFPEEKVEEVKALLKTLPVFFALIPYWTVYFQMT-------FQF-------------PAAWLTMFDAVLILMLIPLKDKVVDPVLKRRGLLPSSLKRIAVGMFFVMCSAVAAGILETKRLEIVKSNGTINQVLGNVIYYVADLPIWWQVPQYVLIGISEIFASIAGLEFAYSAAPKSMQSAIMGLFFFFSGIGSFVGSGLLAIVSLKAIGWMSSQKDFGNINDCSLHYYFFLLAGIQGVTLLVFL 527          

HSP 2 Score: 90.5077 bits (223), Expect = 1.154e-18
Identity = 58/217 (26.73%), Postives = 100/217 (46.08%), Query Frame = 3
Query:   57 ILSTDKLGSMFLLLAQMLERIVFYSISANFYFTLNSNPLQWTAVNTMSTTFLHSGFCFVFTMVGGILADTVIKKSTTVIIGYIFYIAYVGFIII-FQENKDSD----SNNKLYSL----CSHKTDKISHNIF--DEACSNILIPTVIFCAIGSGLIKSVMASIGSDMAVKYWTYPS-VFFNMYYWSLNVGSLISFAAITFIQQNVSKFYGFLAPGIC 671
            +    +L    +LLA+ LERI FY I++N    LN +P  W          +  G  ++ +  GG LAD  + K  T+    + Y  ++G I   F  N+D+          + +    CS+ T   +      D  C  ++   ++  A+G G +KS +   G+D         +  FFN +YW +N+G+++S   + +IQQN S   G++ P +C
Sbjct:   25 VFQGRRLACAAVLLAESLERIAFYGITSNLVLFLNGSPFYWEGTKASQAPLMFMGITYLISPFGGWLADAYLGKFVTIASSLVLY--FIGMIFFPFIANEDTRIHLCGEESAFPVQPAECSNSTPPKNVTCLYRDPYCGPLIYTGLLLIALGVGTLKSNITPFGADQVKDRGPEATRRFFNWFYWCINLGAILSLGFVAYIQQNFSFELGYIIPTVC 239          
BLAST of slc15a-5 vs. Planmine SMEST
Match: SMESG000042513.1 (SMESG000042513.1)

HSP 1 Score: 1079.32 bits (2790), Expect = 0.000e+0
Identity = 586/591 (99.15%), Postives = 588/591 (99.49%), Query Frame = 3
Query:   51 MKILSTDKLGSMFLLLAQMLERIVFYSISANFYFTLNSNPLQWTAVNTMSTTFLHSGFCFVFTMVGGILADTVIKKSTTVIIGYIFYIAYVGFIIIFQENKDSDSNNKLYSLCSHKTDKISHNIFDEACSNILIPTVIFCAIGSGLIKSVMASIGSDMAVKYWTYPSVFFNMYYWSLNVGSLISFAAITFIQQNVSKFYGFLAPGICXXXXXXXXXXXXPYYVVVPKSSKSTLNLVYRVYFEAFQXXXXXXXXXXXXVTNTATDDPINSTTQASFKTNDINTFYQQRADYPSLNAGYFXXXXXXXXETSTIVETTMSESTSDILFLDRSKIRFGGKFSEDDVEDVRKFSTTLILIAFIIPYWLLYFQMETTYMKQGFQLNSGVTISSKNLIIPAAWLSMIDILTIMFLLPILVRFVYPYLRKKNLYPDFIFRIVFGMILAVISMIAAGILQIYVDNDIANNRTITRLIGGTYFNQSNISIYSQVPQYFIIGISESQTIVAGLELACTQVPTSMQAVTNXXXXXXXXXXXXXXTALLSFSNLINKEDKNHFYYFFVLAIIQTVFILLLLPWIWKIRRNKKIHVITTSSTLTN 1823
            MKILSTDKLGSMFLLLAQMLERIVFYSISANFYFTLNS PLQWTAVNTMSTTFLHSGFCFVFTMVGGILADTVIKKSTTVIIGYIFYIAYVGFIIIFQENKDSDSNNKLYSLCSHKTDKISHNIF+EACSNILIPTVIFCAIGSGLIKSVMASIGSDMAVKYWTYPSVFFNMYYWSLNVGSLISFAAITFIQQNVSKFYGFLAPGICLFLSFVLFLLGLPYYVVVPKSSKSTLNLVYRVYFEAFQKKFSKKKNLSEKVTNTATDDPINSTTQASFKTNDINTFYQQRADYPS NAGYFNDSDNSSDETSTIVETTMSESTSDILFLDRSKIRFGGKFSEDDVEDVRKFSTTLILIAFIIPYWLLYFQMETTYMKQGFQLNSGVTISSKNLIIPAAWLSMIDILTIMFLLPILVRFVYPYLRKKNLYPDFIFRIVFGMILAVISMIAAGILQIYVDNDIANNRTITRLIGGTYFNQSNISIYSQVPQYFIIGISESQTIVAGLELACTQVPTSMQAVTNGIFWF SGIGSFLGTALL+FSNLINKEDKNHFYYFFVLAIIQTVFILLLLPWIWKIRRNKKIHVITTSSTLTN
Sbjct:    1 MKILSTDKLGSMFLLLAQMLERIVFYSISANFYFTLNSKPLQWTAVNTMSTTFLHSGFCFVFTMVGGILADTVIKKSTTVIIGYIFYIAYVGFIIIFQENKDSDSNNKLYSLCSHKTDKISHNIFNEACSNILIPTVIFCAIGSGLIKSVMASIGSDMAVKYWTYPSVFFNMYYWSLNVGSLISFAAITFIQQNVSKFYGFLAPGICLFLSFVLFLLGLPYYVVVPKSSKSTLNLVYRVYFEAFQKKFSKKKNLSEKVTNTATDDPINSTTQASFKTNDINTFYQQRADYPSYNAGYFNDSDNSSDETSTIVETTMSESTSDILFLDRSKIRFGGKFSEDDVEDVRKFSTTLILIAFIIPYWLLYFQMETTYMKQGFQLNSGVTISSKNLIIPAAWLSMIDILTIMFLLPILVRFVYPYLRKKNLYPDFIFRIVFGMILAVISMIAAGILQIYVDNDIANNRTITRLIGGTYFNQSNISIYSQVPQYFIIGISESQTIVAGLELACTQVPTSMQAVTNGIFWFSSGIGSFLGTALLNFSNLINKEDKNHFYYFFVLAIIQTVFILLLLPWIWKIRRNKKIHVITTSSTLTN 591          
BLAST of slc15a-5 vs. Planmine SMEST
Match: SMESG000042513.1 (SMESG000042513.1)

HSP 1 Score: 1043.11 bits (2696), Expect = 0.000e+0
Identity = 568/573 (99.13%), Postives = 570/573 (99.48%), Query Frame = 3
Query:  105 MLERIVFYSISANFYFTLNSNPLQWTAVNTMSTTFLHSGFCFVFTMVGGILADTVIKKSTTVIIGYIFYIAYVGFIIIFQENKDSDSNNKLYSLCSHKTDKISHNIFDEACSNILIPTVIFCAIGSGLIKSVMASIGSDMAVKYWTYPSVFFNMYYWSLNVGSLISFAAITFIQQNVSKFYGFLAPGICXXXXXXXXXXXXPYYVVVPKSSKSTLNLVYRVYFEAFQXXXXXXXXXXXXVTNTATDDPINSTTQASFKTNDINTFYQQRADYPSLNAGYFXXXXXXXXETSTIVETTMSESTSDILFLDRSKIRFGGKFSEDDVEDVRKFSTTLILIAFIIPYWLLYFQMETTYMKQGFQLNSGVTISSKNLIIPAAWLSMIDILTIMFLLPILVRFVYPYLRKKNLYPDFIFRIVFGMILAVISMIAAGILQIYVDNDIANNRTITRLIGGTYFNQSNISIYSQVPQYFIIGISESQTIVAGLELACTQVPTSMQAVTNXXXXXXXXXXXXXXTALLSFSNLINKEDKNHFYYFFVLAIIQTVFILLLLPWIWKIRRNKKIHVITTSSTLTN 1823
            MLERIVFYSISANFYFTLNS PLQWTAVNTMSTTFLHSGFCFVFTMVGGILADTVIKKSTTVIIGYIFYIAYVGFIIIFQENKDSDSNNKLYSLCSHKTDKISHNIF+EACSNILIPTVIFCAIGSGLIKSVMASIGSDMAVKYWTYPSVFFNMYYWSLNVGSLISFAAITFIQQNVSKFYGFLAPGICLFLSFVLFLLGLPYYVVVPKSSKSTLNLVYRVYFEAFQKKFSKKKNLSEKVTNTATDDPINSTTQASFKTNDINTFYQQRADYPS NAGYFNDSDNSSDETSTIVETTMSESTSDILFLDRSKIRFGGKFSEDDVEDVRKFSTTLILIAFIIPYWLLYFQMETTYMKQGFQLNSGVTISSKNLIIPAAWLSMIDILTIMFLLPILVRFVYPYLRKKNLYPDFIFRIVFGMILAVISMIAAGILQIYVDNDIANNRTITRLIGGTYFNQSNISIYSQVPQYFIIGISESQTIVAGLELACTQVPTSMQAVTNGIFWF SGIGSFLGTALL+FSNLINKEDKNHFYYFFVLAIIQTVFILLLLPWIWKIRRNKKIHVITTSSTLTN
Sbjct:    1 MLERIVFYSISANFYFTLNSKPLQWTAVNTMSTTFLHSGFCFVFTMVGGILADTVIKKSTTVIIGYIFYIAYVGFIIIFQENKDSDSNNKLYSLCSHKTDKISHNIFNEACSNILIPTVIFCAIGSGLIKSVMASIGSDMAVKYWTYPSVFFNMYYWSLNVGSLISFAAITFIQQNVSKFYGFLAPGICLFLSFVLFLLGLPYYVVVPKSSKSTLNLVYRVYFEAFQKKFSKKKNLSEKVTNTATDDPINSTTQASFKTNDINTFYQQRADYPSYNAGYFNDSDNSSDETSTIVETTMSESTSDILFLDRSKIRFGGKFSEDDVEDVRKFSTTLILIAFIIPYWLLYFQMETTYMKQGFQLNSGVTISSKNLIIPAAWLSMIDILTIMFLLPILVRFVYPYLRKKNLYPDFIFRIVFGMILAVISMIAAGILQIYVDNDIANNRTITRLIGGTYFNQSNISIYSQVPQYFIIGISESQTIVAGLELACTQVPTSMQAVTNGIFWFSSGIGSFLGTALLNFSNLINKEDKNHFYYFFVLAIIQTVFILLLLPWIWKIRRNKKIHVITTSSTLTN 573          
BLAST of slc15a-5 vs. Planmine SMEST
Match: SMESG000030835.1 (SMESG000030835.1)

HSP 1 Score: 164.466 bits (415), Expect = 9.393e-44
Identity = 137/507 (27.02%), Postives = 244/507 (48.13%), Query Frame = 3
Query:   90 LLLAQMLERIVFYSISANFYFTLNSNPLQWTAVNTMSTTFLHSGFCFVFTMVGGILADTVIKKSTTVIIGYIFYIAYVGFIIIFQENKDSDSNNKLYSLCSHKTDKISHNIFDEACSNILIPTVIFCAIGSGLIKSVMASIGSD-MAVKYWTYPSVFFNMYYWSLNVGSLISFAAITFIQQNVSKFYGFLAPGICXXXXXXXXXXXXPYYVVVP--KSSKSTLNLVYRVYFEAFQXXXXXXXXXXXXVTNTATDDPINSTTQASFKTNDINTFYQQRADYPSLNAGYFXXXXXXXXETSTIVETTMSESTSDILFLDRSKIRFGGKFSEDDVEDVRKFSTTLILIAFIIPYWLLYFQMETTYMKQGFQLNSGVTISSKNLIIPAAWLSMIDILTIMFLLPILVRFVYPYLRKK-NLYPDFIFRIVFGMILAVISMIAAGILQIYVDNDIANNRTITRLIGGTYFNQSNISIYSQVPQYFIIGISESQTIVAGLELACTQVPTSMQAV 1598
            +L+ ++ ER+ FYSISANF     +  LQ   V  M+ + + +G  ++ T+  G ++D+V+ K  T+I+  I Y  ++G ++I      S+   K+    + +       +             +F  I +G IKS +   G++ +  K      +FF  YYW +N+GS I+F  +T++QQN++ F GF+ P + + ++ VLF++   +Y      K++ S    V  +++EAFQ                         +++ +K       Y Q  DY SL+ G                                      G + +  + D RK    + ++   IP+++ Y QM++TY+ Q  +LN  ++      +IP A L++++ + I+F++P+L   VYP L K     P+ + RI  G+ L+ +S+IAAG+L+IY  ++I +   I + +    +N S+IS+ +Q+PQ+F +G  E      GLE A +Q P SMQAV
Sbjct:   19 ILVFELCERLTFYSISANFV-RFCTIFLQVDNVTAMNMSLIFTGSIYIVTLFCGWISDSVLGKFKTIILSGIIY--FIGVLLITAVTFQSEPRLKITLSLTLRRVLTGFGL-------------VFIGIATGGIKSTVGPFGAEQLDQKNENITRLFFIWYYWFVNLGSAIAFLGVTYVQQNINFFIGFIIPLVSISVAMVLFIIPHRFYKRNESFKNTSSIFTYV-SIFWEAFQ-----------------------RRSRSIYK-------YSQFLDYASLSNG--------------------------------------GSYDDTVIADFRKTIRIIPVLLTFIPFYIAYSQMQSTYLLQAERLNLNIS----TFVIPVASLNVVNTVVILFIIPLLAILVYPILNKCFKASPNHLKRIALGLFLSSLSVIAAGVLEIYRKDEIRDTGGIPQTVFNKSYNVSHISVLAQIPQFFFVGSGEVFASATGLEFAYSQAPVSMQAV 436          
The following BLAST results are available for this feature:
BLAST of slc15a-5 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC15A41.235e-3739.33solute carrier family 15 member 4 [Source:HGNC Sym... [more]
SLC15A31.243e-2332.57solute carrier family 15 member 3 [Source:HGNC Sym... [more]
SLC15A32.080e-1931.05solute carrier family 15 member 3 [Source:HGNC Sym... [more]
SLC15A31.038e-1127.23solute carrier family 15 member 3 [Source:HGNC Sym... [more]
SLC15A43.629e-922.53solute carrier family 15 member 4 [Source:HGNC Sym... [more]
back to top
BLAST of slc15a-5 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc15a-5 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc15a-5 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
slc15a41.278e-3738.78solute carrier family 15 member 4 [Source:ZFIN;Acc... [more]
SLC15A52.431e-724.87si:ch211-190o6.3 [Source:ZFIN;Acc:ZDB-GENE-131121-... [more]
SLC15A53.146e-724.87si:ch211-190o6.3 [Source:ZFIN;Acc:ZDB-GENE-131121-... [more]
SLC15A56.541e-724.87si:ch211-190o6.3 [Source:ZFIN;Acc:ZDB-GENE-131121-... [more]
back to top
BLAST of slc15a-5 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
slc9a3r12.571e-3940.39SLC9A3 regulator 1 [Source:Xenbase;Acc:XB-GENE-487... [more]
back to top
BLAST of slc15a-5 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc15a43.719e-4039.62solute carrier family 15, member 4 [Source:MGI Sym... [more]
Slc15a31.005e-2729.86solute carrier family 15, member 3 [Source:MGI Sym... [more]
Slc15a42.953e-2339.52solute carrier family 15, member 4 [Source:MGI Sym... [more]
Slc15a41.995e-1826.60solute carrier family 15, member 4 [Source:MGI Sym... [more]
Slc15a41.177e-1342.50solute carrier family 15, member 4 [Source:MGI Sym... [more]
back to top
BLAST of slc15a-5 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A6QQL0|S15A4_BOVIN7.043e-5329.09Solute carrier family 15 member 4 OS=Bos taurus OX... [more]
sp|O09014|S15A4_RAT1.256e-3938.68Solute carrier family 15 member 4 OS=Rattus norveg... [more]
sp|Q91W98|S15A4_MOUSE2.601e-3939.62Solute carrier family 15 member 4 OS=Mus musculus ... [more]
sp|Q68F72|S15A4_XENLA2.766e-3840.39Solute carrier family 15 member 4 OS=Xenopus laevi... [more]
sp|Q8N697|S15A4_HUMAN5.928e-3739.33Solute carrier family 15 member 4 OS=Homo sapiens ... [more]
back to top
BLAST of slc15a-5 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YIZ00.000e+0100.00Slc15a-5 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
K1RF998.415e-7530.03Solute carrier family 15 member 4 OS=Crassostrea g... [more]
A0A210QH826.595e-6328.90Solute carrier family 15 member 4 OS=Mizuhopecten ... [more]
A0A3M7SSZ31.154e-6033.62Solute carrier family 15 member 4 OS=Brachionus pl... [more]
R7UDG96.511e-6030.95Uncharacterized protein OS=Capitella teleta OX=283... [more]
back to top
BLAST of slc15a-5 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
slc15a41.863e-3739.47solute carrier family 15 member 4 [Source:NCBI gen... [more]
slc15a48.306e-3538.50solute carrier family 15 member 4 [Source:NCBI gen... [more]
back to top
BLAST of slc15a-5 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000005298.11.409e-2033.18pep scaffold:Pmarinus_7.0:GL477384:58393:77162:-1 ... [more]
back to top
BLAST of slc15a-5 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
PTR21.443e-924.46Integral membrane peptide transporter; mediates tr... [more]
back to top
BLAST of slc15a-5 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO373723.855e-3836.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO471312.272e-3030.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO331761.006e-2834.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc15a-5 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
slc15a44.116e-4240.15solute carrier family 15 member 4 [Source:NCBI gen... [more]
slc15a47.585e-4240.30solute carrier family 15 member 4 [Source:NCBI gen... [more]
slc15a47.585e-4240.30solute carrier family 15 member 4 [Source:NCBI gen... [more]
slc15a42.874e-3538.67solute carrier family 15 member 4 [Source:NCBI gen... [more]
back to top
BLAST of slc15a-5 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000042513.10.000e+099.15SMESG000042513.1[more]
SMESG000042513.10.000e+099.13SMESG000042513.1[more]
SMESG000030835.19.393e-4427.02SMESG000030835.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30011823
GenBankAKN21491.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011823 ID=SMED30011823|Name=slc15a-5|organism=Schmidtea mediterranea sexual|type=transcript|length=1852bp
CTATATAAATCTTATATGAATATTGTTACACGAAATTATATTCGTAAGAT
ATGAAGATTCTAAGTACTGATAAGCTAGGAAGTATGTTTTTACTACTAGC
GCAAATGTTAGAGCGAATTGTTTTTTATTCAATATCAGCAAATTTCTATT
TCACTCTTAATTCAAACCCATTGCAATGGACCGCTGTTAACACAATGAGT
ACTACATTTCTTCACAGTGGATTTTGTTTTGTTTTTACAATGGTTGGTGG
AATACTCGCAGACACAGTTATCAAGAAATCTACTACTGTCATCATTGGAT
ATATATTTTACATAGCATATGTTGGATTTATTATAATATTCCAGGAAAAT
AAAGATTCAGATTCAAATAACAAGCTTTATTCATTATGTAGTCACAAAAC
TGATAAGATATCACATAATATATTTGACGAAGCGTGTTCAAATATTCTGA
TTCCAACTGTTATATTTTGTGCAATCGGATCCGGTTTGATCAAGTCCGTT
ATGGCTAGCATTGGATCTGACATGGCGGTTAAATATTGGACTTATCCATC
GGTATTTTTCAATATGTACTATTGGTCATTGAATGTTGGGAGCCTTATTT
CTTTTGCAGCTATTACTTTTATACAACAGAATGTGTCAAAGTTTTATGGA
TTTTTAGCTCCTGGTATTTGTTTATTCCTTTCTTTCGTCCTTTTCTTATT
AGGATTGCCATATTATGTAGTTGTTCCAAAATCGAGTAAAAGTACTCTGA
ATTTAGTTTATAGAGTATACTTTGAGGCTTTTCAAAAGAAATTCAGTAAG
AAAAAGAATTTGTCTGAAAAAGTGACAAATACTGCCACTGATGACCCAAT
AAACTCAACAACTCAAGCAAGTTTCAAAACAAATGATATTAACACCTTTT
ATCAACAAAGAGCAGATTATCCAAGTTTGAATGCCGGATATTTTAATGAT
TCCGATAATTCTTCGGACGAAACTTCAACCATTGTAGAAACGACAATGTC
TGAATCTACCAGTGATATACTATTCCTTGATCGAAGCAAAATCAGATTTG
GTGGTAAATTTTCCGAAGACGATGTTGAAGATGTCCGGAAATTTTCAACC
ACACTTATTTTAATAGCTTTTATAATACCTTATTGGCTACTTTATTTTCA
AATGGAGACCACATATATGAAACAAGGTTTTCAATTGAATTCTGGAGTGA
CTATAAGCTCCAAAAATTTGATCATTCCTGCGGCGTGGCTGTCTATGATT
GATATACTTACAATAATGTTTCTTTTGCCTATTTTAGTTCGCTTCGTTTA
TCCCTATTTACGGAAAAAGAACTTATACCCCGATTTTATATTTAGAATTG
TATTTGGCATGATTCTAGCTGTTATATCCATGATCGCAGCGGGGATTCTC
CAGATTTACGTGGACAATGACATTGCCAACAATCGGACGATTACTCGATT
GATAGGTGGAACTTATTTCAACCAATCAAATATATCTATTTATAGTCAAG
TTCCCCAATATTTTATTATAGGAATTAGTGAATCACAGACTATTGTAGCA
GGACTTGAGTTAGCATGTACACAAGTGCCAACCTCAATGCAAGCGGTCAC
CAATGGTATCTTTTGGTTTTTTAGTGGAATAGGAAGTTTTTTAGGAACTG
CTCTTCTAAGTTTTTCCAATTTAATTAATAAAGAAGATAAAAACCACTTC
TATTATTTTTTCGTATTGGCAATAATTCAAACAGTATTTATATTACTGTT
GTTACCATGGATTTGGAAAATAAGAAGAAACAAAAAGATCCATGTTATAA
CCACTTCATCAACTTTAACAAATTGAGATTAATTTTTTGTACTATTTTTA
TA
back to top

protein sequence of SMED30011823-orf-1

>SMED30011823-orf-1 ID=SMED30011823-orf-1|Name=SMED30011823-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=592bp
MKILSTDKLGSMFLLLAQMLERIVFYSISANFYFTLNSNPLQWTAVNTMS
TTFLHSGFCFVFTMVGGILADTVIKKSTTVIIGYIFYIAYVGFIIIFQEN
KDSDSNNKLYSLCSHKTDKISHNIFDEACSNILIPTVIFCAIGSGLIKSV
MASIGSDMAVKYWTYPSVFFNMYYWSLNVGSLISFAAITFIQQNVSKFYG
FLAPGICLFLSFVLFLLGLPYYVVVPKSSKSTLNLVYRVYFEAFQKKFSK
KKNLSEKVTNTATDDPINSTTQASFKTNDINTFYQQRADYPSLNAGYFND
SDNSSDETSTIVETTMSESTSDILFLDRSKIRFGGKFSEDDVEDVRKFST
TLILIAFIIPYWLLYFQMETTYMKQGFQLNSGVTISSKNLIIPAAWLSMI
DILTIMFLLPILVRFVYPYLRKKNLYPDFIFRIVFGMILAVISMIAAGIL
QIYVDNDIANNRTITRLIGGTYFNQSNISIYSQVPQYFIIGISESQTIVA
GLELACTQVPTSMQAVTNGIFWFFSGIGSFLGTALLSFSNLINKEDKNHF
YYFFVLAIIQTVFILLLLPWIWKIRRNKKIHVITTSSTLTN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0022857transmembrane transporter activity
GO:0005215transporter activity
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
GO:0006810transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036259MFS_trans_sf
IPR000109POT_fam
IPR020846MFS_dom
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.20.1250.20coord: 8..589
e-value: 5.1E-98
score: 330.8
NoneNo IPR availablePANTHERPTHR11654:SF80SOLUTE CARRIER FAMILY 15 MEMBER 4coord: 13..258
coord: 316..568
NoneNo IPR availableCDDcd17348MFS_SLC15A3_4coord: 14..569
e-value: 4.93245E-56
score: 193.467
NoneNo IPR availableTMHMMTMhelixcoord: 395..417
NoneNo IPR availableTMHMMTMhelixcoord: 198..220
NoneNo IPR availableTMHMMTMhelixcoord: 52..74
NoneNo IPR availableTMHMMTMhelixcoord: 78..97
NoneNo IPR availableTMHMMTMhelixcoord: 348..365
NoneNo IPR availableTMHMMTMhelixcoord: 550..572
NoneNo IPR availableTMHMMTMhelixcoord: 518..540
NoneNo IPR availableTMHMMTMhelixcoord: 132..154
NoneNo IPR availableTMHMMTMhelixcoord: 432..454
NoneNo IPR availableTMHMMTMhelixcoord: 10..32
NoneNo IPR availableTMHMMTMhelixcoord: 169..191
IPR000109Proton-dependent oligopeptide transporter familyPFAMPF00854PTR2coord: 91..544
e-value: 1.4E-58
score: 198.7
IPR000109Proton-dependent oligopeptide transporter familyPANTHERPTHR11654OLIGOPEPTIDE TRANSPORTER-RELATEDcoord: 316..568
coord: 13..258
IPR036259MFS transporter superfamilySUPERFAMILYSSF103473MFS general substrate transportercoord: 13..577