slc22a-7

Overview
Nameslc22a-7 (AKN21555.1)
Smed IDSMED30011820
Length (bp)1666
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc22a-7 (SMED30011820) t-SNE clustered cells

Violin plots show distribution of expression levels for slc22a-7 (SMED30011820) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc22a-7 (SMED30011820) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc22a-7 (SMED30011820) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011820

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30011820SMESG000025785.1 DN312863ncbi_smed_estsPMID:30399335
Ross et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30011820SMESG000025785.1 DN312863ncbi_smed_estsPMID:30399335
Ross et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30011820SMESG000025785.1 dd_Smed_v4_12284_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30011820SMESG000025785.1 dd_Smed_v4_12284_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc22a-7 vs. Ensembl Human
Match: SLC22A4 (solute carrier family 22 member 4 [Source:HGNC Symbol;Acc:HGNC:10968])

HSP 1 Score: 91.2781 bits (225), Expect = 9.947e-19
Identity = 106/446 (23.77%), Postives = 207/446 (46.41%), Query Frame = 3
Query:  186 NFTCQYNETSHQIQISKDQCTMTINGSNVKCQHWTFSSEPFGKTIMSDYDLVCDYKYVGDLLVLLWYSTSLMAP-VFGWLADKYGRKMISIIFLSIETVATFILAFTPNLSSHIFFRLCIGFSE-SAYHICYVWLMEMVNKDFRNV-----AGSFFWLYGSVAMTVFPLTVYVTRNWRLTQLISLTPSILYV-LILFVPESPRWLCVKNKKQQLMESLQTIANINKMDLQLTPXXXXXXXXXXXSNK---WNAFKDNNFLFLASTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMFVLGLMEFPGALLSYLSMYFFKRKRMITIFSMFGSIFIFLSVTLSKVDKW-QSIFRMIFGSIGKVLVITSSQGVL-VYATELFPTTHRSLFFGMLQIILLMAMTAAVYINKLNQFYGFIPMLIYFLLNMISCCLIFVFMPETKGLPIPETI 1484
            NF+    E    + + + +    ++G       W FS + +  T++++++LVC+  +   L   L++   L+   V G L+D++GRK +    ++++T  +F+  F+ +        + +G  + S Y + ++   E++ K  R +       +FF    +V   + PL  Y  R+WR+  L    P +L V L  F+PESPRWL  + + ++  + +Q  A +N + +     +   E    +  K    + F+  N   +   SL      S+   A+ +D   L  + Y++ F+  L+E P  + ++L +    R+ +I     +G   + L + L  VD +  SI  ++ G  G    ITS+  +L V+  EL+PT  R++  G+      +    A Y   L  +   +P ++   L ++   L  +F PE+ G+ +PET+
Sbjct:   91 NFSALGLEPGRDVDLGQLEQESCLDG-------WEFSQDVYLSTVVTEWNLVCEDNWKVPLTTSLFFVGVLLGSFVSGQLSDRFGRKNVLFATMAVQTGFSFLQIFSISWEMFTVLFVIVGMGQISNYVVAFILGTEILGKSVRIIFSTLGVCTFF----AVGYMLLPLFAYFIRDWRMLLLALTVPGVLCVPLWWFIPESPRWLISQRRFREAEDIIQKAAKMNNIAVPAVIFDSVEELNPLKQQKAFILDLFRTRNIAIMTIMSLLLWMLTSVGYFALSLDAPNLHGDAYLNCFLSALIEIPAYITAWLLLRTLPRRYIIAAVLFWGG-GVLLFIQLVPVDYYFLSIGLVMLGKFG----ITSAFSMLYVFTAELYPTLVRNMAVGVTSTASRVGSIIAPYFVYLGAYNRMLPYIVMGSLTVLIGILT-LFFPESLGMTLPETL 519          
BLAST of slc22a-7 vs. Ensembl Human
Match: SLC22A13 (solute carrier family 22 member 13 [Source:HGNC Symbol;Acc:HGNC:8494])

HSP 1 Score: 88.5817 bits (218), Expect = 6.707e-18
Identity = 116/495 (23.43%), Postives = 205/495 (41.41%), Query Frame = 3
Query:   84 KKDTFKVIAF--LILSLPAFQYGSQFQNLLVSIQTPNFTCQYNETSHQIQISKDQCTMTINGSNVKCQHWTFSSEPFGKTIMSDYDLVCDYKYVGDLLVLLWYSTSLMAPV-FGWLADKYGRKMISIIFLSIETVATFILAFTPNLSSHIFFRLCIGFSESAYHICYVWLM-EMVNKDFRNVAGSFFWLYGSVAMTVFPLTVYVTRNWRLTQLISLTPSILYVLILF-VPESPRWLCVKNKKQQLMESLQTIANINKMDL------QLTPXXXXXXXXXXXSNKWNAFKDNNFLFLASTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMFVLGLMEFPGALLSYLSMYFFKRK----RMITIFSMFGSIFIFLSVTLSKVDKWQSIFRMIFGSIGKVLVITSSQGVLVYATELFPTTHRSLFFGMLQIILLMAMTAAVYINKLNQFYGFIPMLIYFLLNMISCCLIFVFMPETKGLPIPETIFDQRLLVKEREQE 1523
            K  TF + A   L+LS+P    G     L+      N + Q +  SH+   ++  C M           W +       ++ ++++LVCD K++ D    ++ +  L+  + FG L D+ GRK   +  L + T+     AF P+   ++  R  +  + +      V L+ E V   +R  A        S+   V     Y  RNWRL Q+    P +L     + +PES RWL  + +  + ++ +Q  A++N+  L      QL P     EKT    N  + F+      +        F  S+    + + +     ++Y++  + G +E P    S   M  F RK      + +  +   I IF+   L  V    ++       +GK+    +     VY+ ELFPT  R    G++ I   +       +  L +++  +PMLIY  L +++  L+   +PET G  + +T+ D  L    R  +
Sbjct:   56 KNHTFNLSAAEQLVLSVPLDTAGHPEPCLMFRPPPANASLQ-DILSHRFNETQP-CDMG----------WEYPENRL-PSLKNEFNLVCDRKHLKDTTQSVFMAGLLVGTLMFGPLCDRIGRKATILAQLLLFTLIGLATAFVPSFELYMALRFAVATAVAGLSFSNVTLLTEWVGPSWRTQAVVLAQCNFSLGQMVLAGLAYGFRNWRLLQITGTAPGLLLFFYFWALPESARWLLTRGRMDEAIQLIQKAASVNRRKLSPELMNQLVP-----EKTGPSGNALDLFRHPQLRKVTLIIFCVWFVDSLGYYGLSLQVGDFGLDVYLTQLIFGAVEVPARCSSIFMMQRFGRKWSQLGTLVLGGLMCIIIIFIPADLPVVVTMLAV-------VGKMATAAAFTISYVYSAELFPTILRQTGMGLVGIFSRIGGILTPLVILLGEYHAALPMLIYGSLPIVA-GLLCTLLPETHGQGLKDTLQDLELGPHPRSPK 524          
BLAST of slc22a-7 vs. Ensembl Human
Match: SLC22A3 (solute carrier family 22 member 3 [Source:HGNC Symbol;Acc:HGNC:10967])

HSP 1 Score: 87.8113 bits (216), Expect = 1.098e-17
Identity = 58/180 (32.22%), Postives = 94/180 (52.22%), Query Frame = 3
Query:  312 KTIMSDYDLVCDYKYVGDL---LVLLWYSTSLMAPVFGWLADKYGRKMISIIFLSIETVATFILAFTPNLSSHIFFRLCIG-FSESAYHICYVWLMEMVNKDFRNVAGSFFWLYGSVAMTVFPLTVYVTRNWRLTQLISLTPSILYVLILFV-PESPRWLCVKNKKQQLMESLQTIANIN 836
             TI+S++DLVC   ++ DL   ++ L + T   A   G+ AD+YGR +I ++      V   ++AF PN    + FR   G F +  +  CYV + E+V    R + G    ++ ++ + + P   Y   NW+  QL    PS L++L  +V PESPRWL  + K  + ++ L+ IA  N
Sbjct:  138 STIVSEFDLVCVNAWMLDLTQAILNLGFLTG--AFTLGYAADRYGRIVIYLLSCLGVGVTGVVVAFAPNFPVFVIFRFLQGVFGKGTWMTCYVIVTEIVGSKQRRIVGIVIQMFFTLGIIILPGIAYFIPNWQGIQLAITLPSFLFLLYYWVVPESPRWLITRKKGDKALQILRRIAKCN 315          

HSP 2 Score: 55.0694 bits (131), Expect = 2.663e-7
Identity = 42/161 (26.09%), Postives = 81/161 (50.31%), Query Frame = 3
Query: 1038 FVLGLMEFPGALLSYLSMYFFKRKRMITIFSMFGSIFIFLSVTLSKVDKWQSIFRMIFGSIGKVLVITSSQGVLVYATELFPTTHRSL----------FFGMLQIILLMAMTAAVYINKLNQFYGFIPMLIYFLLNMISCCLIFVFMPETKGLPIPETIFD 1490
            F+ G++E PGALL  L++    R+      ++   +   ++  L +   W    R    ++G++ +  + + V +  +EL+PTT R+           F G++   LL  + AAV++         +P++I+ +L  I C  + + +PETKG+ +PET+ D
Sbjct:  384 FISGVVELPGALLILLTIERLGRRLPFAASNIVAGVACLVTAFLPEGIAW---LRTTVATLGRLGITMAFEIVYLVNSELYPTTLRNFGVSLCSGLCDFGGIIAPFLLFRL-AAVWLE--------LPLIIFGILASI-CGGLVMLLPETKGIALPETVDD 531          
BLAST of slc22a-7 vs. Ensembl Human
Match: SLC22A15 (solute carrier family 22 member 15 [Source:HGNC Symbol;Acc:HGNC:20301])

HSP 1 Score: 87.4261 bits (215), Expect = 1.552e-17
Identity = 109/454 (24.01%), Postives = 207/454 (45.59%), Query Frame = 3
Query:  204 NETSHQIQISKDQC----TMTINGSNVKCQHWTFSSEPFGKTIMSDYDLVCDYKYVGDLLVLLWYSTSLMAPV-FGWLADKYGRKMISIIFLSIETVATFILAFTPNLSSHIFFRLCIGFSESAYH-ICYVWLMEMVNKDFRNVAGSFFWLYGSVAMTVFPLTVYVTRNWR-LTQLISLTPSILYVLILFVPESPRWLCVKNKKQQLMESLQTIANIN-KMDLQLTPXXXXXXXXXXXSNKWNAFKDNNFLFLASTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMFVLGLMEFPG-ALLSYL-SMYFFKRKRMITIFSMFGSIFIFLSVTLSKVDKWQSIFRMI----FGSIGKVLVITSSQGVLVYATELFPTTHRSLFFGMLQIILLMAMTAAVYINKLNQFYGFIPMLIYFLLNMISCCLIFVFMPETKGLPIPETIFDQRLLVKEREQE 1523
            N++       +DQ      +T NGS +  +H  FSS     +I S++ L+ +  Y        ++S   +  + FG L+D++GRK + +   +++ +      F+P+       R  +G        + +V L E V   +  +AGS   L+ +V +  + L  Y  R+WR L  L++L  +++++L LF+PESPRWL  + +  +  E+L  IA  N K+    +          +  +  + F+    L      +F  F  S++   + +    L  +IY ++ + GL+E P   L  YL +  +F RKR ++ F   G +   + + L +  K   +F ++       +GK+ +  +   V +Y +EL+PT  R++  G   +   +    A +I  L      +P ++ F    ++  L+ + +PET   P+ ET  D ++    R  E
Sbjct:   58 NQSHGNQSAGEDQAFGDWLLTANGSEIH-KHVHFSSSF--TSIASEWFLIANRSYKVSAASSFFFSGVFVGVISFGQLSDRFGRKKVYLTGFALDILFAIANGFSPSYEFFAVTRFLVGMMNGGMSLVAFVLLNECVGTAYWALAGSIGGLFFAVGIAQYALLGYFIRSWRTLAILVNLQGTVVFLLSLFIPESPRWLYSQGRLSEAEEALYLIAKRNRKLKCTFSLTHPANRSCRETGSFLDLFRYRVLLGHTLILMFIWFVCSLVYYGLTLSAGDLGGSIYANLALSGLIEIPSYPLCIYLINQKWFGRKRTLSAFLCLGGLACLIVMFLPE-KKDTGVFAVVNSHSLSLLGKLTISAAFNIVYIYTSELYPTVIRNVGLGTCSMFSRVGGIIAPFIPSLKYVQWSLPFIV-FGATGLTSGLLSLLLPETLNSPLLETFSDLQVYSYRRLGE 506          
BLAST of slc22a-7 vs. Ensembl Human
Match: SLC22A2 (solute carrier family 22 member 2 [Source:HGNC Symbol;Acc:HGNC:10966])

HSP 1 Score: 85.1149 bits (209), Expect = 2.152e-17
Identity = 54/191 (28.27%), Postives = 98/191 (51.31%), Query Frame = 3
Query:  300 EPFGKTIMSDYDLVCDYKYVGDLLVLLWYSTSLMAPVF------GWLADKYGRKMISIIFLSIETVATFILAFTPNLSSHIFFRLCIGF-SESAYHICYVWLMEMVNKDFRNVAGSFFWLYGSVAMTVFPLTVYVTRNWRLTQLISLTPSILYVLILF-VPESPRWLCVKNKKQQLMESLQTIANINKMDL 848
            E  G +I+++++LVC   ++ DL     + +S+    F      G++AD++GRK+  +  + I   A  ++A +P  +  + FRL  G  S++ + I Y+ + E V + +R   G F+ +  +V + V     Y   +WR  Q     P+  ++L  + +PESPRWL  +NK  + M  ++ IA  N   L
Sbjct:  108 ETPGSSIVTEFNLVCANSWMLDL-----FQSSVNVGFFIGSMSIGYIADRFGRKLCLLTTVLINAAAGVLMAISPTYTWMLIFRLIQGLVSKAGWLIGYILITEFVGRRYRRTVGIFYQVAYTVGLLVLAGVAYALPHWRWLQFTVSLPNFFFLLYYWCIPESPRWLISQNKNAEAMRIIKHIAKKNGKSL 293          
BLAST of slc22a-7 vs. Ensembl Celegans
Match: C06H5.6 (pep chromosome:WBcel235:V:17879844:17888968:-1 gene:WBGene00007394.1 transcript:C06H5.6a.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C06H5.6)

HSP 1 Score: 97.4413 bits (241), Expect = 3.331e-21
Identity = 116/478 (24.27%), Postives = 221/478 (46.23%), Query Frame = 3
Query:  171 SIQTPNFTCQYNETSHQIQISKDQCTMTINGSNVKCQHWTFSSEPFGKTIMSDYDLVCDYKYVGDLLVLLWYSTSLM-APVFGWLADKYGRKMISIIFLSIETVATFILAFTPNLSSHIFFRLCIGFSESAYHIC-YVWLMEMVNKDFRN---VAGSFFWLYGSVAMTVFPLTVYVT-RNWRLTQLISLTPSILYVLIL-FVPESPRWLCVKNK----KQQLMESL----QTIA-----NINKMDLQLTPXXXXXXXXXXXSNKWNAFKDNNFLFLASTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMFVLGLMEFPGALLSYLSMYFFKRKRMITIFSM-FGSIFIFLSVTLSKVDKWQSIFRMIFGSIGKVLVITSSQGVLVYATELFPTTHRSLFFGMLQIILLMAMTAAVYINKLNQFYGFIPMLIYFLLNMISCCLIFVFMPETKGLPIPETI--FDQRLLVKE-REQEYLE 1532
            SI + +F+    ++ H   +   Q  +TI+   V    + + ++    TI SD+DLVC+Y+ + +    ++    ++ +P    L+D  GR+ + +I L I   A  I A  PN    + FR   G + +++ +  +V  ME V+ +FR+   V  +  W+ G +   VF    YV  +NWR+    +  P +L +    F PES  WL  K      K+ + ES+    QTI+     NI  +D      + +  +       +     N+F+ +  +  +   S+     +                F+ GL+E P   LS   +  FKRK  ++ +S+ F ++F+  +V +     ++ IF ++  S     ++ +SQ +L   +E  PTT R++F G++  +  +    A Y+N+L       P ++  ++++++  L+ +  PETK   +PE +  FD   L +  ++Q+ LE
Sbjct:   80 SIDSAHFSPLVGDSCH---LQDTQLNITIDCLAVNGASYNYLADK-KSTITSDFDLVCEYQGMAEHATSIFLVGGMIVSPFVSQLSDILGRRPLFLIPLYISVAANLICAAAPNYLIFLLFRFISGVATTSFSMTGFVLCMESVSLEFRSLIPVLTTISWVGGYMLAGVF----YVFFKNWRVLYFAASVPGLLTIPFFWFTPESLHWLMTKQNDRKIKKYINESVAFNKQTISLIDCRNIQTVDNAPATTKTRTFRALFYPKIFVHVVINSFILIVMSGTYWALSLYSTELSEDETTGY---------FLSGLVELPAGFLSVFLLIAFKRKT-VSFYSLAFTAVFMLCTVYIPMQGNYKMIFPLLAKSTNS--IVWASQPLLY--SEATPTTIRNVFSGVVSFVGELGSIGAPYMNRLTAINQDAPAILISIMSIVAAFLV-LLQPETKNKKLPEDLDQFDAGPLFRGWKKQKDLE 534          
BLAST of slc22a-7 vs. Ensembl Celegans
Match: C06H5.6 (pep chromosome:WBcel235:V:17879844:17888984:-1 gene:WBGene00007394.1 transcript:C06H5.6a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C06H5.6)

HSP 1 Score: 97.4413 bits (241), Expect = 3.331e-21
Identity = 116/478 (24.27%), Postives = 221/478 (46.23%), Query Frame = 3
Query:  171 SIQTPNFTCQYNETSHQIQISKDQCTMTINGSNVKCQHWTFSSEPFGKTIMSDYDLVCDYKYVGDLLVLLWYSTSLM-APVFGWLADKYGRKMISIIFLSIETVATFILAFTPNLSSHIFFRLCIGFSESAYHIC-YVWLMEMVNKDFRN---VAGSFFWLYGSVAMTVFPLTVYVT-RNWRLTQLISLTPSILYVLIL-FVPESPRWLCVKNK----KQQLMESL----QTIA-----NINKMDLQLTPXXXXXXXXXXXSNKWNAFKDNNFLFLASTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMFVLGLMEFPGALLSYLSMYFFKRKRMITIFSM-FGSIFIFLSVTLSKVDKWQSIFRMIFGSIGKVLVITSSQGVLVYATELFPTTHRSLFFGMLQIILLMAMTAAVYINKLNQFYGFIPMLIYFLLNMISCCLIFVFMPETKGLPIPETI--FDQRLLVKE-REQEYLE 1532
            SI + +F+    ++ H   +   Q  +TI+   V    + + ++    TI SD+DLVC+Y+ + +    ++    ++ +P    L+D  GR+ + +I L I   A  I A  PN    + FR   G + +++ +  +V  ME V+ +FR+   V  +  W+ G +   VF    YV  +NWR+    +  P +L +    F PES  WL  K      K+ + ES+    QTI+     NI  +D      + +  +       +     N+F+ +  +  +   S+     +                F+ GL+E P   LS   +  FKRK  ++ +S+ F ++F+  +V +     ++ IF ++  S     ++ +SQ +L   +E  PTT R++F G++  +  +    A Y+N+L       P ++  ++++++  L+ +  PETK   +PE +  FD   L +  ++Q+ LE
Sbjct:   80 SIDSAHFSPLVGDSCH---LQDTQLNITIDCLAVNGASYNYLADK-KSTITSDFDLVCEYQGMAEHATSIFLVGGMIVSPFVSQLSDILGRRPLFLIPLYISVAANLICAAAPNYLIFLLFRFISGVATTSFSMTGFVLCMESVSLEFRSLIPVLTTISWVGGYMLAGVF----YVFFKNWRVLYFAASVPGLLTIPFFWFTPESLHWLMTKQNDRKIKKYINESVAFNKQTISLIDCRNIQTVDNAPATTKTRTFRALFYPKIFVHVVINSFILIVMSGTYWALSLYSTELSEDETTGY---------FLSGLVELPAGFLSVFLLIAFKRKT-VSFYSLAFTAVFMLCTVYIPMQGNYKMIFPLLAKSTNS--IVWASQPLLY--SEATPTTIRNVFSGVVSFVGELGSIGAPYMNRLTAINQDAPAILISIMSIVAAFLV-LLQPETKNKKLPEDLDQFDAGPLFRGWKKQKDLE 534          
BLAST of slc22a-7 vs. Ensembl Celegans
Match: B0361.11 (Putative transporter B0361.11 [Source:UniProtKB/Swiss-Prot;Acc:Q7Z118])

HSP 1 Score: 93.5893 bits (231), Expect = 6.524e-20
Identity = 110/446 (24.66%), Postives = 200/446 (44.84%), Query Frame = 3
Query:  195 CQY-NET-----SHQIQISKDQCTMTINGSNVKCQHWTF---SSEPFGKTIMSDYDLVCDYKYVGDLLVLLWYSTSLMA-PVFGWLADKYGRKMISIIFLSIETVATFILAFTPNLSSHIFFRLCIGFSESAY-HICYVWLMEMVNKDFRNVAGSFFWLYGSVAMTVFPLTVYVTRNWRLTQLISLTPSIL-YVLILFVPESPRWLCVKNKKQQLMESLQTIANINKMDLQLTPXXXXXXXXXXXSNKWNAFK----DNNFLFLASTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMFVLGLMEFPGALLSYLSMYFFKRKRMITIFSMFGSIFIFLSVTLSKVDKWQSIFRMIFGSIGKVLVITSSQGVLVYATELFPTTHRSLFFGMLQIILLMAMTAAVYINKLNQFYGFIPMLIYFLLNMISCCLIFVFMPETKGLPIPETI 1484
            C+Y NET     + QI+    +    +NG        T    +++     ++ D+DL C + +  +  + ++   +++A P    LAD+YGRK I +    +  +A    +F+PN +  +  R  IG    +Y  +  V   E +++  R      + +  S+ M    L   +T +WR    I   P +  + L  F+PESP WL  KNK ++L + ++T   +N     ++PE    ++++    K  +FK        ++L   + F    IS++  AI      L  +   +     L+E P  L     M    RK MI I+ +       + VT+  +D ++  F+++   + KV+         ++ATE FPT+ RSL F ++ I   M +  + Y+  +     +IP ++  L + IS  L F+ + ETK   +P  I
Sbjct:   82 CEYKNETIPISETCQIETESSKAFGNLNGEYCGIAENTLVNVTNQKASTNLLVDFDLSCSHWFFQEFGLTIFTIGAVIAVPFMSMLADRYGRKPIIVTTAILAFLANMAASFSPNFAIFLILRAFIGACSDSYLSVASVATCEYLSEKARAWITVVYNVAWSLGMVWTLLVTLMTDDWRWRYFIVSLPGVYGFALWYFLPESPHWLITKNKTEKLKKYIKTANRVN----NVSPEFNDCQQSSHHEEKHESFKALLGSKKLIWLLFANGFIEMVISLVYFAISFMSVELGGDQVQAFLYSSLIEIPAGLAVIPLMMKMGRK-MIVIWCLVFQTLALIGVTVF-LDSYE--FKLVIMLVAKVMATIIYSVHPIWATEQFPTSVRSLCFSLMNIPQSMGIIMSPYVKHIVMSPNWIPFVVIALFSFISATLAFM-LHETKNKKLPTDI 518          
BLAST of slc22a-7 vs. Ensembl Celegans
Match: oct-2 (Organic Cation Transporter [Source:UniProtKB/TrEMBL;Acc:Q23501])

HSP 1 Score: 87.4261 bits (215), Expect = 9.125e-18
Identity = 62/228 (27.19%), Postives = 111/228 (48.68%), Query Frame = 3
Query:  195 CQYNETSH-QIQIS-----KDQCTMTINGSNVKCQHWTFSSEPFGKTIMSDYDLVCDYKYVGDLLVLLWYSTSLMAPVF--GWLADKYGRKMISIIFLSIETVATFILAFTPNLSSHIFFR-LCIGFSESAYHICYVWLMEMVNKDFRNVAGSFFWLYGSVAMTVFPLTVYVTRNWRLTQLISLTPSILYVLIL-FVPESPRWLCVKNKKQQLMESLQTIANINKMDL 848
            C Y E  +  I++S     KD   M   G   +C+ W + +    +TI+++++ VCD  +     V + YS   +   F  G+++D+YGRK     F  +  +  F+L ++      +  R L    +E+A    YV  ME+    +R++ GS      +       L  Y+T++W +  LI +   I+ +++L F+PESPRWL + NK +Q  + ++   + NK  L
Sbjct:  249 CHYFERDYVHIKLSPWAQVKD---MNATGKINRCKEWEYDTSVMDRTIVTEWNRVCDNNW-SRAHVHMSYSLGYLVGCFVGGFISDRYGRKTAITGFGILTMLFGFLLTYSKEFEIFLVVRFLLAATNEAADLAAYVLCMEVTGTKYRSIVGSLIQAPWACGYAFLALIAYLTKSWTMIHLICVLLHIISLMLLYFLPESPRWLILNNKTKQAEKIIREACHYNKSRL 472          

HSP 2 Score: 53.1434 bits (126), Expect = 4.743e-7
Identity = 40/138 (28.99%), Postives = 73/138 (52.90%), Query Frame = 3
Query: 1101 KRKRMITIFSMFGSIFIFLSVTLSKVDKWQSIFRMIFGSIGKVLVITSSQGVLVYATELFPTTHRSLFFGMLQIILLMAMTAAVYINKLNQF-YGFIPMLIYFLLNMISCCLIFVFMPETKGLPIPETIFDQRLLVKE 1511
            KR +M+ +F     +F+  SV +  V + QS   +IF  + K  +  S   + ++ +EL PT  R+   G+  ++  M   A+ YI  L+      +PM I+   ++++   + + +PET+GLP+P+TI D   +VK 
Sbjct:  572 KRSQMLVLFG--SGLFLLTSVVM--VYRKQSTLALIFMLLSKACIQGSFNILYIFTSELNPTVVRNSAVGISSMVARMGAGASGYIAILSDVTMPLVPMTIFACFSLLAG-CLVLLLPETQGLPLPDTILDSVQMVKR 704          
BLAST of slc22a-7 vs. Ensembl Celegans
Match: C44C10.3 (pep chromosome:WBcel235:X:11702525:11704500:1 gene:WBGene00008084.1 transcript:C44C10.3.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C44C10.3)

HSP 1 Score: 80.8777 bits (198), Expect = 4.998e-16
Identity = 73/264 (27.65%), Postives = 116/264 (43.94%), Query Frame = 3
Query:   75 FYNKKDTFKVIAFLILSLPAFQYGSQFQNLLVSIQTPNFTCQYNETSHQIQI----SKDQCTMTINGSNVKCQHWTFSSEPFGKTIMSDYDLVC-DYKYVGDLLVLLWYSTSLMAPV-FGWLADKYGRKMISIIFLSIETVATFILAFTPNLSSHIFFRLCIGFSESAYHICY-VWLMEMVNKDFRNVAGSFF-WLYGSVAMTVFPLTVYVTRNWRLTQLI---SLTPSILYVLILFVPESPRWLCVKNKKQQLMESLQTIANI 833
            FY+  + F +  F+   L  F  G    N+  SI  P + C     +   ++     KD  T                 +P   ++  D+D VC    +      L+ Y   L+  V FG L+DKYGRK I I+ + I  ++      +PN       R C G S +   +C   W++E +    R V  +FF W +  V +TV     Y+T+ WRL   +    L P++L +LI  +PES  WL  K +  +++ES + +A I
Sbjct:    2 FYDV-NRFHLCVFVTWQLVNFAVGQYIFNIF-SIHVPKWKCGDGPVTKDCKVYQSCPKDNLTFV---------------DPIFTSVAMDFDWVCGSSAHYQSFFSLVQYLGVLVGTVLFGTLSDKYGRKPIGILVIVIAIISLLGTGLSPNRQLLFIARFCSGLSIAGVLVCICAWILESILSHQRMVIRAFFNWGWTRVFITV---VCYLTQEWRLASYVCAACLVPALL-MLIFLIPESAIWLHSKGETAKMIESEKFMAKI 244          
BLAST of slc22a-7 vs. Ensembl Fly
Match: Orct2 (gene:FBgn0086365 transcript:FBtr0084598)

HSP 1 Score: 92.0485 bits (227), Expect = 2.329e-19
Identity = 69/265 (26.04%), Postives = 124/265 (46.79%), Query Frame = 3
Query:   99 KVIAFLILSLPAFQYGSQFQN--------LLVSIQTP-NFTCQYNETSHQIQISKDQCTMTINGSNVKCQHWTFSSEPFGKTIMSDYDLVCDYKYVG---DLLVLLWYSTSLMAPVFGWLADKYGRKMISIIFLSIETVATFILAFTPNLSSHIFFRLCIGFSESA-YHICYVWLMEMVNKDFRNVAGSFFWLYGSVAMTVFPLTVYVTRNWRLTQLISLTPSILYVLILF-VPESPRWLCVKNKKQQLMESLQTIANINKMDLQ 851
            K+    +L+ P F+    F+N         L ++  P N  C Y +  +  +        + N +   C  + +    +  + +++++LVC   ++    D L +L     L + VFG L+DKYGRK I    L I+ +   +    P   ++ F RL +G + S  + + YV  MEMV  D R  AG F  ++ SV   +  +  Y   +WR  Q+    P ++++   + +PES RWL +K +K   + ++Q  A  NK+++ 
Sbjct:   35 KLAGVFLLAKPDFRCALPFENGSSYDLPTHLWNLSYPENERCSYYDVDYTEEYLNGSIPRSSNETKT-CSSYVYDRSKYLNSAVTEWNLVCGRDFMAATSDSLFML--GVLLGSIVFGQLSDKYGRKPILFASLVIQVLFGVLAGVAPEYFTYTFARLMVGATTSGVFLVAYVVAMEMVGPDKRLYAGIFVMMFFSVGFMLTAVFAYFVHDWRWLQIALTLPGLIFMFYYWIIPESARWLLLKGRKDCAIANMQKAARFNKVEIS 296          
BLAST of slc22a-7 vs. Ensembl Fly
Match: Orct2 (gene:FBgn0086365 transcript:FBtr0334869)

HSP 1 Score: 92.0485 bits (227), Expect = 2.329e-19
Identity = 69/265 (26.04%), Postives = 124/265 (46.79%), Query Frame = 3
Query:   99 KVIAFLILSLPAFQYGSQFQN--------LLVSIQTP-NFTCQYNETSHQIQISKDQCTMTINGSNVKCQHWTFSSEPFGKTIMSDYDLVCDYKYVG---DLLVLLWYSTSLMAPVFGWLADKYGRKMISIIFLSIETVATFILAFTPNLSSHIFFRLCIGFSESA-YHICYVWLMEMVNKDFRNVAGSFFWLYGSVAMTVFPLTVYVTRNWRLTQLISLTPSILYVLILF-VPESPRWLCVKNKKQQLMESLQTIANINKMDLQ 851
            K+    +L+ P F+    F+N         L ++  P N  C Y +  +  +        + N +   C  + +    +  + +++++LVC   ++    D L +L     L + VFG L+DKYGRK I    L I+ +   +    P   ++ F RL +G + S  + + YV  MEMV  D R  AG F  ++ SV   +  +  Y   +WR  Q+    P ++++   + +PES RWL +K +K   + ++Q  A  NK+++ 
Sbjct:   35 KLAGVFLLAKPDFRCALPFENGSSYDLPTHLWNLSYPENERCSYYDVDYTEEYLNGSIPRSSNETKT-CSSYVYDRSKYLNSAVTEWNLVCGRDFMAATSDSLFML--GVLLGSIVFGQLSDKYGRKPILFASLVIQVLFGVLAGVAPEYFTYTFARLMVGATTSGVFLVAYVVAMEMVGPDKRLYAGIFVMMFFSVGFMLTAVFAYFVHDWRWLQIALTLPGLIFMFYYWIIPESARWLLLKGRKDCAIANMQKAARFNKVEIS 296          
BLAST of slc22a-7 vs. Ensembl Fly
Match: CG8925 (gene:FBgn0038404 transcript:FBtr0083253)

HSP 1 Score: 81.2629 bits (199), Expect = 8.194e-16
Identity = 55/197 (27.92%), Postives = 106/197 (53.81%), Query Frame = 3
Query:  273 KCQHWTFSS-EPFGKTIMSDYDLVCDYKYVGDLLVLLWYSTSLMAPVFGWLADKYGRKMISIIFLSIETVATFILAFTPNLSSHIFFRLCIGF-SESAYHICYVWLMEMVNKDFRNVAGSFFWLYGSVAMTVFPLTVYVTRNWRLTQLISLTPSILYVLILF-VPESPRWLCVKNKKQQLMESLQTIANINKMDLQL 854
            +C H+ FS  +   KT++ ++DLVC    +  +        +  A + GW++D++GR+   + F++I++V   ILAF+ +++  +  R+ IGF S +   + +V ++E+V+  +R V G    L  +++  +     Y+ R+WR  QL    P ++ + I F +PESPRWL  + +  +L   ++  A +N     L
Sbjct:  248 QCWHFEFSDVDGSAKTLVQEFDLVCGRDILSLVETCFLVGAAAGAVLSGWISDRFGRRHTLMAFVTIQSVFGGILAFSTSVAMFMSLRVIIGFASMTVTVVSFVLVVELVSGKWRTVIGILNILPVAISYVLSAGLAYLIRDWRHLQLAISWPWLIMLSIWFWLPESPRWLLAQGRLDELCGLIERAARMNGTSASL 444          
BLAST of slc22a-7 vs. Ensembl Fly
Match: CG8925 (gene:FBgn0038404 transcript:FBtr0113241)

HSP 1 Score: 80.8777 bits (198), Expect = 8.936e-16
Identity = 54/197 (27.41%), Postives = 106/197 (53.81%), Query Frame = 3
Query:  273 KCQHWTFSS-EPFGKTIMSDYDLVCDYKYVGDLLVLLWYSTSLMAPVFGWLADKYGRKMISIIFLSIETVATFILAFTPNLSSHIFFRLCIGFSE-SAYHICYVWLMEMVNKDFRNVAGSFFWLYGSVAMTVFPLTVYVTRNWRLTQLISLTPSILYVLILF-VPESPRWLCVKNKKQQLMESLQTIANINKMDLQL 854
            +C H+ FS  +   KT++ ++DLVC    +  +        +  A + GW++D++GR+   + F++I++V   ILAF+ +++  +  R+ IGF+  +   + +V ++E+V+  +R V G    L  +++  +     Y+ R+WR  QL    P ++ + I F +PESPRWL  + +  +L   ++  A +N     L
Sbjct:  184 QCWHFEFSDVDGSAKTLVQEFDLVCGRDILSLVETCFLVGAAAGAVLSGWISDRFGRRHTLMAFVTIQSVFGGILAFSTSVAMFMSLRVIIGFASMTVTVVSFVLVVELVSGKWRTVIGILNILPVAISYVLSAGLAYLIRDWRHLQLAISWPWLIMLSIWFWLPESPRWLLAQGRLDELCGLIERAARMNGTSASL 380          
BLAST of slc22a-7 vs. Ensembl Fly
Match: Balat (gene:FBgn0033778 transcript:FBtr0087815)

HSP 1 Score: 79.337 bits (194), Expect = 2.810e-15
Identity = 58/227 (25.55%), Postives = 109/227 (48.02%), Query Frame = 3
Query:  183 PNFTCQYNETSHQIQISKDQCTMTINGSNVKCQH-WTFSSEPFGKTIMSDYDLVCDYKYVGDLLVLLWYSTSLMAP-VFGWLADKYGRKMISIIFLSIETVATFILAFTPNLSSHIFFRLCIGFSESAYHIC-YVWLMEMVNKDFRNVAGSFFWLYGSVAMTVFPLTVYVTRNWR-LTQLISLTPSILYVLILFVPESPRWLCVKNKKQQLMESLQTIANINKMDLQ 851
            P+   Q  E   ++Q    Q         V CQH W +    +  T++ +++LVCD  ++  L ++++    L+   VFG+L D +GR+     +L +E +A    AF  N  + +  R  +G +  A     YV  +E+V  + R        +  S+ + V    +Y+ R+WR L+  +S+   +L+     +PESPRWL    K ++ ++ L+ +A +N + + 
Sbjct:  102 PDLLRQQAEDLLKLQPDTTQV--------VPCQHGWHYDKSIYSSTVVQEWNLVCDRSFLVTLALVVFGVGGLLGNYVFGYLVDLWGRRPSFYAYLLLEIIACAASAFAWNYYTWLGLRFVVGLTVPAILASPYVLAIELVGPERRVFCTIVSNIAYSLGLVVLAGVIYIVRDWRELSLAVSMPLLMLFSCFFVLPESPRWLMAVGKTRRAIKILKVMARVNGVRVN 320          
BLAST of slc22a-7 vs. Ensembl Zebrafish
Match: slc22a2 (solute carrier family 22 member 2 [Source:ZFIN;Acc:ZDB-GENE-040426-2167])

HSP 1 Score: 110.538 bits (275), Expect = 3.919e-25
Identity = 109/447 (24.38%), Postives = 206/447 (46.09%), Query Frame = 3
Query:  312 KTIMSDYDLVC-DYKYVGDLLVLLWYSTSLMAPVFGWLADKYGRK---MISIIFLSIETVATFILAFTPNLSSHIFFRLCIGFS-ESAYHICYVWLMEMVNKDFRNVAGSFFWLYGSVAMTVFPLTVYVTRNWRLTQLISLTPSILYVLIL-FVPESPRWLCVKNKKQQLMESLQTIANINKMDLQLTPXXXXXXXXXXXSNKWNAFKDNN--------FLFLASTXXXXXX---------XXXXXXXXXXXXXXXXXXXXXXXMFVLGLMEFPGALLSYLSMYFFKRKRMITIFSMFGSIFIFLSVTLSKVDKWQSIFRMIFGSIGKVLVITSSQGVLVYATELFPTTHRSLFFGMLQIIL-LMAMTAAVYINKLNQFYGFIPMLIYFLLNMISCCLIFVFMPETKGLPIPETIFD----QRLLVKEREQEYLEYMYNRSDVVNSD 1568
            ++ ++++DLVC D  YV      L     + +   G+LADKYGR    +++  F+ +  +   ++A +PN  S + FR   GF  +  + + YV + E+V  D R   G  + L+ S+ + + PL  Y   NWR  Q++   P I ++    F+PESPRWL  +NK  + +E  ++IA  N+  L               S K    KD+N        F+ L  T+    +         + +++   +++ L +L  N+Y+   + G++E P A L  L++    R+      ++       ++  +     W    +     +G++ +  + + V+   TEL+PT  R+L   +   +  +  + A   + +L   +  +P++I+  L  ++  L+ + +PETKG+P+PETI D     R     ++ + LE +       N D
Sbjct:  134 QSFVTEFDLVCGDAWYVDMFQATLSIGFLVGSIAIGYLADKYGRMKSFLMTNFFIGVTGI---LVATSPNYISLLVFRALFGFGVKGGWMVGYVLITELVGVDHRRTVGVTYQLFFSMGILLLPLLAYFITNWRWLQVVFTVPYICFLTYYWFIPESPRWLLTQNKIAEAVEITKSIAKENRKTL---------------SKKIETLKDDNIDSGSTASFMDLFKTAKLRTYTFILSFNWFTSAVVYQGLIMRLGILGGNVYVDFLISGIVELPAAFLILLTIERIGRRLPFATANIVAGAACLITAFIPDSMFW---LKSAVACVGRLGITMAFEMVVFVNTELYPTVIRNLGVSVCSTLCDVGGIVAPFLLYRLAVIWLELPLIIFGALAFVAGGLV-LLLPETKGVPLPETIDDIEHPNRNKENPQQSQQLENLMTSDVTKNKD 558          
BLAST of slc22a-7 vs. Ensembl Zebrafish
Match: slc22a4 (solute carrier family 22 member 4 [Source:ZFIN;Acc:ZDB-GENE-040426-1517])

HSP 1 Score: 108.997 bits (271), Expect = 1.146e-24
Identity = 109/445 (24.49%), Postives = 208/445 (46.74%), Query Frame = 3
Query:  207 ETSHQIQISKDQCTMTINGSNVKCQ----HWTFSSEPFGKTIMSDYDLVCDYKYVGDLLVLLWYSTSLMAPVF-GWLADKYGRKMISIIFLSIETVATFILAFTPNLS--SHIFFRLCIGFSE-SAYHICYVWLMEMVNKDFRNVAGSFFWLYGS-VAMTVFPLTVYVTRNWRLTQLISLTPSILYV-LILFVPESPRWLCVKNKKQQLMESLQTIANINKMDLQLTPXXXXXXXXXXXSNKWNAFKDNNFLFLASTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXM--------FVLGLMEFPGALLSYLSMYFFKRKRMITIFSMFGSIFIF-LSVTLSKVDKWQSIFRMIFGSIGKVLVITSSQGVLVYATELFPTTHRSLFFGMLQIILLMAMTAAVYINKLNQFYGFIPMLIYFLLNMISCCLIFVFMPETKGLPIPETI 1484
            +T  Q+ +      + +N S ++ +     W++S E +  TI++++DLVC+ +Y G L   +++   L+     G ++D+YGR+ +    ++++T+   I  F+P+    S I+F   +GFS  S Y + YV   E+++   R + GS     GS +    FPL  Y  R+WR   L +    +LY  L  F+PESPRWL  + +  +    L+  A  N++     PE I      +E+ K    K +    L++ +  +   I  L+  ++            ++        F+  ++E P  +++ L + F  R+       + G   IF + +  +++    +   M    +GK+ V  +   V    +ELFPT  R++  G   +   +    + +I  L  +Y +IP ++   L + S  ++ + +PE+KG  +PETI
Sbjct:   87 DTLRQLSMLNYTPNVEVNLSQIETEPCVDGWSYSQEFYQSTIVTEWDLVCEREYKGPLTSSIYFCGVLVGTFLSGQMSDRYGRRPVLFAMMALQTITILIQMFSPSWEVFSAIYF--FVGFSGFSNYVVAYVLGSEILSPASRVLFGSLGVFMGSGIGQMFFPLAAYFIRSWRWLVLTNALTGLLYFPLWWFIPESPRWLLSQGRTAEAEAVLRRAAEKNRVT---APEVIFSSSEIEEAAKKRIQKHSILDILSNCNAVSTILICSLLWMVITMSYYALILNTTNLHGNPYLNFFLSAVVEVPAYIIAALLLRFCSRRICQASTLLLGGALIFIIQLIPTELQGLSTALEM----LGKLCVTAAFCVVYAVTSELFPTVVRNMAMGSCSMTARIGSIISPFIIYLGNYYRYIPYIVIGGLALFS-GVMSLLLPESKGKVLPETI 521          
BLAST of slc22a-7 vs. Ensembl Zebrafish
Match: slc22a6l (solute carrier family 22 member 6, like [Source:NCBI gene;Acc:404609])

HSP 1 Score: 99.7525 bits (247), Expect = 9.595e-22
Identity = 122/558 (21.86%), Postives = 229/558 (41.04%), Query Frame = 3
Query:   51 MILENVISFYNKKDTFKVIAFLILSLPAFQYGSQ--FQNLLVSIQTPNFTCQYN-----ETSHQIQISKDQCTMTINGSNVKCQH---------------------------------WTFSSEPFGKTIMSDYDLVCDYK---------YVGDLLVLLWYSTSLMAPVFGWLADKYGRKMISIIFLSIETVATFILAFTPNLSSHIFFRLCIGFSESAYHI-CYVWLMEMVNKDFRNVAGSFFWLYGSVAMTVFPLTVYVTRNWR-LTQLISLTPSILYVLILFVPESPRWLCVKNKKQQLMESLQTIANIN-------KMDLQLTPXXXXXXXXXXXS--NKWNAFKDNNFLFLASTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMFVLGLMEFPGALLSYLSMYFFKRKRMITIFSMFGSIFIFLSVTLSKVDKWQSIFRMIFGSIGKVLVITSSQGVLVYATELFPTTHRSLFFGMLQIILLMAMTAAVYINKLNQFYGFIPMLIYFLLNMISCCLIFVFMPETKGLPIPETI--FDQRLLVKEREQEYLEYM 1538
            M   +++        F+V+   +LS+P     S    QN + ++  P   CQ +      ++  + + +    + +NG   +C+                                  W ++      TI++++DLVCDY+         Y+G +LV         A VFG L+D++GR+++ +I   +  +    +AF+ + +    FR+C G + S   +  +  ++E +    R V G+      +    +     Y  R+WR LT  +SL   + ++   +  ES RWL +  K +Q +++L+T+A IN       K+DL++  E +K E    +   +  +  + +    +        FS S     + +DL     +IY+   + G ++ P  ++  + M    R+       +   I I +++    V     + R     IGK  +  S     +YA EL+PT  R    G + ++       A  +  L   Y +IP  IY    ++S    F F+PET   P+P+TI   D R L +   +   E +
Sbjct:    1 MAFSDLLEQVGSTGRFQVLHVTLLSMPILMMASHNLLQNFVAAV--PPHHCQPHANLSMSSTDAMDVLRATVPLGLNGKLERCKRYTTPQWQILSLNTSESLWDESMAETETQSCEDGWFYNMTEMSSTIITEWDLVCDYRALKQMSQTTYMGGVLV--------GAIVFGGLSDRFGRRVLLLISNLMMAIGGTCVAFSTSFTMFCVFRVCCGMALSGLVLNSFSLIVEWIPTRVRTVVGTGTGYCYTTGQLILAAVAYCIRDWRWLTLAVSLPFYVSFLYSWWFLESARWLVLTKKPEQAVKNLKTVARINGRSAEGDKIDLEMLQESMKKEMACSKGSYSALDLLRTSTMRTITICLSAVWFSTSFAYYGLSMDLQKFGVSIYLIQIIFGAVDIPAKIIVTICMSMLGRRPSQCGALVLAGIMILINLL---VPSDLQMLRTSLAVIGKGCLAASFNCCYLYAGELYPTVIRQSGMGWVSMMARFGAMVAPMVLLLGDDYPWIPGFIYGGAPIVSGIFAF-FLPETLSQPLPDTIQDIDDRGLARTNSKRLPEKL 544          
BLAST of slc22a-7 vs. Ensembl Zebrafish
Match: oct2 (organic cation transporter 2 [Source:ZFIN;Acc:ZDB-GENE-080204-92])

HSP 1 Score: 98.9821 bits (245), Expect = 1.870e-21
Identity = 102/429 (23.78%), Postives = 205/429 (47.79%), Query Frame = 3
Query:  279 QHWTFSSEPFGKTIMSDYDLVCDYKYVGDL-LVLLWYSTSLMAPVFGWLADKYGRKMISIIFLSIETVATFILAFTPNLSSHIFFRLCIGF-SESAYHICYVWLMEMVNKDFRNVAGSFFWLYGSVAMTVFPLTVYVTRNWRLTQLISLTPSILYVLILFV-PESPRWLCVKNKKQQLMESLQTIANINK---------MDLQLTPXXXXXXXXXXXSNKWNAFKDNNFLFLASTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMFVLGLMEFPGALLSYLSMYFFKRKRMITIFSMFGSIFIFLSVTLSKVDKWQSIFRMIFGSIGKVLVITSSQGVLVYATELFPTTHRSLFFGMLQIILLMAMTAAVYI-NKLNQFYGFIPMLIYFLLNMISCCLIFVFMPETKGLPIPETIFD-QRLLVKEREQE 1523
            + WTF+      TI++++ LVC+  ++ DL  V L     + A V G+LAD++GRK   I  +    V+   + F+P     +FFR   GF ++ A+   YV ++E    + R         + S+ + + P   Y   +WR  QL    P+ ++++  +V PESPRWL  + K ++ +  +++IA  NK         MDL +  +E  +  + K+  K    + + F+ + +      F+ +++   +++ L +   N+++   +  ++E P  L+ Y  +    R+ ++   +  G         +S    W    R     +G++ V   ++ V    TEL+PT  R+L   +      +    A +I  +L   +  +P+L+Y +++++   L+ + +PE KG+ +PET+ D + L  + + +E
Sbjct:  114 EGWTFNENR--TTIVTEFSLVCEDSWLADLNQVSLAGGFFIGALVTGYLADRFGRKSCFIASIFGLGVSGTCIIFSPYYPLLLFFRCLQGFFAKGAWTATYVLIIEFFGSNNRKFVSVMSRTFYSLGLVLLPALAYYIPSWRNLQLAMTLPTFIFLIYHWVIPESPRWLLSQRKTKEALSIVKSIAKCNKRSLPEDFHEMDLLIEKQEEIMRPSYKDLFKTPKMRKHTFILIYA-----WFTGAVVFQGLVLRLGITGDNVFLDFLISAVVELPTGLIFYFLVDRIGRRPLMATVNFIGGAACLAVPFISPNISW---LRRTIAIVGRLAVAIGNETVNFANTELYPTPLRNLGVSVCSSASDIGAVVAPFILYRLASIWQELPLLVYGVMSVLYSGLV-MLLPEMKGVDLPETVDDVENLRSRHKRKE 531          
BLAST of slc22a-7 vs. Ensembl Zebrafish
Match: si:dkey-166k12.1 (si:dkey-166k12.1 [Source:ZFIN;Acc:ZDB-GENE-120215-78])

HSP 1 Score: 97.8265 bits (242), Expect = 3.679e-21
Identity = 66/214 (30.84%), Postives = 108/214 (50.47%), Query Frame = 3
Query:  237 DQCTMT--INGS-NVKCQ-HWTFSSEPFGKTIMSDYDLVCDYKYVGDLLVLLWYSTSLM-APVFGWLADKYGRKMISIIFLSIETVATFILAFTPNLSSHIFFRLCIGFSESAYHI-CYVWLMEMVNKDFRNVAGSFFWLYGSVAMTVFPLTVYVTRNWRLTQLISLTPSILYVLILFV-PESPRWLCVKNKKQQLMESLQTIANINKMDLQLT 857
            D CT    +N S    C+  W +S E F  T ++++DLVCD + +  L   ++    L+ A VFG +AD+YGR+   ++ L+++TV     AF PN   ++  R  IG + S   I  +V   E      R +AG F   +      +     ++ R+WR  QL    P  L++  ++V P S RWL V N+K++ ++ L+  A++N   L  T
Sbjct:   80 DACTAASGVNRSARTNCETGWVYSHEVFQSTTVTEWDLVCDKRGLSSLGSSIYMLGLLVGAVVFGAMADRYGRRFAMLVSLALQTVFGVAAAFAPNFPVYVGLRFIIGMTVSGVIINAFVLGTEWTCTQRRMLAGIFTDYFFGFGYMLLAGVAFLIRDWRKLQLAISAPGFLFIFYIWVLPHSARWLLVNNRKEEAIDLLRKAASVNGRTLPPT 293          

HSP 2 Score: 51.6026 bits (122), Expect = 1.866e-6
Identity = 44/151 (29.14%), Postives = 69/151 (45.70%), Query Frame = 3
Query: 1038 FVLGLMEFPGALLSYLSMYFFKRKRMITIFSMFGSIFIFLSVTLSKVDKWQSIFRMIFGSIGKVLVITSSQGVLVYATELFPTTHRSLFFGMLQIILLMAMTAAVYINKLNQFYGFIPMLIYFLLNMISCCLIFVFMPETKGLPIPETIFD 1490
            F+ GL+E P   L  L +    RK  +++F + G     L++TL       +  R     +GK  +  S   + VY+ ELFPT  R    G+  +   M    A  IN L +    +PMLI F    +    + + +PET   P+P++I D
Sbjct:  356 FMFGLVEIPARTL-VLVLLPCSRKIPLSVFLVVGGGACLLTLTLPADS---AHVRTALAMVGKFGITASFAIIYVYSAELFPTVLRQTGIGVSSMFARMGGVLAPLINLLGRHTPVVPMLI-FGSTPLLAAALALALPETARQPLPDSIHD 501          
BLAST of slc22a-7 vs. Ensembl Xenopus
Match: ENSXETT00000022866.1 (solute carrier family 22 (organic anion transporter), member 8 [Source:NCBI gene;Acc:100490266])

HSP 1 Score: 126.331 bits (316), Expect = 2.270e-30
Identity = 124/530 (23.40%), Postives = 219/530 (41.32%), Query Frame = 3
Query:   96 FKVIAFLILSLPAFQYGSQ--FQNLLVSIQTPNFTCQYNETSHQIQISKD------QCTMTINGSNVKCQH-----------------------------WTFSSEPFGKTIMSDYDLVCDYKYVGDLLVLLWYSTSLM-APVFGWLADKYGRKMISIIFLSIETVATFILAFTPNLSSHIFFRLCIGFSESAYHICYVWLM-EMVNKDFRNVAGSFFWLYGSVAMTVFPLTVYVTRNWRLTQLISLTPSILYVLIL-FVPESPRWLCVKNKKQQLMESLQTIANINKMDLQLTPXXXXXXXXXXXSNKWNAFKDNNFLFLASTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMF---------VLGLMEFPGALLSYLSMYFFKRKRMITIFSMFGSIFIFLSVTLSKVDKWQSIFRMIFGSIGKVLVITSSQGVLVYATELFPTTHRSLFFGMLQIILLMAMTAAVYINKLNQFYGFIPMLIYFLLNMISCCLIFVFMPETKGLPIPETIFDQRLLVKEREQEYLEYM 1538
            F++   ++L  P     S    QN   +I  P+  C+ N+T +Q   + +         +  NG   +C                               W +S + F  TI++++DLVC  K    L   ++    L+ A + G L+D+YGR+ + I       V+    AF+PN  S+  FR   G + S   +    L+ E V    R V G+      +    +     Y  R+WR  QL    P  +Y L   + PES RWL +  K ++ ++ ++ +AN+N    +     ++  K+       +A    + + L  T+     S ++ +             + +  F         + G ++FP  L+S  +M +  RK    +  + G I I  ++ +   ++ Q++ R      GK  +  S   + +Y TEL+PT  R    GM   +  +    A  +  L + Y F+P+LIY    +IS   +F F+PET   P+P+TI + + +VK  +   L  M
Sbjct:   16 FQITQVVLLCFPILLMASHNLLQNFSAAI--PDHKCKANDTGYQSNSTDETGYERLSAPLDANGQPDRCLEYVEIQWRMVGSNSTWNNSSELATRPCTIGWEYSKDEFSSTIITEWDLVCGRKTRRQLAQSIYMGGVLVGAIILGGLSDRYGRRALLIWSYFQLAVSGVCAAFSPNYLSYCIFRFLTGMALSGIGLNTTALIVEWVPTRVRTVTGTLAGFSYTAGQLLLAGLAYGMRDWRWLQLCVSLPFFIYFLYAWWFPESARWLVLSGKPEKAVKEIRKVANLNGKKEEGEKITLESLKSEMIKELASAKSSYSVIDLVRTNTIRRISCALSLVWFSTSFAYYGLAMDLQKFNVSIYLIQVIFGAVDFPAKLVSATAMIYVGRKFTQFMSLILGGIAIIANIFVP--NELQTV-RTSLAVFGKGCLAASFSCIFLYTTELYPTVIRQSGLGMCSTMARIGGIVAPLVKILGELYPFVPLLIYGGAPIISGLCVF-FLPETVNKPLPDTIEEHKDIVKSLKLHSLALM 539          
BLAST of slc22a-7 vs. Ensembl Xenopus
Match: ENSXETT00000036031.1 (solute carrier family 22 (organic anion transporter), member 8 [Source:NCBI gene;Acc:100490266])

HSP 1 Score: 123.25 bits (308), Expect = 2.601e-29
Identity = 124/540 (22.96%), Postives = 221/540 (40.93%), Query Frame = 3
Query:   96 FKVIAFLILSLPAFQYGSQ--FQNLLVSIQTPNFTCQYNETSHQIQISKD------QCTMTINGSNVKCQH-----------------------------WTFSSEPFGKTIMSDYDLVCDYKYVGDLLVLLWYSTSLM-APVFGWLADKYGRKMISIIFLSIETVATFILAFTPNLSSHIFFRLCIGFSESAYHICYVWLM-EMVNKDFRNVAGSFFWLYGSVAMTVFPLTVYVTRNWRLTQLISLTPSILYVLIL-FVPESPRWLCVKNKKQQLMESLQTIANINKMDLQLTPXXXXXXXXXXXSNKWNAFKDNNFLFLASTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMF---------VLGLMEFPGALLSYLSMYFFKRKRMITIFSMFGSIFIFLSVTLSKVDKWQSIFRMIFGSIGKVLVITSSQGVLVYATELFPTTHRSLFFGMLQIILLMAMTAAVYINKLNQFYGFIPMLIYFLLNMISCCLIFVFMPETKGLPIPETIFDQRLLVKEREQEYLEYMYNRSDVVNSD 1568
            F++   ++L  P     S    QN   +I  P+  C+ N+T +Q   + +         +  NG   +C                               W +S + F  TI++++DLVC  K    L   ++    L+ A + G L+D+YGR+ + I       V+    AF+PN  S+  FR   G + S   +    L+ E V    R V G+      +    +     Y  R+WR  QL    P  +Y L   + PES RWL +  K ++ ++ ++ +AN+N    +     ++  K+       +A    + + L  T+     S ++ +             + +  F         + G ++FP  L+S  +M +  RK    +  + G I I  ++ +   ++ Q++ R      GK  +  S   + +Y TEL+PT  R    GM   +  +    A  +  L + Y F+P+LIY    +IS   +F F+PET   P+P+TI       +E E+  L+    +   ++ D
Sbjct:   16 FQITQVVLLCFPILLMASHNLLQNFSAAI--PDHKCKANDTGYQSNSTDETGYERLSAPLDANGQPDRCLEYVEIQWRMVGSNSTWNNSSELATRPCTIGWEYSKDEFSSTIITEWDLVCGRKTRRQLAQSIYMGGVLVGAIILGGLSDRYGRRALLIWSYFQLAVSGVCAAFSPNYLSYCIFRFLTGMALSGIGLNTTALIVEWVPTRVRTVTGTLAGFSYTAGQLLLAGLAYGMRDWRWLQLCVSLPFFIYFLYAWWFPESARWLVLSGKPEKAVKEIRKVANLNGKKEEGEKITLESLKSEMIKELASAKSSYSVIDLVRTNTIRRISCALSLVWFSTSFAYYGLAMDLQKFNVSIYLIQVIFGAVDFPAKLVSATAMIYVGRKFTQFMSLILGGIAIIANIFVP--NELQTV-RTSLAVFGKGCLAASFSCIFLYTTELYPTVIRQSGLGMCSTMARIGGIVAPLVKILGELYPFVPLLIYGGAPIISGLCVF-FLPETVNKPLPDTI-------EEVEKGELDVCKTKESHISQD 542          
BLAST of slc22a-7 vs. Ensembl Xenopus
Match: ENSXETT00000036038.1 (solute carrier family 22 (organic anion transporter), member 8 [Source:NCBI gene;Acc:100490266])

HSP 1 Score: 122.479 bits (306), Expect = 5.016e-29
Identity = 121/525 (23.05%), Postives = 216/525 (41.14%), Query Frame = 3
Query:   96 FKVIAFLILSLPAFQYGSQ--FQNLLVSIQTPNFTCQYNETSHQIQISKD------QCTMTINGSNVKCQH-----------------------------WTFSSEPFGKTIMSDYDLVCDYKYVGDLLVLLWYSTSLM-APVFGWLADKYGRKMISIIFLSIETVATFILAFTPNLSSHIFFRLCIGFSESAYHICYVWLM-EMVNKDFRNVAGSFFWLYGSVAMTVFPLTVYVTRNWRLTQLISLTPSILYVLIL-FVPESPRWLCVKNKKQQLMESLQTIANINKMDLQLTPXXXXXXXXXXXSNKWNAFKDNNFLFLASTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMF---------VLGLMEFPGALLSYLSMYFFKRKRMITIFSMFGSIFIFLSVTLSKVDKWQSIFRMIFGSIGKVLVITSSQGVLVYATELFPTTHRSLFFGMLQIILLMAMTAAVYINKLNQFYGFIPMLIYFLLNMISCCLIFVFMPETKGLPIPETIFDQRLLVKEREQE 1523
            F++   ++L  P     S    QN   +I  P+  C+ N+T +Q   + +         +  NG   +C                               W +S + F  TI++++DLVC  K    L   ++    L+ A + G L+D+YGR+ + I       V+    AF+PN  S+  FR   G + S   +    L+ E V    R V G+      +    +     Y  R+WR  QL    P  +Y L   + PES RWL +  K ++ ++ ++ +AN+N    +     ++  K+       +A    + + L  T+     S ++ +             + +  F         + G ++FP  L+S  +M +  RK    +  + G I I  ++ +   ++ Q++ R      GK  +  S   + +Y TEL+PT  R    GM   +  +    A  +  L + Y F+P+LIY    +IS   +F F+PET   P+P+TI +    +   ++E
Sbjct:   16 FQITQVVLLCFPILLMASHNLLQNFSAAI--PDHKCKANDTGYQSNSTDETGYERLSAPLDANGQPDRCLEYVEIQWRMVGSNSTWNNSSELATRPCTIGWEYSKDEFSSTIITEWDLVCGRKTRRQLAQSIYMGGVLVGAIILGGLSDRYGRRALLIWSYFQLAVSGVCAAFSPNYLSYCIFRFLTGMALSGIGLNTTALIVEWVPTRVRTVTGTLAGFSYTAGQLLLAGLAYGMRDWRWLQLCVSLPFFIYFLYAWWFPESARWLVLSGKPEKAVKEIRKVANLNGKKEEGEKITLESLKSEMIKELASAKSSYSVIDLVRTNTIRRISCALSLVWFSTSFAYYGLAMDLQKFNVSIYLIQVIFGAVDFPAKLVSATAMIYVGRKFTQFMSLILGGIAIIANIFVP--NELQTV-RTSLAVFGKGCLAASFSCIFLYTTELYPTVIRQSGLGMCSTMARIGGIVAPLVKILGELYPFVPLLIYGGAPIISGLCVF-FLPETVNKPLPDTIEEVEKGINAPKKE 534          
BLAST of slc22a-7 vs. Ensembl Xenopus
Match: ENSXETT00000022873.1 (solute carrier family 22 (organic anion transporter), member 8 [Source:NCBI gene;Acc:100490266])

HSP 1 Score: 122.094 bits (305), Expect = 7.200e-29
Identity = 120/512 (23.44%), Postives = 211/512 (41.21%), Query Frame = 3
Query:   96 FKVIAFLILSLPAFQYGSQ--FQNLLVSIQTPNFTCQYNETSHQIQISKD------QCTMTINGSNVKCQH-----------------------------WTFSSEPFGKTIMSDYDLVCDYKYVGDLLVLLWYSTSLM-APVFGWLADKYGRKMISIIFLSIETVATFILAFTPNLSSHIFFRLCIGFSESAYHICYVWLM-EMVNKDFRNVAGSFFWLYGSVAMTVFPLTVYVTRNWRLTQLISLTPSILYVLIL-FVPESPRWLCVKNKKQQLMESLQTIANINKMDLQLTPXXXXXXXXXXXSNKWNAFKDNNFLFLASTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMF---------VLGLMEFPGALLSYLSMYFFKRKRMITIFSMFGSIFIFLSVTLSKVDKWQSIFRMIFGSIGKVLVITSSQGVLVYATELFPTTHRSLFFGMLQIILLMAMTAAVYINKLNQFYGFIPMLIYFLLNMISCCLIFVFMPETKGLPIPETI 1484
            F++   ++L  P     S    QN   +I  P+  C+ N+T +Q   + +         +  NG   +C                               W +S + F  TI++++DLVC  K    L   ++    L+ A + G L+D+YGR+ + I       V+    AF+PN  S+  FR   G + S   +    L+ E V    R V G+      +    +     Y  R+WR  QL    P  +Y L   + PES RWL +  K ++ ++ ++ +AN+N    +     ++  K+       +A    + + L  T+     S ++ +             + +  F         + G ++FP  L+S  +M +  RK    +  + G I I  ++ +   ++ Q++ R      GK  +  S   + +Y TEL+PT  R    GM   +  +    A  +  L + Y F+P+LIY    +IS   +F F+PET   P+P+TI
Sbjct:   16 FQITQVVLLCFPILLMASHNLLQNFSAAI--PDHKCKANDTGYQSNSTDETGYERLSAPLDANGQPDRCLEYVEIQWRMVGSNSTWNNSSELATRPCTIGWEYSKDEFSSTIITEWDLVCGRKTRRQLAQSIYMGGVLVGAIILGGLSDRYGRRALLIWSYFQLAVSGVCAAFSPNYLSYCIFRFLTGMALSGIGLNTTALIVEWVPTRVRTVTGTLAGFSYTAGQLLLAGLAYGMRDWRWLQLCVSLPFFIYFLYAWWFPESARWLVLSGKPEKAVKEIRKVANLNGKKEEGEKITLESLKSEMIKELASAKSSYSVIDLVRTNTIRRISCALSLVWFSTSFAYYGLAMDLQKFNVSIYLIQVIFGAVDFPAKLVSATAMIYVGRKFTQFMSLILGGIAIIANIFVP--NELQTV-RTSLAVFGKGCLAASFSCIFLYTTELYPTVIRQSGLGMCSTMARIGGIVAPLVKILGELYPFVPLLIYGGAPIISGLCVF-FLPETVNKPLPDTI 521          
BLAST of slc22a-7 vs. Ensembl Xenopus
Match: emc2 (ER membrane protein complex subunit 2 [Source:Xenbase;Acc:XB-GENE-484487])

HSP 1 Score: 100.908 bits (250), Expect = 7.174e-22
Identity = 113/538 (21.00%), Postives = 234/538 (43.49%), Query Frame = 3
Query:   60 ENVISFYNKKDTFKVIAFLILSLPAFQYGSQFQNLLVSIQTPNFTCQYNETSHQIQISKDQCTMTINGSNVKCQH---------------------------------WTFSSEPFGKTIMSDYDLVCDYKYVGDLLVLLWYSTSLMAP-VFGWLADKYGRKMISIIFLSIETVATFILAFTPNLSSHIFFRLCIGFSE-SAYHICYVWLMEMVNKDFRNVAGSF-FWLYGSVAMTVFPLTVYVTRNWRLTQLISLTPSILYVLILF--VPESPRWLCVKNKKQQLMESLQTIANINKMDLQLTPXXXXXXXXXXXSNKWNAFKDNNFLFLASTXXXXXXXXXXXXX---------XXXXXXXXXXXXXXXXMFVLGLMEFPGALLSYLSMYFFKRK-RMITIFSMFGSIFIFLSVTLSKVDKWQSIFRMIFGSIGKVLVITSSQGVLVYATELFPTTHRSLFFGMLQIILLMAMTAAVYINKLNQFYGFIPMLIY----FLLNMISCCLIFVFMPETKGLPIPETIFDQRLLVKERE 1517
            +   +F  +   F+V  F +LS      G    + +    TP   C   E+++     ++      +G + +C+                                  W +S   +  TI+++++LVC+  + G L   L++   L+   V G ++D++GRK +    ++++T  + I  F+ N        + +G  + S Y   ++   E+++K  R +  +    ++ ++   + PL  Y  R+WR T L++LT   L+ + L+  +PESPRWL  + + Q+  + ++  A  N     +TP +     T  +  K    K + FL L  T    + +   ++           + ++   L  + Y++ F+  ++E P  ++++L +  F R+    +   + G + +F+ +    V +   I  ++   +GK  + ++   V VY  EL+PT  R++  G   +   M    + Y   L  +  F+P ++      L+ M + CL     PE+ G+P+P+TI ++ L VK  +
Sbjct:    5 DQATAFLGEWGPFQVSVFFLLSASIIPNGFTGLSAVFLAATPEHRCHVPESANLSAAWRNASIPRQDGQDSQCRRYRLGTLTNYSALGLLPGRDVDVTGIEQEPCLDGWNYSKSLYLSTIVTEWNLVCENDWKGPLTTSLFFVGVLIGSFVSGQMSDRFGRKKVLFATMAVQTGFSIIQVFSVNWEMFTALFIIVGMGQISNYVAAFILGAEILDKSVRIIFSTLGVCIFYAIGYMLLPLFAYFIRDWR-TLLLALTIPGLFCIPLWWIIPESPRWLISQGRFQEAEDIIRKAAKKNG----ITPPDSIFNFTELQEQKELTHKSHTFLDLLKTRNIRIITFLSILLWMIISVGYFGLSLNTPNLHGDPYVNCFLSAIIEVPAYVIAWLLLRSFPRRYSTASTLVLGGVVLLFIQL----VPQELGILSIVLVMLGKFGITSAFSMVYVYTAELYPTVVRNMGVGASSMASRMGSILSPYFVYLGAYDRFLPFILMGSLTVLIGMFTLCL-----PESHGMPLPDTI-EEMLRVKGEQ 527          
BLAST of slc22a-7 vs. Ensembl Mouse
Match: Slc22a5 (solute carrier family 22 (organic cation transporter), member 5 [Source:MGI Symbol;Acc:MGI:1329012])

HSP 1 Score: 106.301 bits (264), Expect = 9.850e-24
Identity = 113/462 (24.46%), Postives = 219/462 (47.40%), Query Frame = 3
Query:  186 NFTCQYNETSHQIQISKDQCTMTINGSNVKCQHWTFSSEPFGKTIMSDYDLVCDYKYVGDLLVLLWYSTSLMAP-VFGWLADKYGRKMISIIFLSIETVATFILAFTPNLSSHIFFRLCIGFSE-SAYHICYVWLMEMVNKDFRNVAGSF----FWLYGSVAMTVFPLTVYVTRNWRLTQLISLTPSIL-YVLILFVPESPRWLCVKNKKQQLMESLQTIANINKMDLQLTPXXXXXXXXXXXSNK--------WNAFKDNNFLFLASTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMFVLGLMEFPGALLSYLSMYFFKRKRMITIFSMF--GSIFIFLSVTLSKVDKWQSIFRMIFGSIGKVLVITSSQGVLVYATELFPTTHRSLFFGMLQIILLMAMTAAVYINKLNQFYGFIPMLIYFLLNMISCCLIFVFMPETKGLPIPETIFDQRLLVKEREQ 1520
            NF+    E    + + + +    ++G       W +  + F  TI++++DLVC   +   L   L++   LM   + G L+D++GRK +  + + ++T  +F+  F+ N        + +G  + S Y   +V   E+++K  R +  +     F+ +G     V PL  Y  R+WR+  L    P +L   L  F+PESPRWL  + + ++    ++  A IN +   + P  I      ++ N         ++  +  N   +   S+    +IS+    + +D   L  +IY++ F+L  +E P  +L++L + +  R+  I+  ++F  GS+ +F+ +  S++    +   M    +GK  + ++   V VY  EL+PT  R++  G+      +    + Y   L  +  F+P ++   L +++  L  +F PE+ G+P+P+TI DQ L VK  +Q
Sbjct:   91 NFSELGLEPGRDVDLEQLEQESCLDG-------WEYDKDVFLSTIVTEWDLVCKDDWKAPLTTSLFFVGVLMGSFISGQLSDRFGRKNVLFLTMGMQTGFSFLQVFSVNFEMFTVLFVLVGMGQISNYVAAFVLGTEILSKSIRIIFATLGVCIFYAFG---FMVLPLFAYFIRDWRMLLLALTVPGVLCGALWWFIPESPRWLISQGRIKEAEVIIRKAAKINGI---VAPSTIFDPSELQDLNSTKPQLHHIYDLIRTRNIRVITIMSIILWLTISVGYFGLSLDTPNLHGDIYVNCFLLAAVEVPAYVLAWLLLQYLPRRYSISA-ALFLGGSVLLFMQLVPSELFYLSTALVM----VGKFGITSAYSMVYVYTAELYPTVVRNMGVGVSSTASRLGSILSPYFVYLGAYDRFLPYILMGSLTILTAILT-LFFPESFGVPLPDTI-DQMLRVKGIKQ 532          
BLAST of slc22a-7 vs. Ensembl Mouse
Match: Slc22a21 (solute carrier family 22 (organic cation transporter), member 21 [Source:MGI Symbol;Acc:MGI:1929481])

HSP 1 Score: 97.4413 bits (241), Expect = 6.997e-21
Identity = 111/436 (25.46%), Postives = 202/436 (46.33%), Query Frame = 3
Query:  285 WTFSSEPFGKTIMSDYDLVCDYKYVGDLLVLLWYSTSLMAP-VFGWLADKYGRKMISIIFLSIETVATFILAFTPNLSSHIFFRLCIGFSE-SAYHICYVWLMEMVNKDFRNVAGSF----FWLYGSVAMTVFPLTVYVTRNWRLTQLISLTPSIL-YVLILFVPESPRWLCVKNKKQQLMESLQTIANINKM-------DLQLTPXXXXXXXXXXXSNK-WNAFKDNNFLFLASTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMFVLGLMEFPGALLSYLSMYFFKRKRMITIFSMFGSIFIFLSVTL------SKVDKWQSIFRMIFGSIGKVLVITSSQGVLVYATELFPTTHRSLFFGMLQIILLMAMTAAVYINKLNQFYGFIPMLIYFLLNMISCCLIFVFMPETKGLPIPETIFDQRLLVKEREQEYL 1529
            W +  + F  TI++++DLVC   +   L    +Y   L+   + G L+D++GRK I  + +++ T  +FI  F+ N          +G    S Y   +V   EM++K  R +  +     F+ +G     V PL  Y  R WR   L    P +L   L  F+PESPRWL  + + ++    ++  A IN +       D   T +         +S+  ++  +  N   L   S+    +IS+    + +D   L+ NIY++ F+L  +E P  +L++L +    R+     +SM GS+F+  SV L      S +    +   M    +GK  + ++   V VY  EL+PT  R++  G+      +    + Y   L  +   +P ++   L +++  +I +F PE+ G+ +PETI + + + K ++++ L
Sbjct:  117 WEYDKDIFLSTIVTEWDLVCKDDWKAPLTTSFFYVGVLLGSFISGQLSDRFGRKNILFLTMAMHTGFSFIQVFSVNFEMFTLLYTLVGMGHISNYVAAFVLGTEMLSKSVRIIFATLGVCIFFAFG---FMVLPLFAYFIREWRRLLLAITLPGVLCGALWWFIPESPRWLISQGRIKEAEVIIRKAAKINGIVAPSTIFDPSETNKLQDDSSKKPQSHHIYDLVRTPNIRILTIMSIILWLTISVGYFGLSLDTPNLNGNIYVNCFLLAAVEVPAYVLAWLLLQHVSRR-----YSMAGSLFLGGSVLLLVQLVPSDLHYLSTTLVM----VGKFGITSAYSMVYVYTAELYPTVVRNMGVGVSSTASRLGSILSPYFVYLGAYDRRLPYILMGSLTILT-AIITLFFPESSGVSLPETIDEMQKVKKLKQRQSL 539          
BLAST of slc22a-7 vs. Ensembl Mouse
Match: Slc22a20 (solute carrier family 22 (organic anion transporter), member 20 [Source:MGI Symbol;Acc:MGI:2685809])

HSP 1 Score: 97.0561 bits (240), Expect = 7.643e-21
Identity = 94/424 (22.17%), Postives = 192/424 (45.28%), Query Frame = 3
Query:  285 WTFSSEPFGKTIMSDYDLVCDYKYVGDLLVLLWYSTSLM-APVFGWLADKYGRK---MISIIFLSIETVATFILAFTPNLSSHIFFRLCIGFSESAYHICYVWLM-EMVNKDFRNVAGSFFWLYGSVAMTVFPLTVYVTRNWRLTQLISLTPSILYVLI-LFVPESPRWLCVKNKKQQLMESLQTIANINKMDLQLTPXXXXXXXXXXXSNKWNAFKDNNFLFLASTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMFVL---------GLMEFPGALLSYLSMYFFKRKRMITIFSMFGSIFIFLSVTLSKVDKWQSIFRMIFGSIGKVLVITSSQGVLVYATELFPTTHRSLFFGMLQIILLMAMTAAVYINKLNQFYGFIPMLIYFLLNMISCCLIFVFMPETKGLPIPETIFDQRLLVKE 1511
            W +    F  TI+ ++DLVC+ + + DL   ++ S  L+ A +FG LAD+ GRK   + S + L++   AT   A+  + S++  FR  +G + S   +  + L+ E +    R VAG       ++   +     Y+ R WR  Q     P +++ L   ++PES RWL +  K QQ +++LQ +A +N    +      ++  +  +    +    N+ L L  T      +  ++       +      + +  F L         G+++ P  L++  +M +  R+  ++ F +   + +  ++ +   +  Q++ R +  ++GK  + +S   V ++  EL+PT  R +  G   +   +    A  I  L +    +P + +   ++++   +  F+ ET+ +P+ ETI      VK+
Sbjct:  111 WVYDRSIFPSTIVMEWDLVCEARTLRDLAQSIYMSGVLVGAALFGGLADRLGRKAPLVWSYLQLAVSGAAT---AYVGSFSAYCVFRFLMGMTFSGIILNSLSLVVEWMPTRGRTVAGILLGFSFTLGQLILAGVAYLIRPWRWLQFAVSAPFLVFFLYSWWLPESSRWLLLHGKAQQAVQNLQKVAMMNGRKAEGERLTTEVVSSYIQDEFASVRTSNSILDLFRTPAIRRVTCCLMGVWFSNSVAYYGLAMDLQKFGLSIYLVQALFGIIDIPAMLVATTTMIYVGRRATVSSFLILAGLMVIANMFMP--EDLQTL-RTVQAALGKGCLASSFICVYLFTGELYPTEIRQMGMGFASVNARLGGLVAPLITTLGEISPVLPPVSFGATSVLAGMAVACFLTETRNVPLVETIAAMERRVKQ 528          
BLAST of slc22a-7 vs. Ensembl Mouse
Match: Slc22a3 (solute carrier family 22 (organic cation transporter), member 3 [Source:MGI Symbol;Acc:MGI:1333817])

HSP 1 Score: 92.4337 bits (228), Expect = 8.003e-20
Identity = 57/182 (31.32%), Postives = 97/182 (53.30%), Query Frame = 3
Query:  315 TIMSDYDLVCDYKYVGDLLVLLWYSTSLMAPVF--GWLADKYGRKMISIIFLSIETVATFILAFTPNLSSHIFFRLCIG-FSESAYHICYVWLMEMVNKDFRNVAGSFFWLYGSVAMTVFPLTVYVTRNWRLTQLISLTPSILYVLILF-VPESPRWLCVKNKKQQLMESLQTIANINKMDL 848
            TI+S +DLVC   ++ DL   +  +   +A  F  G+ AD+YGR +I +I      +   ++AF PN S  + FR   G F + A+  C+V + E+V    R + G    ++ ++ + + P   Y T +W+  QL    PS L++L  + VPESPRWL  + + ++ ++ L+ +A  N   L
Sbjct:  134 TIVSQFDLVCSNAWMLDLTQAI-LNLGFLAGAFTLGYAADRYGRLIIYLISCFGVGITGVVVAFAPNFSVFVIFRFLQGVFGKGAWMTCFVIVTEIVGSKQRRIVGIVIQMFFTLGIIILPGIAYFTPSWQGIQLAISLPSFLFLLYYWVVPESPRWLITRKQGEKALQILRRVAKCNGKHL 314          
BLAST of slc22a-7 vs. Ensembl Mouse
Match: Slc22a3 (solute carrier family 22 (organic cation transporter), member 3 [Source:MGI Symbol;Acc:MGI:1333817])

HSP 1 Score: 93.9745 bits (232), Expect = 8.068e-20
Identity = 57/183 (31.15%), Postives = 97/183 (53.01%), Query Frame = 3
Query:  312 KTIMSDYDLVCDYKYVGDLLVLLWYSTSLMAPVF--GWLADKYGRKMISIIFLSIETVATFILAFTPNLSSHIFFRLCIG-FSESAYHICYVWLMEMVNKDFRNVAGSFFWLYGSVAMTVFPLTVYVTRNWRLTQLISLTPSILYVLILF-VPESPRWLCVKNKKQQLMESLQTIANINKMDL 848
             TI+S +DLVC   ++ DL   +  +   +A  F  G+ AD+YGR +I +I      +   ++AF PN S  + FR   G F + A+  C+V + E+V    R + G    ++ ++ + + P   Y T +W+  QL    PS L++L  + VPESPRWL  + + ++ ++ L+ +A  N   L
Sbjct:  133 STIVSQFDLVCSNAWMLDLTQAI-LNLGFLAGAFTLGYAADRYGRLIIYLISCFGVGITGVVVAFAPNFSVFVIFRFLQGVFGKGAWMTCFVIVTEIVGSKQRRIVGIVIQMFFTLGIIILPGIAYFTPSWQGIQLAISLPSFLFLLYYWVVPESPRWLITRKQGEKALQILRRVAKCNGKHL 314          

HSP 2 Score: 54.6842 bits (130), Expect = 2.035e-7
Identity = 41/161 (25.47%), Postives = 81/161 (50.31%), Query Frame = 3
Query: 1038 FVLGLMEFPGALLSYLSMYFFKRKRMITIFSMFGSIFIFLSVTLSKVDKWQSIFRMIFGSIGKVLVITSSQGVLVYATELFPTTHRSL----------FFGMLQIILLMAMTAAVYINKLNQFYGFIPMLIYFLLNMISCCLIFVFMPETKGLPIPETIFD 1490
            F+ GL+E PGALL  L++    R+      ++   +   ++  L +   W    R    ++G++ +  + + V +  +EL+PTT R+           F G++   LL  + AA+++         +P++I+ +L  + C  + + +PETKG+ +PET+ D
Sbjct:  379 FISGLVELPGALLILLTIERLGRRLPFAASNIVAGVSCLVTAFLPEGIPW---LRTTVATLGRLGITMAFEIVYLVNSELYPTTLRNFGVSLCSGLCDFGGIIAPFLLFRL-AAIWLE--------LPLIIFGILASV-CGGLVMLLPETKGIALPETVED 526          
BLAST of slc22a-7 vs. UniProt/SwissProt
Match: sp|Q9Z0E8|S22A5_MOUSE (Solute carrier family 22 member 5 OS=Mus musculus OX=10090 GN=Slc22a5 PE=1 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 6.890e-23
Identity = 113/462 (24.46%), Postives = 219/462 (47.40%), Query Frame = 3
Query:  186 NFTCQYNETSHQIQISKDQCTMTINGSNVKCQHWTFSSEPFGKTIMSDYDLVCDYKYVGDLLVLLWYSTSLMAP-VFGWLADKYGRKMISIIFLSIETVATFILAFTPNLSSHIFFRLCIGFSE-SAYHICYVWLMEMVNKDFRNVAGSF----FWLYGSVAMTVFPLTVYVTRNWRLTQLISLTPSIL-YVLILFVPESPRWLCVKNKKQQLMESLQTIANINKMDLQLTPXXXXXXXXXXXSNK--------WNAFKDNNFLFLASTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMFVLGLMEFPGALLSYLSMYFFKRKRMITIFSMF--GSIFIFLSVTLSKVDKWQSIFRMIFGSIGKVLVITSSQGVLVYATELFPTTHRSLFFGMLQIILLMAMTAAVYINKLNQFYGFIPMLIYFLLNMISCCLIFVFMPETKGLPIPETIFDQRLLVKEREQ 1520
            NF+    E    + + + +    ++G       W +  + F  TI++++DLVC   +   L   L++   LM   + G L+D++GRK +  + + ++T  +F+  F+ N        + +G  + S Y   +V   E+++K  R +  +     F+ +G     V PL  Y  R+WR+  L    P +L   L  F+PESPRWL  + + ++    ++  A IN +   + P  I      ++ N         ++  +  N   +   S+    +IS+    + +D   L  +IY++ F+L  +E P  +L++L + +  R+  I+  ++F  GS+ +F+ +  S++    +   M    +GK  + ++   V VY  EL+PT  R++  G+      +    + Y   L  +  F+P ++   L +++  L  +F PE+ G+P+P+TI DQ L VK  +Q
Sbjct:   91 NFSELGLEPGRDVDLEQLEQESCLDG-------WEYDKDVFLSTIVTEWDLVCKDDWKAPLTTSLFFVGVLMGSFISGQLSDRFGRKNVLFLTMGMQTGFSFLQVFSVNFEMFTVLFVLVGMGQISNYVAAFVLGTEILSKSIRIIFATLGVCIFYAFG---FMVLPLFAYFIRDWRMLLLALTVPGVLCGALWWFIPESPRWLISQGRIKEAEVIIRKAAKINGI---VAPSTIFDPSELQDLNSTKPQLHHIYDLIRTRNIRVITIMSIILWLTISVGYFGLSLDTPNLHGDIYVNCFLLAAVEVPAYVLAWLLLQYLPRRYSISA-ALFLGGSVLLFMQLVPSELFYLSTALVM----VGKFGITSAYSMVYVYTAELYPTVVRNMGVGVSSTASRLGSILSPYFVYLGAYDRFLPYILMGSLTILTAILT-LFFPESFGVPLPDTI-DQMLRVKGIKQ 532          
BLAST of slc22a-7 vs. UniProt/SwissProt
Match: sp|O70594|S22A5_RAT (Solute carrier family 22 member 5 OS=Rattus norvegicus OX=10116 GN=Slc22a5 PE=1 SV=1)

HSP 1 Score: 103.219 bits (256), Expect = 5.687e-22
Identity = 112/462 (24.24%), Postives = 217/462 (46.97%), Query Frame = 3
Query:  186 NFTCQYNETSHQIQISKDQCTMTINGSNVKCQHWTFSSEPFGKTIMSDYDLVCDYKYVGDLLVLLWYSTSLMAP-VFGWLADKYGRKMISIIFLSIETVATFILAFTPNLSSHIFFRLCIGFSE-SAYHICYVWLMEMVNKDFRNVAGSF----FWLYGSVAMTVFPLTVYVTRNWRLTQLISLTPSIL-YVLILFVPESPRWLCVKNKKQQLMESLQTIANINKMDLQLTPXXXXXXXXXXXSNK--------WNAFKDNNFLFLASTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMFVLGLMEFPGALLSYLSMYFFKRKRMITIFSMF--GSIFIFLSVTLSKVDKWQSIFRMIFGSIGKVLVITSSQGVLVYATELFPTTHRSLFFGMLQIILLMAMTAAVYINKLNQFYGFIPMLIYFLLNMISCCLIFVFMPETKGLPIPETIFDQRLLVKEREQ 1520
            NF+    E    + + + +    ++G       W ++ + F  TI++++DLVC   +   L   L++   LM   + G L+D++GRK +  + + ++T  +F+  F+ N        + +G  + S Y   +V   E+++K  R +  +     F+ +G     V PL  Y  R+WR+  L    P +L   L  F+PESPRWL  + + ++    ++  A  N +   + P  I      ++ N         ++  +  N   +   S+    +IS+    + +D   L  +IY++ F+L  +E P  +L++L +    R+  I+  ++F  GS+ +F+ +  S++    +   M    +GK  + ++   V VY  EL+PT  R++  G+      +    + Y   L  +  F+P ++   L +++  L  +F PE+ G P+P+TI DQ L VK  +Q
Sbjct:   91 NFSALGLEPGRDVDLEQLEQENCLDG-------WEYNKDVFLSTIVTEWDLVCKDDWKAPLTTSLFFVGVLMGSFISGQLSDRFGRKNVLFLTMGMQTGFSFLQLFSVNFEMFTVLFVLVGMGQISNYVAAFVLGTEILSKSIRIIFATLGVCIFYAFG---FMVLPLFAYFIRDWRMLLLALTVPGVLCGALWWFIPESPRWLISQGRVKEAEVIIRKAAKFNGI---VAPSTIFDPSELQDLNSKKPQSHHIYDLVRTRNIRIITIMSIILWLTISVGYFGLSLDTPNLHGDIYVNCFLLAAVEVPAYVLAWLLLQHLPRRYSISA-ALFLGGSVLLFIQLVPSELFYLSTALVM----VGKFGITSAYSMVYVYTAELYPTVVRNMGVGVSSTASRLGSILSPYFVYLGAYDRFLPYILMGSLTILTAILT-LFFPESFGAPLPDTI-DQMLRVKGIKQ 532          
BLAST of slc22a-7 vs. UniProt/SwissProt
Match: sp|Q9WTN6|S22AL_MOUSE (Solute carrier family 22 member 21 OS=Mus musculus OX=10090 GN=Slc22a21 PE=2 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 4.894e-20
Identity = 111/436 (25.46%), Postives = 202/436 (46.33%), Query Frame = 3
Query:  285 WTFSSEPFGKTIMSDYDLVCDYKYVGDLLVLLWYSTSLMAP-VFGWLADKYGRKMISIIFLSIETVATFILAFTPNLSSHIFFRLCIGFSE-SAYHICYVWLMEMVNKDFRNVAGSF----FWLYGSVAMTVFPLTVYVTRNWRLTQLISLTPSIL-YVLILFVPESPRWLCVKNKKQQLMESLQTIANINKM-------DLQLTPXXXXXXXXXXXSNK-WNAFKDNNFLFLASTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMFVLGLMEFPGALLSYLSMYFFKRKRMITIFSMFGSIFIFLSVTL------SKVDKWQSIFRMIFGSIGKVLVITSSQGVLVYATELFPTTHRSLFFGMLQIILLMAMTAAVYINKLNQFYGFIPMLIYFLLNMISCCLIFVFMPETKGLPIPETIFDQRLLVKEREQEYL 1529
            W +  + F  TI++++DLVC   +   L    +Y   L+   + G L+D++GRK I  + +++ T  +FI  F+ N          +G    S Y   +V   EM++K  R +  +     F+ +G     V PL  Y  R WR   L    P +L   L  F+PESPRWL  + + ++    ++  A IN +       D   T +         +S+  ++  +  N   L   S+    +IS+    + +D   L+ NIY++ F+L  +E P  +L++L +    R+     +SM GS+F+  SV L      S +    +   M    +GK  + ++   V VY  EL+PT  R++  G+      +    + Y   L  +   +P ++   L +++  +I +F PE+ G+ +PETI + + + K ++++ L
Sbjct:  117 WEYDKDIFLSTIVTEWDLVCKDDWKAPLTTSFFYVGVLLGSFISGQLSDRFGRKNILFLTMAMHTGFSFIQVFSVNFEMFTLLYTLVGMGHISNYVAAFVLGTEMLSKSVRIIFATLGVCIFFAFG---FMVLPLFAYFIREWRRLLLAITLPGVLCGALWWFIPESPRWLISQGRIKEAEVIIRKAAKINGIVAPSTIFDPSETNKLQDDSSKKPQSHHIYDLVRTPNIRILTIMSIILWLTISVGYFGLSLDTPNLNGNIYVNCFLLAAVEVPAYVLAWLLLQHVSRR-----YSMAGSLFLGGSVLLLVQLVPSDLHYLSTTLVM----VGKFGITSAYSMVYVYTAELYPTVVRNMGVGVSSTASRLGSILSPYFVYLGAYDRRLPYILMGSLTILT-AIITLFFPESSGVSLPETIDEMQKVKKLKQRQSL 539          
BLAST of slc22a-7 vs. UniProt/SwissProt
Match: sp|Q80UJ1|S22AK_MOUSE (Solute carrier family 22 member 20 OS=Mus musculus OX=10090 GN=Slc22a20 PE=1 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 5.347e-20
Identity = 94/424 (22.17%), Postives = 192/424 (45.28%), Query Frame = 3
Query:  285 WTFSSEPFGKTIMSDYDLVCDYKYVGDLLVLLWYSTSLM-APVFGWLADKYGRK---MISIIFLSIETVATFILAFTPNLSSHIFFRLCIGFSESAYHICYVWLM-EMVNKDFRNVAGSFFWLYGSVAMTVFPLTVYVTRNWRLTQLISLTPSILYVLI-LFVPESPRWLCVKNKKQQLMESLQTIANINKMDLQLTPXXXXXXXXXXXSNKWNAFKDNNFLFLASTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMFVL---------GLMEFPGALLSYLSMYFFKRKRMITIFSMFGSIFIFLSVTLSKVDKWQSIFRMIFGSIGKVLVITSSQGVLVYATELFPTTHRSLFFGMLQIILLMAMTAAVYINKLNQFYGFIPMLIYFLLNMISCCLIFVFMPETKGLPIPETIFDQRLLVKE 1511
            W +    F  TI+ ++DLVC+ + + DL   ++ S  L+ A +FG LAD+ GRK   + S + L++   AT   A+  + S++  FR  +G + S   +  + L+ E +    R VAG       ++   +     Y+ R WR  Q     P +++ L   ++PES RWL +  K QQ +++LQ +A +N    +      ++  +  +    +    N+ L L  T      +  ++       +      + +  F L         G+++ P  L++  +M +  R+  ++ F +   + +  ++ +   +  Q++ R +  ++GK  + +S   V ++  EL+PT  R +  G   +   +    A  I  L +    +P + +   ++++   +  F+ ET+ +P+ ETI      VK+
Sbjct:  111 WVYDRSIFPSTIVMEWDLVCEARTLRDLAQSIYMSGVLVGAALFGGLADRLGRKAPLVWSYLQLAVSGAAT---AYVGSFSAYCVFRFLMGMTFSGIILNSLSLVVEWMPTRGRTVAGILLGFSFTLGQLILAGVAYLIRPWRWLQFAVSAPFLVFFLYSWWLPESSRWLLLHGKAQQAVQNLQKVAMMNGRKAEGERLTTEVVSSYIQDEFASVRTSNSILDLFRTPAIRRVTCCLMGVWFSNSVAYYGLAMDLQKFGLSIYLVQALFGIIDIPAMLVATTTMIYVGRRATVSSFLILAGLMVIANMFMP--EDLQTL-RTVQAALGKGCLASSFICVYLFTGELYPTEIRQMGMGFASVNARLGGLVAPLITTLGEISPVLPPVSFGATSVLAGMAVACFLTETRNVPLVETIAAMERRVKQ 528          
BLAST of slc22a-7 vs. UniProt/SwissProt
Match: sp|Q9WTW5|S22A3_MOUSE (Solute carrier family 22 member 3 OS=Mus musculus OX=10090 GN=Slc22a3 PE=2 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 5.644e-19
Identity = 57/183 (31.15%), Postives = 97/183 (53.01%), Query Frame = 3
Query:  312 KTIMSDYDLVCDYKYVGDLLVLLWYSTSLMAPVF--GWLADKYGRKMISIIFLSIETVATFILAFTPNLSSHIFFRLCIG-FSESAYHICYVWLMEMVNKDFRNVAGSFFWLYGSVAMTVFPLTVYVTRNWRLTQLISLTPSILYVLILF-VPESPRWLCVKNKKQQLMESLQTIANINKMDL 848
             TI+S +DLVC   ++ DL   +  +   +A  F  G+ AD+YGR +I +I      +   ++AF PN S  + FR   G F + A+  C+V + E+V    R + G    ++ ++ + + P   Y T +W+  QL    PS L++L  + VPESPRWL  + + ++ ++ L+ +A  N   L
Sbjct:  133 STIVSQFDLVCSNAWMLDLTQAI-LNLGFLAGAFTLGYAADRYGRLIIYLISCFGVGITGVVVAFAPNFSVFVIFRFLQGVFGKGAWMTCFVIVTEIVGSKQRRIVGIVIQMFFTLGIIILPGIAYFTPSWQGIQLAISLPSFLFLLYYWVVPESPRWLITRKQGEKALQILRRVAKCNGKHL 314          

HSP 2 Score: 54.6842 bits (130), Expect = 1.424e-6
Identity = 41/161 (25.47%), Postives = 81/161 (50.31%), Query Frame = 3
Query: 1038 FVLGLMEFPGALLSYLSMYFFKRKRMITIFSMFGSIFIFLSVTLSKVDKWQSIFRMIFGSIGKVLVITSSQGVLVYATELFPTTHRSL----------FFGMLQIILLMAMTAAVYINKLNQFYGFIPMLIYFLLNMISCCLIFVFMPETKGLPIPETIFD 1490
            F+ GL+E PGALL  L++    R+      ++   +   ++  L +   W    R    ++G++ +  + + V +  +EL+PTT R+           F G++   LL  + AA+++         +P++I+ +L  + C  + + +PETKG+ +PET+ D
Sbjct:  379 FISGLVELPGALLILLTIERLGRRLPFAASNIVAGVSCLVTAFLPEGIPW---LRTTVATLGRLGITMAFEIVYLVNSELYPTTLRNFGVSLCSGLCDFGGIIAPFLLFRL-AAIWLE--------LPLIIFGILASV-CGGLVMLLPETKGIALPETVED 526          
BLAST of slc22a-7 vs. TrEMBL
Match: A0A0H3YF34 (Slc22a-7 OS=Schmidtea mediterranea OX=79327 GN=slc22a-7 PE=2 SV=1)

HSP 1 Score: 983.786 bits (2542), Expect = 0.000e+0
Identity = 525/525 (100.00%), Postives = 525/525 (100.00%), Query Frame = 3
Query:   51 MILENVISFYNKKDTFKVIAFLILSLPAFQYGSQFQNLLVSIQTPNFTCQYNETSHQIQISKDQCTMTINGSNVKCQHWTFSSEPFGKTIMSDYDLVCDYKYVGDLLVLLWYSTSLMAPVFGWLADKYGRKMISIIFLSIETVATFILAFTPNLSSHIFFRLCIGFSESAYHICYVWLMEMVNKDFRNVAGSFFWLYGSVAMTVFPLTVYVTRNWRLTQLISLTPSILYVLILFVPESPRWLCVKNKKQQLMESLQTIANINKMDLQLTPXXXXXXXXXXXSNKWNAFKDNNFLFLASTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMFVLGLMEFPGALLSYLSMYFFKRKRMITIFSMFGSIFIFLSVTLSKVDKWQSIFRMIFGSIGKVLVITSSQGVLVYATELFPTTHRSLFFGMLQIILLMAMTAAVYINKLNQFYGFIPMLIYFLLNMISCCLIFVFMPETKGLPIPETIFDQRLLVKEREQEYLEYMYNRSDVVNSDREDSDASSEMSQLINRKFR 1625
            MILENVISFYNKKDTFKVIAFLILSLPAFQYGSQFQNLLVSIQTPNFTCQYNETSHQIQISKDQCTMTINGSNVKCQHWTFSSEPFGKTIMSDYDLVCDYKYVGDLLVLLWYSTSLMAPVFGWLADKYGRKMISIIFLSIETVATFILAFTPNLSSHIFFRLCIGFSESAYHICYVWLMEMVNKDFRNVAGSFFWLYGSVAMTVFPLTVYVTRNWRLTQLISLTPSILYVLILFVPESPRWLCVKNKKQQLMESLQTIANINKMDLQLTPEEIKIEKTTKESNKWNAFKDNNFLFLASTSLFAVFSISILISAILIDLNLLSSNIYISMFVLGLMEFPGALLSYLSMYFFKRKRMITIFSMFGSIFIFLSVTLSKVDKWQSIFRMIFGSIGKVLVITSSQGVLVYATELFPTTHRSLFFGMLQIILLMAMTAAVYINKLNQFYGFIPMLIYFLLNMISCCLIFVFMPETKGLPIPETIFDQRLLVKEREQEYLEYMYNRSDVVNSDREDSDASSEMSQLINRKFR
Sbjct:    1 MILENVISFYNKKDTFKVIAFLILSLPAFQYGSQFQNLLVSIQTPNFTCQYNETSHQIQISKDQCTMTINGSNVKCQHWTFSSEPFGKTIMSDYDLVCDYKYVGDLLVLLWYSTSLMAPVFGWLADKYGRKMISIIFLSIETVATFILAFTPNLSSHIFFRLCIGFSESAYHICYVWLMEMVNKDFRNVAGSFFWLYGSVAMTVFPLTVYVTRNWRLTQLISLTPSILYVLILFVPESPRWLCVKNKKQQLMESLQTIANINKMDLQLTPEEIKIEKTTKESNKWNAFKDNNFLFLASTSLFAVFSISILISAILIDLNLLSSNIYISMFVLGLMEFPGALLSYLSMYFFKRKRMITIFSMFGSIFIFLSVTLSKVDKWQSIFRMIFGSIGKVLVITSSQGVLVYATELFPTTHRSLFFGMLQIILLMAMTAAVYINKLNQFYGFIPMLIYFLLNMISCCLIFVFMPETKGLPIPETIFDQRLLVKEREQEYLEYMYNRSDVVNSDREDSDASSEMSQLINRKFR 525          
BLAST of slc22a-7 vs. TrEMBL
Match: A0A0H3YJ93 (Slc22a-1 OS=Schmidtea mediterranea OX=79327 GN=slc22a-1 PE=2 SV=1)

HSP 1 Score: 528.48 bits (1360), Expect = 1.347e-180
Identity = 272/528 (51.52%), Postives = 382/528 (72.35%), Query Frame = 3
Query:   51 MILENVISFYNKKDTFKVIAFLILSLPAFQYGSQFQNLLVSIQTPNFTCQYNETSHQIQISKDQCTMTINGSNVKCQHWTFSSEPFGKTIMSDYDLVCDYKYVGDLLVLLWYSTSLMAPVFGWLADKYGRKMISIIFLSIETVATFILAFTPNLSSHIFFRLCIGFSESAYHICYVWLMEMVNKDFRNVAGSFFWLYGSVAMTVFPLTVYVTRNWRLTQLISLTPSILYVLILFVPESPRWLCVKNKKQQLMESLQTIANINKMDLQLTPXXXXXXXXXXXSNKWNAFKDNNFLFLASTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMFVLGLMEFPGALLSYLSMYFFKRKRMITIFSMFGSIFIFLSVTLSKVDKWQSIFRMIFGSIGKVLVITSSQGVLVYATELFPTTHRSLFFGMLQIILLMAMTAAVYINKLNQFYGFIPMLIYFLLNMISCCLIFVFMPETKGLPIPETIFDQRLLVKEREQEYLEYMYNRSDV-VNSDRE----DSDASSEMSQLINRK 1619
            MILE+++  YNK++TFK +AF ILSLP+FQ+ SQ QN+L+S  TP +TC YN +  +I IS DQC M I+GS + C  W FS EP G+T+MSD+ LVCDYK +GD+++++WYSTS+  P+ GW +DK+GRK ++I  L +ET++TF ++FTP+++S+I  RL IG S + ++ CYVWLMEMV+ +FR  +GSF W YG +A  VFPLT Y T++WR+TQLISL P+ILY LIL  PESPRWLCV N+K +L++SL  IA INK+D  +  ++I + KT  E N W A KD  F    + S   VFSI+++ +AI ++L +LS+N+YISMF+LGLMEFPG LLSY+S+ FF+RK    +    GSIFI +SV  S+   WQ + R+IFG I K+ V T +Q  +VY +EL PT+HRSL F  +Q+  L + TAAVYINKL+    F+PM+IYF+L  ++ C+I++++PETK LPIPET+ DQ++L   +E+E+L+YM  + ++ V SD +     S+ S+E S LINRK
Sbjct:    1 MILEDILKDYNKRNTFKFLAFFILSLPSFQFSSQMQNILISTYTPKYTCLYNSSFSKISISADQCNMIIDGSTIVCNKWNFSYEPVGRTMMSDFSLVCDYKNLGDIILIVWYSTSITGPIMGWFSDKFGRKKVAIFNLCLETISTFFVSFTPDVTSNIICRLLIGISANGFYTCYVWLMEMVDNEFREFSGSFIWTYGCLAYMVFPLTAYFTKDWRITQLISLIPNILYFLILLFPESPRWLCVTNRKSELIKSLNKIAEINKIDTNINYDQIFVPKTKDEHNTWKALKDKTFSLRMTLSFLLVFSINLIYAAIAVNLQILSNNMYISMFLLGLMEFPGILLSYVSLRFFRRKTSFILIGGIGSIFILISVFFSRNILWQGVIRIIFGCIAKIAVTTCNQSTMVYVSELCPTSHRSLGFASIQLANLCSFTAAVYINKLSTVLFFLPMVIYFILMFLTSCIIYLYLPETKNLPIPETLLDQKMLKVNKEKEFLDYMNKKREMEVESDLDLDLLKSNESTEESHLINRK 528          
BLAST of slc22a-7 vs. TrEMBL
Match: A0A0H3YFD1 (Slc22a-9 OS=Schmidtea mediterranea OX=79327 GN=slc22a-9 PE=2 SV=1)

HSP 1 Score: 410.994 bits (1055), Expect = 1.819e-134
Identity = 227/528 (42.99%), Postives = 357/528 (67.61%), Query Frame = 3
Query:   51 MILENVISFYNKKDTFKVIAFLILSLPAFQYGSQFQNLLVSIQTPNFTCQYNETSHQIQISKDQCTMTINGSNVKCQHWTFSSEPFGKTIMSDYDLVCDYKYVGDLLVLLWYSTSLMAPVFGWLADKYGRKMISIIFLSIETVATFILAFTPNLSSHIFFRLCIGFSESAYHICYVWLMEMVNKDFRNVAGSFFWLYGSVAMTVFPLTVYVTRNWRLTQLISLTPSILYVLILFVPESPRWLCVKNKKQQLMESLQTIANINKMDLQLTPXXXXXXXXXXXSNKWNAFKDNNFLFLASTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMFVLGLMEFPGALLSYLSMYFFKRKRMITIFSMFGSIFIFLSVTLSKVDKWQSIFRMIFGSIGKVLVITSSQGVLVYATELFPTTHRSLFFGMLQIILLMAMTAAVYINKLNQFYGFIPMLIYFLLNMISCCLIFVFMPETKGLPIPETIFDQRLLVKEREQEYLEYMYNR-----SDVVNSDREDSDASSEMSQLINRK 1619
            M L+N++S  NK  TFK++AF ILSLP FQ  SQ QN+L ++  PNF C++N  S  I +SKDQC++ +NG+ + C+ W FS  P G T++SD+ LVCD +Y+GD+++++WY+  L+ P+ G+++D++GRK I I+ L +ET ++ +LA +PN ++++ FR+ +G S SA +I  VWL+E V+ +FR   GSF+W Y +VA  VFP+T ++ R+WRL+QL +L PS+ Y+ I F+PESPRWLCV N+K ++MESL+ ++ IN++   +  ++I +E   KE N   A KD +F   + T+LF  FSI+++ S++L+D+ +LSSN+Y+S+F+LGLME P  LLSY  + + KRK    +    GS+ +F+S+  SK    QS+ R++ G + K+ + + +Q ++VY  ELFPTTHRS    +L I   ++ + AV IN+L+    F+P LIYF    I   +++  +PETK LPIPET+ D ++L   +E+E++ YM N+     + V NSD + S+  +E S+LI  K
Sbjct:    1 MFLDNILSDINKPLTFKIVAFFILSLPTFQSCSQIQNILFALFIPNFKCKFNSKSKFI-VSKDQCSILMNGTTMNCKEWDFSLLPIGSTLVSDFGLVCDNRYLGDVILMVWYAMFLLGPLVGFMSDRFGRKNIVILSLVLETFSSILLALSPNFATYLTFRILLGLSASAVYISIVWLIESVSIEFRPFIGSFYWFYWTVAYMVFPITSFLARDWRLSQLFTLIPSVFYLFIFFMPESPRWLCVMNRKDEMMESLRFMSKINRLRFDVEKDQIYVENLVKEGNICVACKDTDFQSRSITALFCAFSINLIYSSMLVDIGILSSNMYLSVFLLGLMELPSLLLSYYVLRYIKRKIGFLLIGGVGSLLLFISIFFSKSIPLQSVIRIVLGCLSKIAISSCNQNIMVYVNELFPTTHRSFGITLLLISNFLSFSGAVLINRLSVISYFLPTLIYFSFLWIVGVVVYFSLPETKDLPIPETLIDMKMLKCGKEEEFVFYMQNKHKYFNNTVDNSDEKSSENLNEKSKLITGK 527          
BLAST of slc22a-7 vs. TrEMBL
Match: A0A267FBR0 (MFS domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig009851g1 PE=4 SV=1)

HSP 1 Score: 166.777 bits (421), Expect = 3.014e-41
Identity = 129/516 (25.00%), Postives = 251/516 (48.64%), Query Frame = 3
Query:  111 FLILSLPAFQYGSQFQNLLVSIQTPNFTC-QYNETSHQIQISKDQCTMT-INGS-------NVKCQHWTFS-SEPFGKTIMSDYDLVCDYKYVGDLLVLLWYSTSLMAPVFGWLADKYGRKMISIIFLSIETVATFILAFTPNLSSHIFFRLCIGFSESAYHICYVWLMEMVNKDFRNVAGSFFWLYGSVAMTVFPLTVYVTRNWRLTQLISLTPSILYVLI-LFVPESPRWLCVKNKKQQLMESLQTIANIN--KMDLQLTPXXXXXXXXXXXSNKWNAFKDNNFLFLASTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMFVLGLMEFPGALLSYLSMYFFKRKRMITIFSMFGSIFIFLSVTLSKVDKWQSIFRMIFGSIGKVLVITSSQGVLVYATELFPTTHRSLFFGMLQIILLMAMTAAVYINKLNQFYGFIPMLIYFLLNMISCCLIFVFMPETKGLPIPETIFDQRLLVKEREQEYLEYMYNRSDVVNSDREDSDASSEMSQLINRK 1619
            FL LS  +F+     + +++++    F C Q N + +  Q   + C+++ + G        N  C  + +   +   K+++ +YDLVCD K+    ++ +++    +  +FG L DK GRK I I+    + + T + AF P   + IF R   GF  + Y+   + + EM  +  R V G+ +WL+  V      + VY+ + W   QL S    + Y++I + VPESPRWL +K + ++ ++ L+ IA  N  K + +++  +    +     N  +          +      +   ++    +  D   +++NI +++ + G +E P + + +L    + RK    I ++  S F  ++V +       +I + +   +GK L+ T      V+A E+FPT+ R+    +   + +++   A  IN L+    F+P LI+ + +++S  L  + +PETKGLP+PET+     LV+ RE+++    ++R +   S  +D D  +  SQ I ++
Sbjct:   21 FLALSFTSFKAVLDLELMVLTLHESKFRCAQQNSSDYVAQNYSEHCSISRLVGDDTNFTLINETCTKFDYQHGDVISKSMVEEYDLVCDRKHYATGMMSVFFLGCALGMLFGTLGDKIGRKKILIVCGVTDLITTILPAFMPTAETQIFARFLKGFPAAVYYQGLLIMEEMTEEKHRAVLGNLYWLFWCVGYMFSGVVVYIFKEWDKIQLFSTVFCLNYIVIFIVVPESPRWLVLKGRVEEAVDVLKRIAKWNGIKWEHKVSKVKALDVEEEPTGNILDLVTYPEMRMKSIVIFSNLAMFAMCYFGLSTDTTFITTNIVLNVLLNGAVEIPSSFIGWLGSDRYGRKYTTVIITVL-SGFCLIAVPIVPTGGVYNIVKAVVAMVGKCLLTTGYCIADVWAAEIFPTSVRNNGLFLATTLAMLSNIVAPVINTLSDVATFLPGLIFGITSIVS-ALSLLLLPETKGLPLPETVPSSEGLVRGRERQWAIETFSR-ERAQSLLDDDDMEAVNSQRIIKQ 533          
BLAST of slc22a-7 vs. TrEMBL
Match: A0A0H3YF32 (Slc22a-2 OS=Schmidtea mediterranea OX=79327 GN=slc22a-2 PE=2 SV=1)

HSP 1 Score: 159.844 bits (403), Expect = 7.454e-39
Identity = 143/500 (28.60%), Postives = 243/500 (48.60%), Query Frame = 3
Query:   96 FKVIAFLILSLPAFQYGSQFQNLLVSIQTPNFTCQYNETSHQIQ-----ISKDQCT--MTINGSNVKCQHWTFSSEPFGKTIMSDYDLVCDYKYVGDLLVLLWYSTSLMAPVFGWLADKYGRKMISIIFLSIETVATFILAFTPNLSSHIFFRLCIGFSESAY-HICYVWLMEMVNKDFRNVAGSFFWLYGSVAMTVFPLTVYVTRNWRLTQLISLTPSILYVLIL-FVPESPRWLCVKNKKQQLMESLQTIANINKMDLQLTPXXXXXXXXXXXSNKWNAFKDNNFLFLASTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMFVLGLMEFPGALLSYLSMYFFKRKRMITIFSMFGSIFIFLSVTLSKVDKWQSIFR---MIFGSIGKVLVITSSQGVL-VYATELFPTTHRSLFFGMLQIILLMAMTAAVYINK-LNQFYGFIPMLIYFLLNMISCCLIFVFMPETKGLPIPETIFDQRLLVKEREQEYLEYMYNRSD 1553
            F  I+F+ LS+  F+Y  +FQ L  ++  P F+C     S  I+     ISKDQC   +++N S  KC  WTF       T++++ +LVCD  +  +L+   ++   L +  F  L+D  G++++ I+ + + T+ T     +  +   +      G  +S Y  + Y  L+E++     ++A + FW   S       L  Y+ R+WR   ++SL  SI YVL   FVPE+PRWL +  ++ +  +++  IA INK  L                  WN  K    ++      FA ++ S        DL   S NI+I+ FV+GL+E P   LS +      RK+ ++  S  G I   + +   + D  +S+++    +  ++G  L  +S+  +  +   EL PTT R+    ++ I + +    A  I+  L QFY   P L+Y LL +I+  L+F F+PET  LP+P+TI     L+  +EQE+   M  +++
Sbjct:   16 FHYISFMTLSITTFKYVVEFQGLTFALYEPKFSCLVKNISSTIRNSTNLISKDQCQYRLSVNDSWNKCDQWTFEKRFMRNTLINELNLVCDRAFYRELIFTTFFVGCLFSFPFSILSDSIGKRLLLIVSIFLSTIITIGQMVSYQIWQQLVLSFVSGVCKSVYVSLAYTTLIEIIPVSHIDLAATNFWNLYSFGYMSVALFAYIFRSWRQIYILSLITSIFYVLYFWFVPETPRWLMLNKRRNEAFKTMSFIAKINKCTLNKEEFNKWKPIQQVTGKFWNLLKHKTMIYRFLILNFAGWAFSFAYIGSATDLTFASENIFITTFVMGLVELPTGPLSGIMANKLGRKKSVSALSGLG-IICLIIMPFIEADSLKSVWQPWLKVCLAMGAKLGFSSAWLIFDIITNELIPTTDRNTAMSLVYITVGLGSIFAPMIHSVLLQFYFAGPFLLYSLLLLITVVLVFAFIPETHHLPVPQTIEQAVSLLIHKEQEWKMDMIQQAE 514          
BLAST of slc22a-7 vs. Ensembl Cavefish
Match: slc22a4 (solute carrier family 22 member 4-like [Source:NCBI gene;Acc:103026746])

HSP 1 Score: 105.531 bits (262), Expect = 1.232e-23
Identity = 109/421 (25.89%), Postives = 197/421 (46.79%), Query Frame = 3
Query:  273 KC-QHWTFSSEPFGKTIMSDYDLVCDYKYVGDLLVLLWYSTSLMAP-VFGWLADKYGRKMISIIFLSIETVATFILAFTPNLSSHIFFRLCIGFSE-SAYHICYVWLMEMVNKDFRNVAGSFFWLYGS-VAMTVFPLTVYVTRNWRLTQLISLTPSILYV-LILFVPESPRWLCVKNKKQQLMESLQTIANINKM---DLQLTPXXXXXXXXXXXS--NKWNAFKDNNFLFLASTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMFVLGLMEFPG-----ALLSYLSMYFFKRKRMITIFSMFGSIFIFLSVTLSKVDKWQSIFRMIFGSIGKVLVITSSQGVLVYATELFPTTHRSLFFGMLQIILLMAMTAAVYINKLNQFYGFIPMLIYFLLN--MISCCLIFVFMPETKGLPIPETI 1484
            KC   W +S E +  TI++++DLVCD +Y   L   +++   LM   + G L+DKYGR+ +    ++++T+  FI  F+P+          +GFS  S Y + +V   E+++   R V  S     GS +     PL  Y  R WRL  LI+    +LY+ L  F+PESPRWL  + +  +    L+  A  NK+   ++   P EI+     ++   +  +  ++ N + +          I++    ++++ + L  + Y++ F+  ++E P       LL Y S  F +   ++    + G I +F+ +    + +      M    +GK  +  +   V    +ELFPT  R++  G+  +   +    + +I  L  +Y  +P   Y LL    +   L+ + +PET G  +PETI
Sbjct:  112 KCLDGWNYSKEIYQSTIVTEWDLVCDNEYKVPLCSSIYFLGVLMGTFISGQLSDKYGRRPVLFAMMAMQTLTIFIQMFSPSWEVFTAIYFFVGFSGFSNYVVGFVLGSEILSPATRVVFCSLGVFMGSGIGQMFLPLAAYFARWWRLLVLINALTGVLYIPLWWFIPESPRWLLSQGRIAEAEAILRQAAQKNKISAPEVIFIPSEIEESAAIRKKKYSILDILRNGNAVTICIICSLLWIVITMSYYGLILNTSNLHGDPYLNYFISAVVELPAFFIAMLLLKYCSRRFCQSSTLL----LGGGIILFVQLVPEDLPELAVFLEM----VGKFGITAAFCVVYAVTSELFPTVVRNMAMGICSMSARIGSIISPFIIYLGSYYKMLP---YLLLGAWAVVASLLCLLLPETSGKVLPETI 521          
BLAST of slc22a-7 vs. Ensembl Cavefish
Match: ENSAMXT00000010878.2 (pep primary_assembly:Astyanax_mexicanus-2.0:14:29265439:29284025:-1 gene:ENSAMXG00000010589.2 transcript:ENSAMXT00000010878.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 105.531 bits (262), Expect = 1.534e-23
Identity = 109/434 (25.12%), Postives = 205/434 (47.24%), Query Frame = 3
Query:  273 KC-QHWTFSSEPFGKTIMSDYDLVCDYKYVGDLLVLLWYSTSLMAPVF-GWLADKYGRKMISIIFLSIETVATFILAFTPNLS--SHIFFRLCIGFSESAYHICYVWLMEMVNKDFRNVAGSF-FWLYGSVAMTVFPLTVYVTRNWRLTQLISLTPSILYV-LILFVPESPRWLCVKNKKQQLMESLQTIANINKMDLQLTPXXXXXXXXXXXSN--KWNAFKDNNFLFLASTXXXXXXXXXXXXX---------XXXXXXXXXXXXXXXXMFVLGLMEFPGALLSYLSMYFFKRKRMITIFSMF-GSIFIFLSVTLSKVDKWQSIFRMIFGSIGKVLVITSSQGVLVYATELFPTTHRSLFFGMLQIILLMAMTAAVYINKLNQFYGFIPMLIYFLLNMISCCLIFVFMPETKGLPIPETIFDQRLLVKEREQ 1520
            KC   WT+S + +  TI++++DLVCD ++       +++   L    F G ++D++GRK +    + ++T+ TFI  F P+    S +FF + +G   S Y   +V   E+++   R    S    L+ +    + PL  Y+ RNWR+  +    P ++Y+ L  F+PESPRWL  + + +   E+   + N  + +  L P+ I  +   +E N        +NN L L  TS     ++ + +           + ++ + L  + Y++ F+   +E P  + S+LS+ +  RK    +  +  G +  F+ +    +        M     GK  +   +  +  Y  EL+PT  R+   G   ++  +    A Y   L+ ++ ++P ++   L + S  L  +F+PET   P+PETI DQ   +++RE+
Sbjct:  128 KCTDGWTYSKDVYQSTIVTEFDLVCDDEWKQPFTSSIYFIGVLCGSFFSGQISDRFGRKPVLFATMMVQTIFTFIQVFAPSWEVFSILFFIVGLG-QISNYVAAFVLGTELLSGGVRVFYSSLGVCLFFAFGYMMLPLIAYLIRNWRMLLVALSVPGLIYIPLWWFIPESPRWLISQGRVE---EAEAIVKNAARKNGVLPPDIIFKKSEEEEKNTKPQKTKPENNILDLMRTSNIRRTTLILFLVWLTLSMGYFGLSLNTSRLHGDSYVNCFISAALEVPAYITSWLSLRYLPRKLSCPVSMLLGGGVLYFIQLVPPDLPALSVALEM----AGKFGMAIGTALMFAYTGELYPTVLRNTAVGSCAMVSRVGSAVAPYFIHLSVYHKYLPYILLGTLCIFS-SLTTLFLPETFRRPLPETI-DQ---MQKRER 548          
BLAST of slc22a-7 vs. Ensembl Cavefish
Match: SLC22A2 (solute carrier family 22 member 2-like [Source:NCBI gene;Acc:103036098])

HSP 1 Score: 103.99 bits (258), Expect = 4.147e-23
Identity = 122/509 (23.97%), Postives = 225/509 (44.20%), Query Frame = 3
Query:  147 SQFQNLLVSIQTPNFTCQ-YNETSHQIQISKDQCTMTINGSNVKCQHWTFSSEPFGKTIMSDYDLVCDYKYVGDLLVLLWYSTSLMAPV-FGWLADKYGRKMISIIFLSIETVATFILAFTPNLSSHIFFRLCIGFS-ESAYHICYVWLMEMVNKDFRNVAGSFFWLYGSVAMTVFPLTVYVTRNWRLTQLISLTPSILYV-LILFVPESPRWLCVKNKKQQLMESLQTIANINKMDLQLTPXXXXXXXXXXXSNKWNAFKDNN-------FLFLASTXXXXXX---------XXXXXXXXXXXXXXXXXXXXXXXMFVLGLMEFPGALLSYLSMYFFKRKRMITIFSMFGSIFIFLSVTLSKVDKWQSIFRMIFGSIGKVLVITSSQGVLVYATELFPTTHRSLFFGMLQIIL-LMAMTAAVYINKLNQFYGFIPMLIYFLLNMISCCLIFVFMPETKGLPIPETIFDQRLLVKEREQEYLEYMYNRSDVVNSDREDSDASSEMSQLI 1610
            SQ Q   V   + +  C   +  + ++Q +    T   NG +   +H         ++ ++++DLVCD  ++ D+   +     L+  +  G+LADK+GRKM  ++   +  V   ++A +PN  S + FR   GF  +  +   YV + E V        G  F ++ S  + +  L  Y+  NWR  Q+    P I+++    FVPESPRWL  +NK  + +E  Q +A  NK  L               S      KD+N       F+ L  T               + +++   +++ L +L  NIYI   + G++EFP A L   ++    R+      ++       ++  + +   W    +     IG++ +  + + V+   TEL+PT  R+L   +   +  +  + A   + +L   +  +P++I+ +L  ++  L+ + +PETKG+P+PETI D            +EY        N ++ED+  S ++  L+
Sbjct:   86 SQCQRYDVDWNSTDLNCDGLDSETTEVQRAGLPITACKNGWHYDYEH--------RESFVTEFDLVCDDAWLVDVFQAVLGIGFLVGSITIGYLADKFGRKMSFLLSNILNAVTGILVAISPNYISLVVFRALHGFGVKGGWMAAYVLMTETV--------GVLFQMFFSFGLLLLALIAYLIPNWRWLQVAFTVPYIIFLSYYWFVPESPRWLLSQNKSSRAVEVTQAMAKENKKTL---------------SQNIKNLKDDNAETSTGSFMDLIRTPKIRKHTLILSFNWFTSAVVYQGLIMRLGILRGNIYIDFLISGIVEFPAAFLILFTIERIGRRLPFAAANIVSGAACLITAFIPESVLW---LKTAVACIGRLGITMAFEMVVFVNTELYPTFIRNLGVSVCSTLCDIGGIIAPFLLYRLAVIWLELPLIIFGVLAFVAGGLV-LLLPETKGVPLPETIDD------------IEYP-------NRNKEDTMKSHQLENLL 540          
BLAST of slc22a-7 vs. Ensembl Cavefish
Match: ENSAMXT00000046180.1 (solute carrier family 22 member 4-like [Source:NCBI gene;Acc:103029834])

HSP 1 Score: 100.138 bits (248), Expect = 6.835e-22
Identity = 70/276 (25.36%), Postives = 139/276 (50.36%), Query Frame = 3
Query:   60 ENVISFYNKKDTFKVIAFLILSLPAFQYGSQFQNLLVSIQTPNFTCQ---YNETSHQIQISKDQCTM------TINGSNVKCQHWTFSSEPFGKTIMSDYDLVCDYKYVGDLLVLLWYSTSLMAP-VFGWLADKYGRKMISIIFLSIETVATFILAFTPNLSSHIFFRLCIGFSE-SAYHICYVWLMEMVNKDFR---NVAGSFFWLYGSVAMTVFPLTVYVTRNWRLTQLISLTPSILYV-LILFVPESPRWLCVKNKKQQLMESLQTIANINKM 842
            + V SF      F+V  F++LSL     G     ++    TP++ C+   +N ++  ++ +   C+       + NG+ +    W +S+E +  TI++++DLVC+  +     + +++   L    V G L+D++GRK++    ++I+T+++ I   + +      F    G  + S Y   +V   E++ K+ R   +V G+   ++ ++   + PL  Y+ R+WRL   +   P +LY+ L  F+PESPRWL  K + Q+  + ++  A  N +
Sbjct:    7 DEVTSFLGDWGPFQVTIFILLSLSTVPNGYTGMAMVFLADTPSYRCRTSHWNGSAASLEHTWGTCSQVPALNGSSNGTGLCVDGWEYSTERYESTIVTEWDLVCENSWKVPFSLSIFFLGVLSGSFVSGELSDRFGRKVVLFATMAIQTLSSLIQVTSVSWEMFCVFFFLTGIGQISNYMAAFVLGCELLGKNLRVVYSVLGTC--VFYALGYALLPLCAYLLRSWRLLLTVLSLPGLLYIPLWWFIPESPRWLLAKGRVQEAEDIIRAAARRNGI 280          
BLAST of slc22a-7 vs. Ensembl Cavefish
Match: zmp:0000001102 (solute carrier family 22 member 7-like [Source:NCBI gene;Acc:103028659])

HSP 1 Score: 99.3673 bits (246), Expect = 1.054e-21
Identity = 122/515 (23.69%), Postives = 223/515 (43.30%), Query Frame = 3
Query:   51 MILENVISFYNKKDTFKVIAFLILSLPAFQYGSQF--QNLLVSIQTPNFTCQYNETSHQIQISKDQCTMTINGSN------VKCQH-WTFSSEPFGKTIMSDYDLVCDYKYVGDLLVLLWYSTSLMAPVF-GWLADKYGRKMISIIFLSIETVATFILA--FTPNLSSHIFFRLCIGFSESAYHICYV-----WLMEMVNKDFRNVAGSFFWLYGSVAMTVFPLTVYVTRNWRLTQLISLTPSILYVLILF-VPESPRWLCVKNKKQQLMESLQTIANI-------NKMDLQLTPXXXXXXXXXXXSNKWNAFKDNNFLFLASTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMFVLGLMEFPGALLSYLSMYFFKRKRMITIFSMFGSIFIFLSVTLSKVDKWQSIFRMIFGSIGKVLVITSSQGVLVYATELFPTTHRSLFFGMLQIILLMAMTAAVYINKLNQFYGFIPMLIYFLLNMISCCLIFVFMPETKGLPIPETIFDQRLLVKEREQ 1520
            M  EN+++  +    +++    +L  P       F   N + +I  P+  C ++     +   + Q  +  N SN      V+CQ  W F    F  T+ + +DLVCD K +      ++++  +   VF G ++DKYGR+  S++ LS  T   F +A  F+ +      FR   GFS +   I  +     W+ ++ ++ F  V GS FW  G++ +       Y+  +WRL  +   +P +L     + +PES RWL V  +  +    LQ  A++       +K+ L+      +++        ++  K      L   +    + ++     I ++L     N+Y++ F+   +E P     Y S+    R+       +   I IF+++ + K + W   FR I   +GK L   S   V +Y TEL+PT  R    G    +  +  + +  I  L   +  +P +++  + ++S  L+   + ET    +PETI D   + K R Q
Sbjct:    1 MKFENILTETDGFGRYQIAILALLVFPRMTLPGHFLLNNFIGAI--PSHHCDFS----SLDTYEAQFHLLTNTSNTTELPVVRCQDGWHFDHSTFKSTLATQFDLVCDTKGLNKASATIFFTGVMFGAVFFGVMSDKYGRR--SMLLLSYITSIVFSVASAFSTSFPMFATFRFLTGFSLAGISIISIVLSIEWV-DIEHRTFIGVIGSMFWTVGNMLLGGI---AYLVTDWRLLIITVTSPLLLAGATWWWIPESARWLIVNGRTDRAYSYLQKCASVNGKEEFTSKVKLETLSSVAEVDNHGHNYTYFDLIKTPRLRRLTLFTGIVWYGVASTYYGISLNLKGFGLNLYLTHFIYSAIEAPAKFFIYFSLQKIGRRPNQVGTLLLTGICIFINIVVPK-EYWT--FRTIIAVLGKGLSEASFTTVFLYTTELYPTVLRQNGLGYNSFVARLGASISPLIMLLEDVWRLLPQVVFGTMAIVS-GLVACLLQETNNTRLPETIED---IEKTRNQ 496          
BLAST of slc22a-7 vs. Ensembl Sea Lamprey
Match: oct2 (organic cation transporter 2 [Source:ZFIN;Acc:ZDB-GENE-080204-92])

HSP 1 Score: 98.5969 bits (244), Expect = 4.798e-22
Identity = 60/205 (29.27%), Postives = 109/205 (53.17%), Query Frame = 3
Query:  246 TMTINGSNVKCQH-WTFSSEPFGKTIMSDYDLVCDYKYVGDL-LVLLWYSTSLMAPVFGWLADKYGRKMISIIFLSIETVATFILAFTPNLSSHIFFRLCIG-FSESAYHICYVWLMEMVNKDFRNVAGSFFWLYGSVAMTVFPLTVYVTRNWRLTQLISLTPSI-LYVLILFVPESPRWLCVKNKKQQLMESLQTIANINKMDL 848
             ++ +G  + C H W F +E  G T++S++DLVC+  ++ DL   LL     + A + G+++D+YGR+   ++ + ++T+   ++AF PN ++ +  R   G F+  ++   +V   E V    R V      ++ S  + +     Y  R WR  QL    P++ L+     +PESPRWL  +N+K+Q    L+ IA++N  +L
Sbjct:  117 NVSFSGRLIACDHGWEFDTEKTGLTLVSEFDLVCENAWLLDLSQALLNVGLLVGAILMGYVSDRYGRRWSLMVSIVMQTIFGVLVAFAPNYAAFVCMRTLQGIFNMGSWTTVFVTATEFVGSGQRRVVHMVLQMFFSFGVIMLSGIAYYLRTWRYLQLALTLPNVVLFSYYWLLPESPRWLISQNRKEQAFGVLKKIASVNGREL 321          

HSP 2 Score: 49.6766 bits (117), Expect = 1.573e-6
Identity = 42/183 (22.95%), Postives = 80/183 (43.72%), Query Frame = 3
Query: 1047 GLMEFPGALLSYLSMYFFKRKRMITIFSMFGSIFIFLSVTLSKVDKWQSIFRMIFGSIGKVLVITSSQGVLVYATELFPTTHRSLFFGMLQIIL-LMAMTAAVYINKLNQFYGFIPMLIYFLLNMISCCLIFVFMPETKGLPIPETIFDQRLLVKEREQEYLEYMYNRSDVVNSDR-EDSDAS 1589
            GL E PGAL+    +    R+  + +      +    +  +     W +I  +  G +G  +   + + V +   EL+PT  R++       +  +  + A   + +L   +  +PM+I+  L +I    + + +PET GLP+PET  D   + K ++ +       + +  N  R EDS A 
Sbjct:  393 GLAEIPGALMVIALIDRVGRRLPMCVAPGLSGLACLATALVPHDIGWLNITLVTLGRLGLTM---AYEMVTLVNNELYPTHLRNMAMSTCSSLSGIGGIVAPFVLYRLYTIWRHLPMVIFGTLAIIGG-FVILLLPETNGLPLPETTEDAENISKNQKMKQKMLRSRKFETKNPLRNEDSQAD 571          
BLAST of slc22a-7 vs. Ensembl Sea Lamprey
Match: SLC22A7 (solute carrier family 22 member 7 [Source:HGNC Symbol;Acc:HGNC:10971])

HSP 1 Score: 92.0485 bits (227), Expect = 9.350e-21
Identity = 60/199 (30.15%), Postives = 102/199 (51.26%), Query Frame = 3
Query:  270 VKC-QHWTFSSEPFGKTIMSDYDLVCDYKYVGDLLVLLWYSTSLMAP-VFGWLADKYGRKMISIIFLSIETVATFILAFTPNLSSHIFFRLCIGFSESA-----YHICYVWLMEMVNKDFRNVAGSFFWLYGSVAMTVFPLTVYVTRNWRLTQLISLTPSILYVLIL---FVPESPRWLCVKNKKQQLMESLQTIANIN 836
            V C   W +    F +T+++ +DLVC++K +  L + L+ +  ++   VFG+L+D+YGR+   +    +  V     A+ P+ SS    R  +G S S        +   WL +  ++ F   +G F W  G++A+    L  Y+ R W+  QL+  +P  +Y  IL   F+PESPRWL V+ + ++   +L   A IN
Sbjct:  109 VPCPSGWEYDRRQFTETVVTQWDLVCEHKALNHLSLTLFMAGVMLGSLVFGYLSDRYGRRNALLGSYVLNAVTGTAAAWAPSFSSFTAMRFLLGVSLSGIIVNTLSLSVEWL-DQGHRTFAGTSGGFAWSTGNMALG---LLAYLLRGWQQLQLVVTSP--IYFCILTWWFIPESPRWLLVRGRAREAHRNLSLCARIN 301          
BLAST of slc22a-7 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007122.1 (pep scaffold:Pmarinus_7.0:GL476962:153150:164773:-1 gene:ENSPMAG00000006444.1 transcript:ENSPMAT00000007122.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 68.5514 bits (166), Expect = 2.763e-13
Identity = 52/186 (27.96%), Postives = 87/186 (46.77%), Query Frame = 3
Query:  204 NETSHQIQISKDQCTMTINGSNVK--CQHWTFSSEPFGKTIMSDYDLVCDYKY---VGDLLVLLWYSTSLMAPVFGWLADKYGRKMISIIFLSIETVATFILAFTPNLSSHIFFRLCIGFSESAYHI-CYVWLMEMVNKDFRNVAG-SFFWLYGSVAMTVFPLTVYVTRNWRLTQLISLTPSILYV 740
             E++      + +C   +N S  +     W +    F  T+++++DLVC   Y   VG  + +L     + APV G +ADKYGRK + ++ ++I+T      AF PN   +   R  +G + S   +  +V   E      R +AG +    +G   M + P+  Y  R+WR  QL    P IL++
Sbjct:   70 GESAAANGTERPRCGSRLNESGWQPCATGWDYDRSVFTSTVVTEWDLVCTRSYLNNVGSSIFML--GLMVGAPVLGTMADKYGRKSVILVSMAIQTAFGLGAAFAPNFVMYALARFMVGVAISGVIMNAFVLATEWTGIGERMLAGIATQQAFGVGYMLLAPV-AYFIRDWRQLQLAISIPEILFI 252          
BLAST of slc22a-7 vs. Ensembl Sea Lamprey
Match: si:dkey-190l8.2 (si:dkey-190l8.2 [Source:ZFIN;Acc:ZDB-GENE-030131-9103])

HSP 1 Score: 67.781 bits (164), Expect = 1.936e-12
Identity = 79/326 (24.23%), Postives = 144/326 (44.17%), Query Frame = 3
Query:  408 VFGWLADKYGRKMISIIFLSIETVATFILAFTPNLSSHIFFRLCIGFSESAYHICYVWL-MEMVNKDFRNVAGSFFWLYGSVAMTVFPLTVYVTRNWRLTQLISLTPSILYVLILF--VPESPRWLCVKNKKQQLMESLQTIANINKM-DLQLTPXXXXXXXXXXXSNKWN---AFKDNNFLFLASTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMFVLGLMEFPGALLSYLSMYFFKRKRMITIFSMFGSIFIF---LSVTLSKVDKWQSIFRMIFGSIGKVLVITSSQGVLVYATELFPTTHRSLFFGMLQIIL-LMAMTAAV 1352
              G  +D+YGR+ + +  ++ +  A F++AF PN  +++  RL  G + S   +C   L +E      R        L  SV M        +++NW    L +  P ++ VL+LF  +PESPRWL +K +  +    L+  + IN+  ++  TP  +  + +T+ +N+      F++           +   ++S+    + + +     +I+++ F+ GL E P  LL  L     +R   I   S+ G+  +    L   L+ V        +    +GK+    ++    +Y  ELFPT  R    G  Q  L  +AM  +V
Sbjct:   35 AMGIASDRYGRRPVLLGCVASQGAAEFVIAFLPNFPTYLLGRLLTGTTASGIMLCSFSLGVEWCGPALRAWPPIILALAFSVGMMALAGVAKISQNWPQLHLATGVPQLM-VLLLFWSLPESPRWLFLKKRTTEARNLLRQASIINRRSEVSWTPLRLTSKLSTRGANESTLLITFRNRTLRKRLLIMSYICAAVSMTYYGLCLSVGDFGLDIHMAQFLSGLAEIPQLLLPPLMRRVGRRSLCIVFLSVAGATCLLCLPLQPNLANVV-------VALALLGKLCAQVTACVATLYRIELFPTNVRPRCHGHRQNALGAVAMCGSV 352          
BLAST of slc22a-7 vs. Ensembl Sea Lamprey
Match: svopl (SVOP-like [Source:NCBI gene;Acc:492766])

HSP 1 Score: 52.7582 bits (125), Expect = 1.468e-7
Identity = 40/149 (26.85%), Postives = 65/149 (43.62%), Query Frame = 3
Query:  414 GWLADKYGRKMISIIFLSIETVATFILAFTPNLSSHIFFRLCIGFSESAYHICYVWLMEMVNKDFRNVA---GSFFWLYGSVAMTVFPLTVYVTRNWRLTQLISLTPS-ILYVLILFVPESPRWLCVKNKKQQLMESLQTIANINKMDL 848
            G+LAD+YGR  + ++     +  + I +F+P     +F R  +G         +V + E +    R         FW+ GS+   V    +  T  W     IS  PS +L +   F+PES R+     K  + + +L  IA +NK  L
Sbjct:  105 GFLADRYGRWKVLLLVTIWSSYWSGISSFSPTYGWFVFLRFLMGCGIGGQSQGFVLMSEFMPSTARGRVLPMSQVFWVLGSLLEVVLAYLILPTLGWAWLIRISTIPSFVLLIAFKFIPESARYQVSAAKPDKALLTLAKIAKMNKTTL 253          
BLAST of slc22a-7 vs. Ensembl Yeast
Match: CIN10 (Putative transporter; member of the sugar porter family; non-essential gene; overexpression results in elevated colony sectoring, an indicator of chromosomal instability [Source:SGD;Acc:S000002795])

HSP 1 Score: 49.6766 bits (117), Expect = 9.077e-7
Identity = 44/143 (30.77%), Postives = 65/143 (45.45%), Query Frame = 3
Query:  420 LADKYGRKMISIIFLSIETVATFILAFTPNLSSHIFFRLCIGFSESAYHICY-VWLMEMVNKDFRNVAGSFFWLYGSVAMTVFPLTVYV--------TRNWRLTQLISLTPSILYVLIL-FVPESPRWLCVKNKKQQLMESLQ 818
            LAD+YGR++   I  SI  +A   +A    L+  I  RL +G +      C  ++L E+     R     F      +A+T   L  YV          +WR    +S  P+IL++ IL F+PESPRW   K       +SL+
Sbjct:  103 LADRYGRRITLAICCSIFILAAIGMAIARTLTFLICGRLLVGIAVGVSAQCVPLFLSEISPSRIRG----FMLTLNIIAITGGQLVSYVIASLMKEIDNSWRYLFALSAIPAILFLSILDFIPESPRWSISKGDILYTRDSLR 241          
BLAST of slc22a-7 vs. Ensembl Nematostella
Match: EDO36723 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHW3])

HSP 1 Score: 119.398 bits (298), Expect = 8.995e-29
Identity = 116/439 (26.42%), Postives = 207/439 (47.15%), Query Frame = 3
Query:  201 YNETSHQIQISKDQCTMTINGSNVKCQHWTFSSEPFGKTIMSDYDLVCDYKYVGDLL-VLLWYSTSLMAPVFGWLADKYGRKMISIIFLSIETVA--TFILAFTPNLSSHIFFRLCIGFSESAYHIC-YVWLMEMVNKDFRNVAGSFFWLYGSVAMTVFPLTVYVTRNWRLTQLISLTPSI-LYVLILFVPESPRWLCVKNKKQQLMESLQTIANINKMDLQLTPXXXXXXXXXXXSNKWNAFKDNNFLFLASTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMFVL-GLMEFPGALLSYLSMYFFKRKRMITIFSMFGSI-FIFLSVTLSKVDKWQSIF-RMIFGSIGKVLVITSSQGVLVYATELFPTTHRSLFFGMLQIILLMAMTAAVYINKLNQFYGFIPMLIYFLLNMISCCLIFVFMPETKGLPIPETIFDQ 1493
            Y+ ++  I++   +C +  N ++ K         P   TI++ +DLVCD  +   L   +L++  +L A + G +ADKYGR+  S++F S   V   TF ++F       I  R   GF      +  +V   E+V    R ++ +  W Y ++A+ V  L  Y  ++W+L  +IS  P + +++   F+PES RWL V  +K Q  E L+ +A +NK ++   P+E       K +  +        L L +      + ++ L+   +              FVL  ++EFP  +L   +   F RK  +  +++ G+I  + +S   S  D    I  R+  G++GK+ + TS   + V++ ELFPT  R+   G+L +I  +    A ++ +L +    +P  +   L  ++  L   F+PET+G P  E + D 
Sbjct:   69 YSTSTQPIELYHRRCKL--NRTDWKFADPELYEGPV-HTIVTQFDLVCDNSFHAWLANSMLFFGWALGAIILGMIADKYGRR--SVLFPSAACVIAITFSMSFAQASWVVIALRFFSGFFLGGSILTMFVLAAELVGPAKRALSSTMVWFYFTLALMVLGLQAYFIKDWKLLCIISTVPFVFIFIFWKFIPESVRWLLVVGRKDQAREILEQVAKVNKKEM---PKEDLRVPVVKHNRGFLELFGTPRLALLTLLQCYAWLVNGLVYYAVSMSAGDFGGSIYLNFVLTSIVEFPANILVIDNCNRFGRKHTVVWYTVVGAISCLVVSFIPSGTDNIGYIAGRVAAGTLGKLCITTSFNSLYVFSAELFPTMIRNSGMGLLSVISRVGAALAPFVVQLTRINAILPFALMSGLTFLA-ALACWFLPETRGKPTLEVMGDD 498          
BLAST of slc22a-7 vs. Ensembl Nematostella
Match: EDO36696 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHW2])

HSP 1 Score: 110.538 bits (275), Expect = 7.151e-26
Identity = 116/451 (25.72%), Postives = 208/451 (46.12%), Query Frame = 3
Query:  201 YNETSHQIQISKDQCTMTINGSNVKCQHWTFSSEPFGKTIMSDYDLVCDYKYVGDLL-VLLWYSTSLMAPVFGWLADKYGRKMISIIFLSIETVA--TFILAFTPNLSSHIFFRLCIGFSESAYHIC-YVWLMEMVNKDFRNVAGSFFWLYGSVAMTVFPLTVYVTRNWRLTQLISLTPSILYVLIL-FVPESPRWLCVKNKKQQLMESLQTIANINKMDLQLTPXXXXXXXXXXXSNKWNAFKDNNFLFLASTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMFVL-GLMEFPGALLSYLSMYFFKRKRMITIFSMFGSIFIFLSVTLSKVDKWQS-----IFRMIFGSIGKVLVITSSQGVLVYATELFPTTHRSLFFGMLQIILLMAMTAAVYINKLNQFYGFIPMLIYFLLNMISCCLIFVFMPETKGLPIPETIFDQRLLVKEREQ 1520
            Y+ ++  I++   +C +  N ++ K         P   TI++++DLVCD+ +   +   +L++  ++ A   G +ADKYGR   S++F S   V   +  +AF       +  R  IGF E    +  +V   E+V    R +AG+  W+Y + A+ V  L  +  R+W    +IS+ P +  VL   FVPES RWL V   K +    L+   N+ +++ +  PEE       + +           L + +      + ++ ++   +              FVL  L+EFP  +L   +   F RKR +  +++ G+I     +T+S +    +     I R+  G +GK+ + TS  G+ V++ ELFPT  R+   G+L +I  +    A ++ +L +    +P  +   L  ++  L   F+PET+G P  E I D    + E  +
Sbjct:   69 YSTSTQPIELYHRRCKL--NRTDWKFADPELYEGPV-HTIVTEFDLVCDHSFTAWMANSMLFFGWAIGAIFLGIIADKYGR--CSVLFPSAILVMGLSLAMAFVKKAWLVLVLRFFIGFFEGGGFLSMFVLATELVGPAKRALAGTLVWIYFTAALMVLALKAFFIRDWSTLCIISIAPFVFIVLFWKFVPESVRWLLVTGSKGKARRILE---NVARVNKKSMPEEELFAPQVEHNRGIIELFSTKRLAVLTLLQCYAWFVNGMVYYGVSMSAGDFGGSIYLNFVLTSLVEFPANVLLIHNCNRFGRKRTVVAYTLIGAI---ACITVSFIPAGTNNLGFIIGRVTGGMLGKLCITTSFNGLYVFSAELFPTMVRNSGMGLLSVISRVGAALAPFVVQLTRINAILPFALMGGLTFLA-ALACWFLPETRGKPTLEVIGDDDPHILEEGK 507          
BLAST of slc22a-7 vs. Ensembl Nematostella
Match: EDO27829 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T865])

HSP 1 Score: 92.8189 bits (229), Expect = 7.660e-20
Identity = 107/442 (24.21%), Postives = 191/442 (43.21%), Query Frame = 3
Query:  279 QHWTFSSEPFGKTIMSDYDLVCD---YKYVGDLLV-LLWYSTSLMAPVFGWLADKYGRKMI---SIIFLSIETVATFILAFTPNLSSHIFFRLCIGFSESAYHIC-YVWLMEMVNKDFRNVAGSFFWLYGSVAMTVFPLTVYVTRNWRLTQLISLTPSIL-YVLILFVPESPRWLCVKNKKQQLMESLQTIA-----NINKMDLQLTPXXXXXXXXXXXSNKWNAFKDNNFLFLASTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMFVLGLMEFPGALLSYLSMYFFKRKRMITIFSMFGSIFIFLSVTLSKVDKWQSIFRMIFGSIGKVLVIT------SSQGVLVYATELFPTTHRSLFFGMLQIILLMAMTAAVYINKLNQFYGFIPMLIYFLLNMISCCLIFVFMPETKGLPIPETIFDQRLLVKEREQEYLEYMYN 1544
              W F+ +    +I++++DLVC    Y  + + +  +LW   ++   + G   DK+GRK++    +IF S+  +A+   AF         FR  +G     Y IC +V +ME +    R++ G   W    +A+ +  L  Y+  +WR   +I+  P +L +V   F P+S RW  VK K     + L  +A     N  K D +   E     +  +  +  + F   +       S +      ++   I +    +  ++Y++ F+  L E  G  +    +  F RK+ I       ++   ++  LS+ D       M+ G I   +VI       +  GV VY++ELFPT  R+   G       +   AA +     + +  +P  I   LN + C ++ + +PETK  P+P+T       VK+ E+   EY + 
Sbjct:   79 DQWEFAIDAGFDSIVTEWDLVCSKSMYATIANSITFILWIFGAMAGSIIG---DKFGRKIVVFPCVIFASLCGLAS---AFANKYWVFALFRALLGAGIGGYSICGFVLVMEYIGIRHRSIVGFCVWYPWILALFMLALLGYLIPSWRTLSIITSAPGLLFFVFWWFTPDSLRWYLVKGKFDDAKKVLVDVAKGCGNNYTKQDFEFEEEHTFNIEHERLGDIRDLFHSRSMAHRTLVSWYCWLVSGLVYYGISLSSTTIGGDMYLNFFLSALFEGIGMAIGIPLLDRFGRKKTIVASMYVAALAAIVAALLSQYDDGSQ--AMLVGKIISAMVIAKFFVTIAFDGVYVYSSELFPTVVRNTAMGTSTSAARIGSFAAPFTVYSQKVHPMMPFGI-MALNALICGILCMTLPETKDKPLPDT-------VKQTEESPCEYAFE 504          
BLAST of slc22a-7 vs. Ensembl Nematostella
Match: EDO36597 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SI67])

HSP 1 Score: 92.0485 bits (227), Expect = 8.184e-20
Identity = 100/419 (23.87%), Postives = 186/419 (44.39%), Query Frame = 3
Query:  279 QHWTFSSEPFGKTIMSDYDLVCD---YKYVGDLLV-LLWYSTSLMAPVFGWLADKYGRKMI---SIIFLSIETVATFILAFTPNLSSHIFFRLCIGFSESAYHIC-YVWLMEMVNKDFRNVAGSFFWLYGSVAMTVFPLTVYVTRNWRLTQLISLTPSILYVLILFVPESPRWLCVKNKKQQLMESLQTIA-----NINKMDLQLTPXXXXXXXXXXXSNKWNAFKDNNFLFLASTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMFVLGLMEFPGALLSYLSMYFFKRKRMITIFSMFGSIFIFLSVTLSKVDKWQSIFRMIFGS--IGKVLVITSSQGVLVYATELFPTTHRSLFFGMLQIILLMAMTAAVYINKLNQFYGFIPMLIYFL--LNMISCCLIFVFMPETKGLPIPETI 1484
              W F+ +    +I++++DLVC    Y  + + +  +LW   ++   + G   DK+GRK++    +IF S+  +A+   AF         FR  +G     Y IC +V +ME +    R++ G   +    +A+ +  L  Y+  +WR   +I+  P +L+ +  F P+S RW  VK K     + L  +A     N  K D +   E     +  +  +  + F   +       S +      ++   I +    +  ++Y++ F+  L E  G  +    +  F RK+ I       ++   ++  LS+ D    +   I  +  I K  V  +  GV VY++ELFPT  R+   G       +   AA +  K++      PM+ + +  LN + C ++ + +PETK  P+P+T+
Sbjct:   79 DQWEFAIDAGFDSIVTEWDLVCSKSMYATIANSITFILWIFGAMAGSIIG---DKFGRKIVVFPCVIFASLCGLAS---AFANKYWVFALFRALLGAGIGGYSICSFVLVMEYIGIRHRSIVGFCVFYPWILALFMLALLGYLIPSWRTLSIITSAPGLLFFVFWFTPDSLRWYLVKGKFDDAKKVLVDVAKGCGNNYTKQDFEFEEEHTFNIEHERLGDIRDLFHSRSMAHRTLVSWYCWLVSGLVYYGISLSSTTIGGDMYLNFFLSALFEGIGMAIGIPLLDRFGRKKTIAASMCVAALAAIVAALLSQYDDGTMLVGKIISAMVIAKFFVTIAFDGVYVYSSELFPTVVRNTAMGTSTSAARIGSFAAPFTQKVH------PMMPFGIMALNALICGILCMTLPETKDKPLPDTV 485          
BLAST of slc22a-7 vs. Ensembl Nematostella
Match: EDO47316 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMR6])

HSP 1 Score: 90.5077 bits (223), Expect = 2.247e-19
Identity = 101/420 (24.05%), Postives = 187/420 (44.52%), Query Frame = 3
Query:  279 QHWTFSSEPFGKTIMSDYDLVCD---YKYVGDLLV-LLWYSTSLMAPVFGWLADKYGRKMI---SIIFLSIETVATFILAFTPNLSSHIFFRLCIGFSESAYHIC-YVWLMEMVNKDFRNVAGSFFWLYGSVAMTVFPLTVYVTRNWRLTQLISLTPSIL-YVLILFVPESPRWLCVKNKKQQLMESLQTIA-----NINKMDLQLTPXXXXXXXXXXXSNKWNAFKDNNFLFLASTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMFVLGLMEFPGALLSYLSMYFFKRKRMITIFSMFGSIFIFLSVTLSKVDKWQSIFRMIFGS--IGKVLVITSSQGVLVYATELFPTTHRSLFFGMLQIILLMAMTAAVYINKLNQFYGFIPMLIYFL--LNMISCCLIFVFMPETKGLPIPETI 1484
              W F+ +    +I++++DLVC    Y  + + +  +LW   ++   +   ++DK+GRK++    +IF S+  +A+   AF         FR  +G     Y IC +V +ME +    R++ G   W    +A+ +  L  Y+  +WR   +I+  P +L +V   F P+S RW  VK K     + L  +A     N  K D +   E     +  +  +  + F   +       S +      ++   I +    +  ++Y++ F+  L E  G  +    +  F RK+ I       ++   ++  LS+ D    +   I  +  I K  V  +  GV VY++ELFPT  R+   G       +   AA +  K++      PM+ + +  LN + C ++ + +PETK  P+P+T+
Sbjct:   79 DQWEFAIDAGFDSIVTEWDLVCSKSMYATIANSITFILWIFGAMAGSI---ISDKFGRKIVVFPCVIFASLCGLAS---AFANKYWVFALFRALLGAGIGGYSICGFVLVMEYIGIRHRSIVGFCVWYPWILALFMLALLGYLIPSWRTLSIITSAPGLLFFVFWWFTPDSLRWYLVKGKFDDAKKVLVDVAKGCGNNYTKQDFEFEEEHTFNIEHERLGDIRDLFHSRSMAHRTLVSWYCWLVSGLVYYGISLSSTTIGGDMYLNFFLSALFEGIGMAIGIPLLDRFGRKKTIVASMYVAALAAIVAALLSQYDDGTMLVGKIISAMVIAKFFVTIAFDGVYVYSSELFPTVVRNTAMGTSTSAARIGSFAAPFTQKVH------PMMPFGIMALNALICGILCMTLPETKDKPLPDTV 486          
BLAST of slc22a-7 vs. Ensembl Medaka
Match: slc22a4 (solute carrier family 22 member 4 [Source:NCBI gene;Acc:101163192])

HSP 1 Score: 111.694 bits (278), Expect = 1.130e-25
Identity = 120/429 (27.97%), Postives = 202/429 (47.09%), Query Frame = 3
Query:  276 CQH-WTFSSEPFGKTIMSDYDLVCDYKYVGDLLVLLWYSTSLMAPVF-GWLADKYGRKMISIIFLSIETVATFILAFTPNLSSHIFFRLCIGFSE-SAYHICYVWLMEMVNKDFRNVAGSFFWLYGS-VAMTVFPLTVYVTRNWRLTQLISLTPSILYVLILF--VPESPRWLCVKNKKQQLMESLQTIANINKMDLQLTPXXXXXXXXXXXSNKWNAF------KDNNFLFLASTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMFVLGLMEFPGALLSYLSMYFFKRKRMITIFSMFGSIFIFLSVTLSKVDKWQSIFRMIFGSIGKVLVITSSQGVLVYATELFPTTHRSLFFGMLQIILLMAMTAAVYINKLNQFYGFIPMLIYFLLNMISCCLIFVFMPETKGLPIPETIFD-QRLLVKEREQE 1523
            CQ  W +S E +  TI++++DLVCD  Y G L   + Y   L+  V  G L+D++GRK +  + ++++TVA     F+PN     F    +G    S Y I +V   E+++   R V  S     GS V     P   Y  R+WR + LIS+  S L  + L+  + ESPRWL  + K ++    L+  A +NK+ +   P   + E     + K          K  N L +          I+I   A+L++ + L+ N Y++ F+  + E P  +++ L + +  R    +     G + I L V L  +D       ++   +GK  V  +   V    +ELFPT  R+   G   +   +A   + +I  L ++Y  +P ++  +L +    + F+ +PET+G  +PETI   QR+  K+ E+E
Sbjct:  118 CQDGWIYSREIYQSTIVTEWDLVCDNAYKGPLTTSIHYVGVLVGTVLSGQLSDRFGRKPMLFVMMALQTVAITAQIFSPNWEIFTFIFCLVGAGGYSNYTIAFVLGSEILSPRIRVVFCSLGVFMGSAVGYMAMPAVAYFLRDWR-SLLISMAASGLIYIPLWWLLSESPRWLLSQGKVEEAEAILKDAAKMNKVQVP-EPIFTQAEVEDSLAMKERKINIMVIVKSCNILSITMACASLWMIITISYYALLLNTSNLNGNPYLNCFLSAVTEVPAYIIALLLLRYCSRHICQSSTLFLGGVMI-LCVRLIPID--LPAVAVLLEMLGKFGVTAAFCVVYSVTSELFPTVIRNTAMGCCSMAARIATILSPFIIYLGKYYKALPYIVMGVLALSGAVITFI-LPETRGKVLPETIPQMQRICGKQGEKE 540          
BLAST of slc22a-7 vs. Ensembl Medaka
Match: slc22a2 (solute carrier family 22 member 2 [Source:NCBI gene;Acc:101173762])

HSP 1 Score: 105.916 bits (263), Expect = 1.045e-23
Identity = 59/190 (31.05%), Postives = 106/190 (55.79%), Query Frame = 3
Query:  279 QHWTFSSEPFGKTIMSDYDLVCDYKYVGDLLVLLWYSTSLMAPV-FGWLADKYGRKMISIIFLSIETVATFILAFTPNLSSHIFFRLCIGFS-ESAYHICYVWLMEMVNKDFRNVAGSFFWLYGSVAMTVFPLTVYVTRNWRLTQLISLTPSILYV-LILFVPESPRWLCVKNKKQQLMESLQTIANINK 839
            + W +  E   ++ ++++DLVC + ++ D+         L+  +  G+LAD++GRKM  ++   +  VA  ++A +PN +S + FR   GF  +  +   YV + E+V  +FR   G  + ++ SV + + PL  +   +WR  QL    P IL++    F+PESPRWL  +NKK Q+++  ++IA  N+
Sbjct:  119 EGWEYDYEGR-QSFVTEFDLVCSHGWMADMFQATLNVGFLVGSIAIGYLADRFGRKMSFLMSTLVNAVAGILVAVSPNYTSLLVFRSLSGFGVKGGWMAGYVLITEIVGVEFRRTVGVLYQMFFSVGLLILPLLAFFITDWRWLQLAITAPYILFLSYYWFIPESPRWLLSQNKKSQVVKITESIAKENR 307          
BLAST of slc22a-7 vs. Ensembl Medaka
Match: slc22a4 (solute carrier family 22 member 4 [Source:NCBI gene;Acc:101163192])

HSP 1 Score: 105.916 bits (263), Expect = 1.049e-23
Identity = 117/431 (27.15%), Postives = 198/431 (45.94%), Query Frame = 3
Query:  276 CQH-WTFSSEPFGKTIMSDYDLVCDYKYVGDLLVLLWYSTSLMAPVF-GWLADKYGRKMISIIFLSIETVATFILAFTPNLSSHIFFRLCIGFSE-SAYHICYVWLMEMVNKDFRNVAGSFFWLYGS-VAMTVFPLTVYVTRNWRLTQLISLTPSILYVLILF--VPESPRWLCVKNKKQQLMESLQTIANINKMDLQLTPXXXXXXXXXXXSNKWNAF------KDNNFLFLASTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMFVLGLMEFPGALLSYLSMYFFKRKRMITIFSMFGSIFIFLSVTLSKVDKWQSIFRMIFGSIGKVLVITSSQGVLVYATELFPTTHRSLFFGMLQIILLMAMTAAVYINKLNQFYGFIPMLIYFLLNMISCCLIFVFMPETKGLPIPETIFDQRLLVKEREQEYLE 1532
            CQ  W +S E +  TI++++DLVCD  Y G L   + Y   L+  V  G L+D++GRK +  + ++++TVA     F+PN     F    +G    S Y I +V   E+++   R V  S     GS V     P   Y  R+WR + LIS+  S L  + L+  + ESPRWL  + K ++    L+  A +NK+ +   P   + E     + K          K  N L +          I+I   A+L++ + L+ N Y++ F+  + E P  +++ L + +  R    +     G + I L V L  +D       ++   +GK  V  +   V    +ELFPT  R+   G   +   +A   + +I  L ++Y  +P ++  +L +    + F+ +PET+G  +PETI   + +      E  E
Sbjct:  118 CQDGWIYSREIYQSTIVTEWDLVCDNAYKGPLTTSIHYVGVLVGTVLSGQLSDRFGRKPMLFVMMALQTVAITAQIFSPNWEIFTFIFCLVGAGGYSNYTIAFVLGSEILSPRIRVVFCSLGVFMGSAVGYMAMPAVAYFLRDWR-SLLISMAASGLIYIPLWWLLSESPRWLLSQGKVEEAEAILKDAAKMNKVQVP-EPIFTQAEVEDSLAMKERKINIMVIVKSCNILSITMACASLWMIITISYYALLLNTSNLNGNPYLNCFLSAVTEVPAYIIALLLLRYCSRHICQSSTLFLGGVMI-LCVRLIPID--LPAVAVLLEMLGKFGVTAAFCVVYSVTSELFPTVIRNTAMGCCSMAARIATILSPFIIYLGKYYKALPYIVMGVLALSGAVITFI-LPETRGKVLPETIPQMQRICGNANCEASE 542          
BLAST of slc22a-7 vs. Ensembl Medaka
Match: ENSORLT00000024218.2 (solute carrier family 22 member 7 [Source:NCBI gene;Acc:101170147])

HSP 1 Score: 101.679 bits (252), Expect = 1.768e-22
Identity = 118/473 (24.95%), Postives = 212/473 (44.82%), Query Frame = 3
Query:  135 FQYGSQFQNLLVSIQTPNFTCQYNETSHQIQI-SKDQCTMTINGSN------VKCQH-WTFSSEPFGKTIMSDYDLVCDYKYVGDLLVLLWY-STSLMAPVFGWLADKYGRKMISIIFLSIETVATFILAFTPNLSSHIFFRLCIGFSESAYHICYVWL-MEMVNKDFRNVAGSFFWLYGSVAMTVFPLTVYVTRNWRLTQLISLTPSILYVLIL--FVPESPRWLCVKNKKQQLMESLQTIANINKMD---LQLTPXXXXXXXXXXXSNKWNAFKD----NNFLFLASTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMFVLGLMEFPGALLSYLSMYFFKRKRMITIFS--MFGSIFIFLSVTLSKVDKWQSIFRMIFGSIGKVLVITSSQGVLVYATELFPTTHRSLFFGMLQIILLMAMTAAVYINKLNQFYGFIPMLIYFLLNMISCCLIFVFMPETKGLPIPETIFD 1490
            F+  S+ + L+VSI       Q + +SH  Q+ ++ Q  +  NG+N      + C + W + +  F  T+ S +DLVCD K +      +++    L A +FG+L+D++GRK   ++     T   F  AF+ N    +  R   G   S   I  + L +E V+   R   G    L  S +  V P   Y   +WR +   ++T  +L  +I   ++PES RWL    K  +    L   A +N  +     L PE +      ++ N+  ++ D         LA  +    F ++     I +++     NIY++ F+ G+ E P    +++  +  K  R +T     +   + IF ++ + +    Q   R   G++GK+L   +   V +Y TEL+PT  R    G    +  + ++ +  +  L + +  +P  I+  +  I+  L   F+PET+ + +PETI D
Sbjct:   60 FRNLSELEKLVVSIP-----AQQDGSSHSCQMFAEPQYHLVWNGTNSTDPLKIPCTNGWWYDNTTFKSTLASQWDLVCDKKSMNRATATIFFMGVMLGAAIFGYLSDRFGRKRTLLVSYIATTTFGFASAFSYNFPMFVAMRFLTGVGISGISIVSIVLCVEWVDIKHRTYVGVLMSLDWSFSTVVLPALAYFVNDWR-SLTATVTAPLLAAMITWRWLPESARWLISTGKVDRAHFYLHQCATVNHREDFMADLKPEVLSKVILVEDENRKYSYVDLVKTPRMRRLALLTGIVWFGVACTYYGISLNVTGFGVNIYLTQFIYGVTEVPAK--AFIVFFLNKIGRRLTQVGTLLLTGLCIFCNIFIPQD---QVAARTTVGALGKMLAEAAFTTVFLYTTELYPTVMRQNGLGYSSFMARIGVSVSPLMMILEETWIHLPNTIFSAVAFIA-GLSASFLPETRNIRLPETIED 520          
BLAST of slc22a-7 vs. Ensembl Medaka
Match: ENSORLT00000042842.1 (solute carrier family 22 member 7 [Source:NCBI gene;Acc:101172381])

HSP 1 Score: 93.9745 bits (232), Expect = 5.650e-20
Identity = 103/438 (23.52%), Postives = 195/438 (44.52%), Query Frame = 3
Query:  270 VKCQH-WTFSSEPFGKTIMSDYDLVCDYKYVGDLLVLLWYSTSLM-APVFGWLADKYGRKMISIIFLSIETVATFILAFTPNLSSHIFFRLCIGFSESAYHICYVWL-MEMVNKDFRNVAGSFFWLYGSVAMTVFPLTVYVTRNWRLTQLISLTPSILYVLI-LFVPESPRWLCVKNKKQQLMESLQTIANINKMDLQLTPXXXXXXXXXXXSNK-------WNAFKDNNFLFLASTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMFVLGLMEFPGALLSYLSMYFFKRKRMITIFSMFGSIFIFLSVTLSKVDKWQSIFRMIFGSIGKVLVITSSQGVLVYATELFPTTHRSLFFGMLQIILLMAMTAAVYINKLNQFYGFIPMLIYFLLNMISCCLIFVFMPETKGLPIPETIFDQRLLVKE--REQEYLEYMYN 1544
            VKCQ+ W +    F  T+ +++DLVC+ K++      +++   +  AP+FG+L+D++GR+ + ++          + A + +       R   G S +   I  + L +E  +   R  +G    L  ++   +     Y    WR   L + +P IL V++  ++PES RWL    K +     +   A +NK    LT    +    + ES +        + FK  N   LA  +    F ++     I ++++    N +++ F+   +E P  +  Y S+    R+R      +  S+ +F+++ +SK +KW  + R I G +GK     S   + +Y TEL+PT  R    G    +  + ++ +  +    + +  +P  IY  + + S  +I   +PET    +PE I D     K+  R +E    M++
Sbjct:  107 VKCQNGWVYDKSIFRSTLATEWDLVCNKKWMNKATATVFFIGVMTGAPLFGYLSDRFGRRPLLLVSYLSSLTFAILSAVSTSFVMFAIMRFLTGISLAGISIISIALNIEWCSTKHRTFSGIIISLDWTLGNWLLVGIAYGINEWRTLILAATSPLILAVMVWRWLPESARWLIANGKAEAAQYYMMKCAKMNKGSKGLTTIIPEALLESVESEREGKKFTVADLFKTPNMRKLAICTGIVWFGVAFTYYGITLNISGFGLNPHLTQFIFASIEMPMKIAVYFSLEKLGRRRCEVTALLATSLLLFINIFVSK-EKW--LIRTIVGVLGKSTSEASFTIMYLYTTELYPTVVRQNGLGYTAFLARLGVSVSPLVVLSEEAWHLLPACIYCAVALGS-GVIASLLPETLDAQLPEFIEDIEKTRKQSVRREEIQSNMHD 540          
BLAST of slc22a-7 vs. Planmine SMEST
Match: SMESG000025785.1 (SMESG000025785.1)

HSP 1 Score: 970.304 bits (2507), Expect = 0.000e+0
Identity = 519/525 (98.86%), Postives = 522/525 (99.43%), Query Frame = 3
Query:   51 MILENVISFYNKKDTFKVIAFLILSLPAFQYGSQFQNLLVSIQTPNFTCQYNETSHQIQISKDQCTMTINGSNVKCQHWTFSSEPFGKTIMSDYDLVCDYKYVGDLLVLLWYSTSLMAPVFGWLADKYGRKMISIIFLSIETVATFILAFTPNLSSHIFFRLCIGFSESAYHICYVWLMEMVNKDFRNVAGSFFWLYGSVAMTVFPLTVYVTRNWRLTQLISLTPSILYVLILFVPESPRWLCVKNKKQQLMESLQTIANINKMDLQLTPXXXXXXXXXXXSNKWNAFKDNNFLFLASTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMFVLGLMEFPGALLSYLSMYFFKRKRMITIFSMFGSIFIFLSVTLSKVDKWQSIFRMIFGSIGKVLVITSSQGVLVYATELFPTTHRSLFFGMLQIILLMAMTAAVYINKLNQFYGFIPMLIYFLLNMISCCLIFVFMPETKGLPIPETIFDQRLLVKEREQEYLEYMYNRSDVVNSDREDSDASSEMSQLINRKFR 1625
            MILENVISFYNKKDTFKVIAFLILSLPAFQYGSQFQNLLVSI+TPNFTCQYNETSHQIQISKDQCTMTINGSNVKCQHWTFSSEPFG+TIMSDYDLVCDYKYVGDLLVLLWYSTSLMAPVFGWLADKYGRKMISIIFLSIETVATFILAFTPNL SHIFFRLCIGFSESAYHICYVWLMEMVNKDFRNVAGSFFWLYGSVAMTVFPLTVYVTRNWRLTQLISLTPSILYVLILFVPESPRWLCVKNKKQQLMESLQTIANINKMDLQLTPEEIKIEKTTKE NKWNAFKD NFLFLASTSLFAVFSISILISAILIDLNLLSSNIYISMFVLGLMEFPGALLSYLSMYFFKRKRMITIFSMFGSIFIFLSVTLSKVDKWQSIFRMIFGSIGKVLV+TSSQGVLVYATELFPTTHRSLFFGMLQIILLMAMTAAVYINKLNQFYGFIPMLIYFLLNMISCCLIFVFMPETKGLPIPETIFDQRLLVKEREQEYLEYMYNRSDVVNSDREDSDASSEMSQLINRKFR
Sbjct:    1 MILENVISFYNKKDTFKVIAFLILSLPAFQYGSQFQNLLVSIRTPNFTCQYNETSHQIQISKDQCTMTINGSNVKCQHWTFSSEPFGETIMSDYDLVCDYKYVGDLLVLLWYSTSLMAPVFGWLADKYGRKMISIIFLSIETVATFILAFTPNLYSHIFFRLCIGFSESAYHICYVWLMEMVNKDFRNVAGSFFWLYGSVAMTVFPLTVYVTRNWRLTQLISLTPSILYVLILFVPESPRWLCVKNKKQQLMESLQTIANINKMDLQLTPEEIKIEKTTKEWNKWNAFKDMNFLFLASTSLFAVFSISILISAILIDLNLLSSNIYISMFVLGLMEFPGALLSYLSMYFFKRKRMITIFSMFGSIFIFLSVTLSKVDKWQSIFRMIFGSIGKVLVMTSSQGVLVYATELFPTTHRSLFFGMLQIILLMAMTAAVYINKLNQFYGFIPMLIYFLLNMISCCLIFVFMPETKGLPIPETIFDQRLLVKEREQEYLEYMYNRSDVVNSDREDSDASSEMSQLINRKFR 525          
BLAST of slc22a-7 vs. Planmine SMEST
Match: SMESG000025822.1 (SMESG000025822.1)

HSP 1 Score: 524.628 bits (1350), Expect = 0.000e+0
Identity = 270/528 (51.14%), Postives = 381/528 (72.16%), Query Frame = 3
Query:   51 MILENVISFYNKKDTFKVIAFLILSLPAFQYGSQFQNLLVSIQTPNFTCQYNETSHQIQISKDQCTMTINGSNVKCQHWTFSSEPFGKTIMSDYDLVCDYKYVGDLLVLLWYSTSLMAPVFGWLADKYGRKMISIIFLSIETVATFILAFTPNLSSHIFFRLCIGFSESAYHICYVWLMEMVNKDFRNVAGSFFWLYGSVAMTVFPLTVYVTRNWRLTQLISLTPSILYVLILFVPESPRWLCVKNKKQQLMESLQTIANINKMDLQLTPXXXXXXXXXXXSNKWNAFKDNNFLFLASTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMFVLGLMEFPGALLSYLSMYFFKRKRMITIFSMFGSIFIFLSVTLSKVDKWQSIFRMIFGSIGKVLVITSSQGVLVYATELFPTTHRSLFFGMLQIILLMAMTAAVYINKLNQFYGFIPMLIYFLLNMISCCLIFVFMPETKGLPIPETIFDQRLLVKEREQEYLEYMYNRSDV-VNSDRE----DSDASSEMSQLINRK 1619
            MILE+++  YNK++TFK +AF ILSLP+FQ+ SQ QN+L+S  TP +TC YN +  +I IS DQC M I+GS + C  W FS EP G+T+MSD+ LVC+YK +GD+++++WYSTS+  P+ GW +DK+GRK ++I  L +ET++TF ++FTP+++S+I  RL IG S + ++ CYVWLMEMV+ +FR  +GSF W YG +A  VFPLT Y T++WR+TQLISL P+ILY LIL  PESPRWLCV N+K +L++SL  IA INK+D  +  E+I + KT  E N W A KD  F    + S   VFSI+++ +AI ++L +LS+N+YISMF+LGLMEFPG L SY+S+ FF+RK    +    GSIFI +SV  S+   WQ + R+IFG I K+ V T +Q  +VY +EL PT+HRSL F  +Q+  L + TAA+YINKL+    F+PM+IYF+L  ++ C+I++++PETK LPIPET+ DQ++L   +E+E+L+YM  + ++ V SD +     S+ S+E S LINRK
Sbjct:    1 MILEDILKDYNKRNTFKFLAFFILSLPSFQFSSQMQNILISTYTPKYTCLYNSSFSKISISADQCNMIIDGSTIVCNKWNFSYEPVGRTMMSDFSLVCNYKNLGDIILIVWYSTSITGPIMGWFSDKFGRKKVAIFNLCLETISTFFVSFTPDVTSNIICRLLIGISANGFYTCYVWLMEMVDNEFREFSGSFIWTYGCLAYMVFPLTAYFTKDWRITQLISLIPNILYFLILLFPESPRWLCVTNRKSELIKSLNKIAEINKIDTNINYEQIFVPKTKDEHNTWKALKDKTFSLRMTLSFLLVFSINLIYAAIAVNLQILSNNMYISMFLLGLMEFPGILFSYVSLRFFRRKTSFILIGGIGSIFILISVFFSRNILWQGVIRIIFGCIAKIAVTTCNQSTMVYVSELCPTSHRSLGFASIQLANLCSFTAAIYINKLSTVLFFLPMVIYFILMFLTSCIIYLYLPETKNLPIPETLLDQKMLKVNKEKEFLDYMNKKREMEVESDLDLDLLKSNESTEESHLINRK 528          
BLAST of slc22a-7 vs. Planmine SMEST
Match: SMESG000025819.1 (SMESG000025819.1)

HSP 1 Score: 523.857 bits (1348), Expect = 0.000e+0
Identity = 270/528 (51.14%), Postives = 380/528 (71.97%), Query Frame = 3
Query:   51 MILENVISFYNKKDTFKVIAFLILSLPAFQYGSQFQNLLVSIQTPNFTCQYNETSHQIQISKDQCTMTINGSNVKCQHWTFSSEPFGKTIMSDYDLVCDYKYVGDLLVLLWYSTSLMAPVFGWLADKYGRKMISIIFLSIETVATFILAFTPNLSSHIFFRLCIGFSESAYHICYVWLMEMVNKDFRNVAGSFFWLYGSVAMTVFPLTVYVTRNWRLTQLISLTPSILYVLILFVPESPRWLCVKNKKQQLMESLQTIANINKMDLQLTPXXXXXXXXXXXSNKWNAFKDNNFLFLASTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMFVLGLMEFPGALLSYLSMYFFKRKRMITIFSMFGSIFIFLSVTLSKVDKWQSIFRMIFGSIGKVLVITSSQGVLVYATELFPTTHRSLFFGMLQIILLMAMTAAVYINKLNQFYGFIPMLIYFLLNMISCCLIFVFMPETKGLPIPETIFDQRLLVKEREQEYLEYMYNRSDV-VNSDRE----DSDASSEMSQLINRK 1619
            MILE+++  YNK++TFK +AF ILSLP+FQ+ SQ QN+L+S  TP +TC YN +  +I IS DQC M I+GS + C  W F  EP G+T+MSD+ LVCDYK +GD+++++WYSTS+  P+ GW +DK+GRK ++I  L +ET++TF ++FTP+++S+I  RL IG S + ++ CYVWLMEMV+ +FR  +GSF W YG +A  VFPLT Y T++WR+TQLISL P+ILY LIL  PESPRWLCV N+K +L++SL  IA INK+D  +  E+I + KT  E N W A KD  F    + S   VFSI+++ +AI ++L +LS+N+YISMF+LGLMEFPG L SY+S+ FF+RK    +    GSIFI +SV  S+   WQ + R+IFG I K+ V T +Q  +VY +EL PT+HRSL F  +Q+  L + TAA+YINKL+    F+PM+IYF+L  ++ C+I++++PETK LPIPET+ DQ++L   +E+E+L+YM  + ++ V SD +     S+ S+E S LINRK
Sbjct:    1 MILEDILKDYNKRNTFKFLAFFILSLPSFQFSSQMQNILISTYTPKYTCLYNSSFSKISISADQCNMIIDGSTIVCNKWNFLYEPVGRTMMSDFSLVCDYKNLGDIILIVWYSTSITGPIMGWFSDKFGRKKVAIFNLCLETISTFFVSFTPDVTSNIICRLLIGISANGFYTCYVWLMEMVDNEFREFSGSFIWTYGCLAYMVFPLTAYFTKDWRITQLISLIPNILYFLILLFPESPRWLCVTNRKSELIKSLNKIAEINKIDTNINYEQIFVPKTKDEHNTWKALKDKTFSLRMTLSFLLVFSINLIYAAIAVNLQILSNNMYISMFLLGLMEFPGILFSYVSLRFFRRKTSFILIGGIGSIFILISVFFSRNILWQGVIRIIFGCIAKIAVTTCNQSTMVYVSELCPTSHRSLGFASIQLANLCSFTAAIYINKLSTVLFFLPMVIYFILMFLTSCIIYLYLPETKNLPIPETLLDQKMLKVNKEKEFLDYMNKKREMEVESDLDLDLLKSNESTEESHLINRK 528          
BLAST of slc22a-7 vs. Planmine SMEST
Match: SMESG000025834.1 (SMESG000025834.1)

HSP 1 Score: 326.25 bits (835), Expect = 1.243e-105
Identity = 202/528 (38.26%), Postives = 321/528 (60.80%), Query Frame = 3
Query:   51 MILENVISFYNKKDTFKVIAFLILSLPAFQYGSQFQNLLVSIQTPNFTCQYNETSHQIQISKDQCTMTINGSNVKCQHWTFSSEPFGKTIMSDYDLVCDYKYVGDLLVLLWYSTSLMAPVFGWLADKYGRKMISIIFLSIETVATFILAFTPNLSSHIFFRLCIGFSESAYHICYVWLMEMVNKDFRNVAGSFFWLYGSVAMTVFPLTVYVTRNWRLTQLISLTPSILYVLILFVPESPRWLCVKNKKQQLMESLQTIANINKMDLQLTPXXXXXXXXXXXSNKWNAFKDNNFLFLASTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMFVLGLMEFPGALLSYLSMYFFKRKRMITIFSMFGSIFIFLSVTLSKVDKWQSIFRMIFGSIGKVLVITSSQGVLVYATELFPTTHRSLFFGMLQIILLMAMTAAVYINKLNQFYGFIPMLIYFLLNMISCCLIFVFMPETKGLPIPETIFDQRLLVKEREQEYLEYMYNRSD-----VVNSDREDSDASSEMSQLINRK 1619
            M L+N++S  NK  TFK++AF ILSLP FQ  SQ QN+L ++  PNF C++N  S  I +SKDQC++ +NG+ + C+ W FS  P G T++SD+ LVCD +Y+GD+++++WY+  L+ P+ G+++D++GRK I I+ L +ET ++ +LA +PN ++++ FR+ +G S                     +  S   L  S+      LT                  + Y+ I F+PESPRWLCV N+K ++MESL+ ++ IN++   +  ++I +E   KE N   A KD +F   + T+LF  FSI+++ S++L+D+ +LSSN+Y+S+F+LGLME P  LLSY  + + KRK    +    GS+ +F+S+  SK    QS+ R++ G + K+ + + +Q ++VY  ELFPTTHRS    +L I   ++ + AV IN+L+    F+P LIYF    I   +++  +PETK LPIPET+ D ++L   +E+E++ YM N+       V NSD + S+  +E S+LI  K
Sbjct:    1 MFLDNILSDINKPLTFKIVAFFILSLPTFQSCSQIQNILFALFIPNFKCKFNSKSKFI-VSKDQCSILMNGTTMNCKEWDFSLLPIGSTLVSDFGLVCDNRYLGDVILMVWYAMFLLGPLVGFMSDRFGRKNIVILSLVLETFSSILLALSPNFATYLTFRILLGLSA--------------------ILSSGRLLDRSIGSIGQSLTC-----------------VFYLFIFFMPESPRWLCVMNRKDEMMESLRFMSKINRLRFDVEKDQIYVENLVKEGNICVACKDTDFQSRSITALFCAFSINLIYSSMLVDIGILSSNMYLSVFLLGLMELPSLLLSYYVLRYIKRKIGFLLIGGVGSLLLFISIFFSKSIPLQSVIRIVLGCLSKIAISSCNQNIMVYVNELFPTTHRSFGITLLLISNFLSFSGAVLINRLSVISYFLPTLIYFSFLWIVGVVVYFSLPETKDLPIPETLIDMKMLKCGKEEEFVFYMQNKHKYFNHTVDNSDEKSSENLNEKSKLITGK 490          
BLAST of slc22a-7 vs. Planmine SMEST
Match: SMESG000004219.1 (SMESG000004219.1)

HSP 1 Score: 160.614 bits (405), Expect = 1.058e-42
Identity = 144/510 (28.24%), Postives = 247/510 (48.43%), Query Frame = 3
Query:   96 FKVIAFLILSLPAFQYGSQFQNLLVSIQTPNFTCQYNETSHQIQ-----ISKDQCT--MTINGSNVKCQHWTFSSEPFGKTIMSDYDLVCDYKYVGDLLVLLWYSTSLMAPVFGWLADKYGRKMISIIFLSIETVATFILAFTPNLSSHIFFRLCIGFSESAY-HICYVWLMEMVNKDFRNVAGSFFWLYGSVAMTVFPLTVYVTRNWRLTQLISLTPSILYVLIL-FVPESPRWLCVKNKKQQLMESLQTIANINKMDLQLTPXXXXXXXXXXXSNKWNAFKDNNFLFLASTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMFVLGLMEFPGALLSYLSMYFFKRKRMITIFSMFGSIFIFLSVTLSKVDKWQSIFR---MIFGSIGKVLVITSSQGVL-VYATELFPTTHRSLFFGMLQIILLMAMTAAVYINK-LNQFYGFIPMLIYFLLNMISCCLIFVFMPETKGLPIPETIFDQRLLVKEREQEYLEYMYNRSDVVNSDREDSD 1583
            F  I+F+ LS+  F+Y  +FQ L  ++  P F+C     S  I+     ISKDQC   +++N S  KC  WTF       T++++ +LVCD  +  +L+   ++   L +  F  L+D  G++++ I+ + + T+ T     +  +   +      G  +S Y  + Y  L+E++     ++A + FW   S    +  L  Y+ R+WR   ++SL  SI YVL   FVPE+PRWL +  ++ +  +++  IA INK  L                  WN  K    ++      FA ++ S        DL   S NI+I+ FV+GL+E P   LS +      RK+ ++  S  G I   + +   + D  +S+++    +  ++G  L  +S+  +  +   EL PTT R+    ++ I + +    A  I+  L QFY   P L+Y LL +I+  L+F F+PET  LP+P+TI     L+  +EQE+   M  +++ +      S+
Sbjct:   16 FHYISFMTLSITTFKYVVEFQGLTFALYEPKFSCLVKNISSTIRNSTNLISKDQCQYRLSVNDSWNKCDQWTFEKRFMRNTLINELNLVCDRAFYRELIFTTFFVGCLFSFPFSILSDSIGKRLLLIVSIFLSTIITIGQMVSYQIWQQLVLSFVSGVCKSVYVSLAYTTLIEIIPVSHIDLAATNFWNLYSFGYMLVALFAYIFRSWRQIYILSLITSIFYVLYFWFVPETPRWLMLNKRRNEAFKTMSFIAKINKCTLNKEEFNKWKPIQQVTGKFWNLLKHKTMIYRFLILNFAGWAFSFAYIGSATDLTFASENIFITTFVMGLIELPTGPLSGIMANKLGRKKSVSALSGLG-IICLIIMPFIEADSLKSVWQPWLKVCLAMGAKLGFSSAWLIFDIITNELIPTTDRNTAMSLVYITVGLGSIFAPMIHSVLLQFYFAGPFLLYSLLLLITVVLVFAFIPETHHLPVPQTIEQAVSLLIHKEQEWKMDMIQQAEKLGMVHRPSE 524          
The following BLAST results are available for this feature:
BLAST of slc22a-7 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC22A49.947e-1923.77solute carrier family 22 member 4 [Source:HGNC Sym... [more]
SLC22A136.707e-1823.43solute carrier family 22 member 13 [Source:HGNC Sy... [more]
SLC22A31.098e-1732.22solute carrier family 22 member 3 [Source:HGNC Sym... [more]
SLC22A151.552e-1724.01solute carrier family 22 member 15 [Source:HGNC Sy... [more]
SLC22A22.152e-1728.27solute carrier family 22 member 2 [Source:HGNC Sym... [more]
back to top
BLAST of slc22a-7 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
C06H5.63.331e-2124.27pep chromosome:WBcel235:V:17879844:17888968:-1 gen... [more]
C06H5.63.331e-2124.27pep chromosome:WBcel235:V:17879844:17888984:-1 gen... [more]
B0361.116.524e-2024.66Putative transporter B0361.11 [Source:UniProtKB/S... [more]
oct-29.125e-1827.19Organic Cation Transporter [Source:UniProtKB/TrEM... [more]
C44C10.34.998e-1627.65pep chromosome:WBcel235:X:11702525:11704500:1 gene... [more]
back to top
BLAST of slc22a-7 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Orct22.329e-1926.04gene:FBgn0086365 transcript:FBtr0084598[more]
Orct22.329e-1926.04gene:FBgn0086365 transcript:FBtr0334869[more]
CG89258.194e-1627.92gene:FBgn0038404 transcript:FBtr0083253[more]
CG89258.936e-1627.41gene:FBgn0038404 transcript:FBtr0113241[more]
Balat2.810e-1525.55gene:FBgn0033778 transcript:FBtr0087815[more]
back to top
BLAST of slc22a-7 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc22a23.919e-2524.38solute carrier family 22 member 2 [Source:ZFIN;Acc... [more]
slc22a41.146e-2424.49solute carrier family 22 member 4 [Source:ZFIN;Acc... [more]
slc22a6l9.595e-2221.86solute carrier family 22 member 6, like [Source:NC... [more]
oct21.870e-2123.78organic cation transporter 2 [Source:ZFIN;Acc:ZDB-... [more]
si:dkey-166k12.13.679e-2130.84si:dkey-166k12.1 [Source:ZFIN;Acc:ZDB-GENE-120215-... [more]
back to top
BLAST of slc22a-7 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000022866.12.270e-3023.40solute carrier family 22 (organic anion transporte... [more]
ENSXETT00000036031.12.601e-2922.96solute carrier family 22 (organic anion transporte... [more]
ENSXETT00000036038.15.016e-2923.05solute carrier family 22 (organic anion transporte... [more]
ENSXETT00000022873.17.200e-2923.44solute carrier family 22 (organic anion transporte... [more]
emc27.174e-2221.00ER membrane protein complex subunit 2 [Source:Xenb... [more]
back to top
BLAST of slc22a-7 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc22a59.850e-2424.46solute carrier family 22 (organic cation transport... [more]
Slc22a216.997e-2125.46solute carrier family 22 (organic cation transport... [more]
Slc22a207.643e-2122.17solute carrier family 22 (organic anion transporte... [more]
Slc22a38.003e-2031.32solute carrier family 22 (organic cation transport... [more]
Slc22a38.068e-2031.15solute carrier family 22 (organic cation transport... [more]
back to top
BLAST of slc22a-7 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9Z0E8|S22A5_MOUSE6.890e-2324.46Solute carrier family 22 member 5 OS=Mus musculus ... [more]
sp|O70594|S22A5_RAT5.687e-2224.24Solute carrier family 22 member 5 OS=Rattus norveg... [more]
sp|Q9WTN6|S22AL_MOUSE4.894e-2025.46Solute carrier family 22 member 21 OS=Mus musculus... [more]
sp|Q80UJ1|S22AK_MOUSE5.347e-2022.17Solute carrier family 22 member 20 OS=Mus musculus... [more]
sp|Q9WTW5|S22A3_MOUSE5.644e-1931.15Solute carrier family 22 member 3 OS=Mus musculus ... [more]
back to top
BLAST of slc22a-7 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YF340.000e+0100.00Slc22a-7 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A0H3YJ931.347e-18051.52Slc22a-1 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A0H3YFD11.819e-13442.99Slc22a-9 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A267FBR03.014e-4125.00MFS domain-containing protein OS=Macrostomum ligna... [more]
A0A0H3YF327.454e-3928.60Slc22a-2 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
back to top
BLAST of slc22a-7 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc22a41.232e-2325.89solute carrier family 22 member 4-like [Source:NCB... [more]
ENSAMXT00000010878.21.534e-2325.12pep primary_assembly:Astyanax_mexicanus-2.0:14:292... [more]
SLC22A24.147e-2323.97solute carrier family 22 member 2-like [Source:NCB... [more]
ENSAMXT00000046180.16.835e-2225.36solute carrier family 22 member 4-like [Source:NCB... [more]
zmp:00000011021.054e-2123.69solute carrier family 22 member 7-like [Source:NCB... [more]
back to top
BLAST of slc22a-7 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
oct24.798e-2229.27organic cation transporter 2 [Source:ZFIN;Acc:ZDB-... [more]
SLC22A79.350e-2130.15solute carrier family 22 member 7 [Source:HGNC Sym... [more]
ENSPMAT00000007122.12.763e-1327.96pep scaffold:Pmarinus_7.0:GL476962:153150:164773:-... [more]
si:dkey-190l8.21.936e-1224.23si:dkey-190l8.2 [Source:ZFIN;Acc:ZDB-GENE-030131-9... [more]
svopl1.468e-726.85SVOP-like [Source:NCBI gene;Acc:492766][more]
back to top
BLAST of slc22a-7 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
CIN109.077e-730.77Putative transporter; member of the sugar porter f... [more]
back to top
BLAST of slc22a-7 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO367238.995e-2926.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO366967.151e-2625.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO278297.660e-2024.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO365978.184e-2023.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO473162.247e-1924.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc22a-7 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc22a41.130e-2527.97solute carrier family 22 member 4 [Source:NCBI gen... [more]
slc22a21.045e-2331.05solute carrier family 22 member 2 [Source:NCBI gen... [more]
slc22a41.049e-2327.15solute carrier family 22 member 4 [Source:NCBI gen... [more]
ENSORLT00000024218.21.768e-2224.95solute carrier family 22 member 7 [Source:NCBI gen... [more]
ENSORLT00000042842.15.650e-2023.52solute carrier family 22 member 7 [Source:NCBI gen... [more]
back to top
BLAST of slc22a-7 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000025785.10.000e+098.86SMESG000025785.1[more]
SMESG000025822.10.000e+051.14SMESG000025822.1[more]
SMESG000025819.10.000e+051.14SMESG000025819.1[more]
SMESG000025834.11.243e-10538.26SMESG000025834.1[more]
SMESG000004219.11.058e-4228.24SMESG000004219.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30011820
GenBankAKN21555.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011820 ID=SMED30011820|Name=slc22a-7|organism=Schmidtea mediterranea sexual|type=transcript|length=1666bp
ATAAAAACTACACGATAAAAGCTGTACGTTAGGTTGCCATTTTATTAAGA
ATGATTTTAGAAAATGTTATCTCATTCTATAATAAAAAAGATACATTCAA
AGTTATTGCCTTCTTGATACTGTCTTTGCCAGCCTTTCAATATGGTAGCC
AGTTTCAAAATTTACTCGTGTCAATCCAGACACCGAATTTCACTTGCCAA
TATAACGAAACCAGCCACCAAATCCAAATCTCAAAAGATCAGTGTACAAT
GACAATAAATGGATCAAATGTTAAATGCCAACATTGGACATTTTCTTCTG
AACCTTTTGGGAAAACCATCATGTCGGATTATGATCTTGTTTGTGATTAT
AAGTATGTGGGTGATTTGTTGGTTTTATTGTGGTATTCAACATCCCTAAT
GGCGCCAGTCTTTGGGTGGTTGGCTGACAAGTATGGCAGGAAGATGATTT
CGATAATATTTCTCAGCATTGAAACTGTTGCCACATTTATTCTGGCTTTC
ACCCCGAATTTATCCAGTCACATTTTCTTTAGACTCTGCATTGGATTCAG
TGAGTCTGCGTACCATATTTGCTACGTTTGGCTGATGGAAATGGTTAATA
AAGATTTTCGTAACGTAGCCGGTTCGTTTTTTTGGCTTTATGGTTCGGTT
GCAATGACTGTCTTTCCACTTACTGTTTATGTCACTCGAAATTGGCGCCT
AACTCAATTGATTTCCCTTACACCAAGCATTCTTTACGTGCTGATCTTAT
TCGTTCCAGAATCTCCGCGTTGGTTGTGTGTAAAGAATAAAAAACAACAA
CTTATGGAATCTTTACAGACTATTGCAAATATTAACAAAATGGATTTACA
GCTGACTCCAGAAGAAATAAAAATAGAAAAAACAACAAAAGAATCGAATA
AATGGAATGCATTCAAAGACAATAATTTCTTATTTCTAGCGAGCACTTCT
CTTTTTGCTGTTTTCTCAATCAGTATTCTCATATCAGCAATATTAATTGA
CTTGAACCTTTTGAGCTCTAATATTTACATTTCGATGTTTGTCCTTGGGC
TCATGGAATTCCCAGGAGCATTATTGTCTTATCTGTCAATGTACTTTTTC
AAACGGAAACGTATGATAACTATCTTTTCCATGTTCGGCTCAATATTTAT
CTTTCTAAGTGTGACTTTAAGTAAGGTGGATAAATGGCAATCAATCTTTC
GTATGATCTTCGGTAGTATTGGAAAGGTTCTTGTGATAACTAGCAGTCAA
GGCGTTTTGGTATATGCAACTGAATTATTTCCTACGACTCATCGTTCGTT
GTTTTTCGGGATGTTGCAAATCATTTTATTAATGGCAATGACTGCTGCAG
TATATATCAACAAATTAAACCAATTTTACGGCTTTATACCAATGCTAATA
TATTTTTTGTTAAATATGATCTCATGTTGTCTGATATTCGTCTTTATGCC
GGAGACGAAAGGTCTACCTATTCCTGAAACAATATTTGACCAAAGATTAT
TAGTAAAAGAAAGAGAGCAAGAATATTTAGAGTATATGTATAACCGTTCT
GATGTTGTCAATTCAGACCGAGAGGATTCTGATGCAAGCAGTGAAATGAG
CCAGTTAATAAATCGGAAATTTCGTTAATTCCCTCGGTGAACGGATTAAT
AATTCATGACGAGCTG
back to top

protein sequence of SMED30011820-orf-1

>SMED30011820-orf-1 ID=SMED30011820-orf-1|Name=SMED30011820-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=526bp
MILENVISFYNKKDTFKVIAFLILSLPAFQYGSQFQNLLVSIQTPNFTCQ
YNETSHQIQISKDQCTMTINGSNVKCQHWTFSSEPFGKTIMSDYDLVCDY
KYVGDLLVLLWYSTSLMAPVFGWLADKYGRKMISIIFLSIETVATFILAF
TPNLSSHIFFRLCIGFSESAYHICYVWLMEMVNKDFRNVAGSFFWLYGSV
AMTVFPLTVYVTRNWRLTQLISLTPSILYVLILFVPESPRWLCVKNKKQQ
LMESLQTIANINKMDLQLTPEEIKIEKTTKESNKWNAFKDNNFLFLASTS
LFAVFSISILISAILIDLNLLSSNIYISMFVLGLMEFPGALLSYLSMYFF
KRKRMITIFSMFGSIFIFLSVTLSKVDKWQSIFRMIFGSIGKVLVITSSQ
GVLVYATELFPTTHRSLFFGMLQIILLMAMTAAVYINKLNQFYGFIPMLI
YFLLNMISCCLIFVFMPETKGLPIPETIFDQRLLVKEREQEYLEYMYNRS
DVVNSDREDSDASSEMSQLINRKFR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR036259MFS_trans_sf
IPR005828MFS_sugar_transport-like
IPR020846MFS_dom
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: molecular function
TermDefinition
GO:0022857transmembrane transporter activity
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR005828Major facilitator, sugar transporter-likePFAMPF00083Sugar_trcoord: 120..474
e-value: 2.7E-21
score: 76.0
NoneNo IPR availableGENE3DG3DSA:1.20.1250.20coord: 11..480
e-value: 2.8E-53
score: 183.3
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 506..525
NoneNo IPR availablePANTHERPTHR24064:SF411coord: 50..480
NoneNo IPR availablePANTHERPTHR24064FAMILY NOT NAMEDcoord: 50..480
NoneNo IPR availableCDDcd17317MFS_SLC22coord: 78..465
e-value: 5.93761E-36
score: 134.63
NoneNo IPR availableTMHMMTMhelixcoord: 446..465
NoneNo IPR availableTMHMMTMhelixcoord: 417..436
NoneNo IPR availableTMHMMTMhelixcoord: 20..42
NoneNo IPR availableTMHMMTMhelixcoord: 382..404
NoneNo IPR availableTMHMMTMhelixcoord: 158..177
NoneNo IPR availableTMHMMTMhelixcoord: 326..348
NoneNo IPR availableTMHMMTMhelixcoord: 294..316
NoneNo IPR availableTMHMMTMhelixcoord: 103..125
NoneNo IPR availableTMHMMTMhelixcoord: 132..154
NoneNo IPR availableTMHMMTMhelixcoord: 221..243
NoneNo IPR availableTMHMMTMhelixcoord: 189..211
NoneNo IPR availableTMHMMTMhelixcoord: 355..372
IPR020846Major facilitator superfamily domainPROSITEPS50850MFScoord: 20..470
score: 14.78
IPR036259MFS transporter superfamilySUPERFAMILYSSF103473MFS general substrate transportercoord: 103..475