G_PROTEIN_RECEP_F1_2 domain-containing protein

Overview
NameG_PROTEIN_RECEP_F1_2 domain-containing protein
Smed IDSMED30011800
Length (bp)876
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30011800) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30011800) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011800

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30011800SMESG000020911.1 dd_Smed_v4_12466_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30011800SMESG000020911.1 dd_Smed_v4_12466_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30011800SMESG000020911.1 dd_Smed_v4_12466_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30011800SMESG000020911.1 dd_Smed_v4_12466_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30011800SMESG000020911.1 dd_Smed_v4_12466_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30011800SMESG000020911.1 dd_Smed_v4_12466_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30011800SMESG000020911.1 dd_Smed_v4_12466_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30011800SMESG000020911.1 Contig51185newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30011800SMESG000020911.1 Contig51185uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
dorsal-ventral muscle cellSMED30011800SMESG000020911.1 dd_Smed_v4_12466_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Match: CCKBR (cholecystokinin B receptor [Source:HGNC Symbol;Acc:HGNC:1571])

HSP 1 Score: 61.2326 bits (147), Expect = 5.580e-10
Identity = 53/173 (30.64%), Postives = 93/173 (53.76%), Query Frame = 3
Query:  243 VILRLKEMRNKYTHLFLLNMAFADLAVSIFCVNFTLLEYIKG-FVFHQLGLIACRFNFFXXXXXXXXXXXXXXXXXIERYIAIVFPMKVHRLMSKSHQLILLFAIWIISSLMGMPNLFIYKLMNNSSF----C--HSSESFLRQYLHLTQFLTLYFLPLLIMAVLYCHIGMKL 740
            V+L L       T+ FLL++A +DL +++ C+ FTLL  + G F+F   G + C+   +L  VS + S L L+ +++ERY AI  P++     ++SH   ++ A W++S L+ +P   +Y ++         C      + +RQ   +   L L+F+P ++MAV Y  I  +L
Sbjct:   77 VVLGLSRRLRTVTNAFLLSLAVSDLLLAVACMPFTLLPNLMGTFIF---GTVICKAVSYLMGVSVSVSTLSLVAIALERYSAICRPLQARVWQTRSHAARVIVATWLLSGLLMVP-YPVYTVVQPVGPRVLQCVHRWPSARVRQTWSVLLLLLLFFIPGVVMAVAYGLISREL 245          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Match: QRFPR (pyroglutamylated RFamide peptide receptor [Source:HGNC Symbol;Acc:HGNC:15565])

HSP 1 Score: 61.2326 bits (147), Expect = 5.668e-10
Identity = 47/177 (26.55%), Postives = 90/177 (50.85%), Query Frame = 3
Query:  240 FVILRLKEMRNKYTHLFLLNMAFADLAVSIFCVNFTLLEYIKGFVFHQLGLIACRFNFFXXXXXXXXXXXXXXXXXIERYIAIVFPMKVHRLMSKSHQLILLFAIWIISSLMGMPNLFIYKLMNNSSFCHSSE---------SFLRQYLHLTQFLT-LYFLPLLIMAVLYCHIGMKL 740
            +V+ R K MR   T++F+ ++A +DL ++ FC+  T+L+ I        G   C+   F+QS +    +L +  +++ER+  +V P K+    +      +L  +W+++ ++G P   + +L     F +  E         S + Q ++ T  L  L+ LPL++M +LY  IG +L
Sbjct:   68 YVVTRSKAMRT-VTNIFICSLALSDLLITFFCIPVTMLQNISDNWLG--GAFICKMVPFVQSTAVVTEILTMTCIAVERHQGLVHPFKMKWQYTNRRAFTMLGVVWLVAVIVGSPMWHVQQLEIKYDFLYEKEHICCLEEWTSPVHQKIYTTFILVILFLLPLMVMLILYSKIGYEL 241          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Match: CCKBR (cholecystokinin B receptor [Source:HGNC Symbol;Acc:HGNC:1571])

HSP 1 Score: 60.8474 bits (146), Expect = 6.733e-10
Identity = 53/173 (30.64%), Postives = 93/173 (53.76%), Query Frame = 3
Query:  243 VILRLKEMRNKYTHLFLLNMAFADLAVSIFCVNFTLLEYIKG-FVFHQLGLIACRFNFFXXXXXXXXXXXXXXXXXIERYIAIVFPMKVHRLMSKSHQLILLFAIWIISSLMGMPNLFIYKLMNNSSF----C--HSSESFLRQYLHLTQFLTLYFLPLLIMAVLYCHIGMKL 740
            V+L L       T+ FLL++A +DL +++ C+ FTLL  + G F+F   G + C+   +L  VS + S L L+ +++ERY AI  P++     ++SH   ++ A W++S L+ +P   +Y ++         C      + +RQ   +   L L+F+P ++MAV Y  I  +L
Sbjct:   77 VVLGLSRRLRTVTNAFLLSLAVSDLLLAVACMPFTLLPNLMGTFIF---GTVICKAVSYLMGVSVSVSTLSLVAIALERYSAICRPLQARVWQTRSHAARVIVATWLLSGLLMVP-YPVYTVVQPVGPRVLQCVHRWPSARVRQTWSVLLLLLLFFIPGVVMAVAYGLISREL 245          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Match: TACR3 (tachykinin receptor 3 [Source:HGNC Symbol;Acc:HGNC:11528])

HSP 1 Score: 59.6918 bits (143), Expect = 1.631e-9
Identity = 53/187 (28.34%), Postives = 95/187 (50.80%), Query Frame = 3
Query:  240 FVILRLKEMRNKYTHLFLLNMAFADLAVSIFCVNFTLLEYIKGFVFHQ---LGLIACRFNFFXXXXXXXXXXXXXXXXXIERYIAIVFPMKVHRLMSKSHQLILLFAIWIISSLMGMPNLFI--YKLMNNSSFC--HSSESFLRQYL-HLTQFLTLYFLPLLIMAVLYCHIGMKLTES---CNCCDQ 767
            ++IL  K MR   T+ FL+N+AF+D +++ F    TL+ +I  +  H     G   CRF  F    +  AS+  +  ++++RY+AI+ P+K    +S +   I++ +IWI++ L+  P       K+M   + C     E   + +  H+   + +Y  PLLIM + Y  +G+ L       + CD+
Sbjct:  108 WIILAHKRMRT-VTNYFLVNLAFSDASMAAFN---TLVNFI--YALHSEWYFGANYCRFQNFFPITAVFASIYSMTAIAVDRYMAIIDPLKPR--LSATATKIVIGSIWILAFLLAFPQCLYSKTKVMPGRTLCFVQWPEGPKQHFTYHIIVIILVYCFPLLIMGITYTIVGITLWGGEIPGDTCDK 286          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Match: CCKAR (cholecystokinin A receptor [Source:HGNC Symbol;Acc:HGNC:1570])

HSP 1 Score: 58.5362 bits (140), Expect = 3.609e-9
Identity = 54/176 (30.68%), Postives = 91/176 (51.70%), Query Frame = 3
Query:  243 VILRLKEMRNKYTHLFLLNMAFADLAVSIFCVNFTLL-EYIKGFVFHQLGLIACRFNFFXXXXXXXXXXXXXXXXXIERYIAIVFPMKVHRLMSKSHQLILLFAIWIISSLMGMP-----NLFIYKLMNN--SSFCH--SSESFLRQYLHLTQFLTLYFLPLLIMAVLYCHIGMKL 740
            V++R K MR   T++FLL++A +DL + +FC+ F L+   +K F+F   G   C+   +    S + S   L+ +S+ERY AI  P++     +KSH L ++ A W +S  +  P     NL  +   NN  ++ C        ++Q  H    L L+ +P ++M V Y  I ++L
Sbjct:   65 VLIRNKRMRT-VTNIFLLSLAVSDLMLCLFCMPFNLIPNLLKDFIF---GSAVCKTTTYFMGTSVSVSTFNLVAISLERYGAICKPLQSRVWQTKSHALKVIAATWCLSFTIMTPYPIYSNLVPFTKNNNQTANMCRFLLPNDVMQQSWHTFLLLILFLIPGIVMMVAYGLISLEL 236          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Match: ckr-1 (CholecystoKinin Receptor homolog [Source:UniProtKB/TrEMBL;Acc:P91487])

HSP 1 Score: 74.7146 bits (182), Expect = 6.448e-15
Identity = 69/205 (33.66%), Postives = 107/205 (52.20%), Query Frame = 3
Query:  279 THLFLLNMAFADLAVSIFCVNFTLL-EYIKGFVFHQLGLIACRFNFFXXXXXXXXXXXXXXXXXIERYIAIVFPMKVHRLMSKSHQLILLFAIWIISSLMGMPNLFIYKLMNNSSFCHSSESFLRQYLH-LTQFLTLYFLPLLIMAVLYCHIGMKLTESCNC----CDQT*TFLTSPSISHFIDCRLLISAVLKLD*MELTSKTF 875
            T+ +LLN+AFADL  SI C+  TLL E  + ++   LG   C+   FLQ V   AS   L +++IERY AI  P++  +  +K   LI +  +W  S    + +LF+Y        C S++  L  +++ L    TL F+PL +M  LY ++ + L  + N      +Q     T PS + F D    +SAV ++  M++ SKTF
Sbjct:   49 TNFYLLNLAFADLLRSIICIPSTLLGELTQCWL---LGAAMCKIVAFLQPVGVCASAYTLAVIAIERYYAICRPLESRKWQTKKRALITISLVWCFSFSANLTSLFLYDANPGKFTCDSTKGPLVDFIYQLYLTFTLLFVPLALMVGLYGNVIITLNTAINSDHPTVEQQMIEKTLPSRASFSD--WFVSAVQRVPSMKVVSKTF 248          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Match: npr-15 (Neuropeptide receptor 15 [Source:UniProtKB/Swiss-Prot;Acc:Q09638])

HSP 1 Score: 62.7734 bits (151), Expect = 4.616e-11
Identity = 56/184 (30.43%), Postives = 86/184 (46.74%), Query Frame = 3
Query:  240 FVILRLKEMRNKYTHLFLLNMAFADLAVSIFCVNFTLLEYIKGFVFHQLGLI----ACRFNFFXXXXXXXXXXXXXXXXXIERYIAIVFPMKVHRLMSKSHQLILLFAIWIISSLMGMP--------------NLFIYKLMNNSSFCHSS--ESFLRQYLHLTQFLTLYFLPLLIMAVLYCHIG 731
            + I   + MR    ++ LLN+A ADLA  IF    T+ E+I    F     +     C    +L+ V   AS+   +++ IERYIAIV PM+  +L S+ + LI +   WI  +    P              N   +KL   S+ C ++  +S   Q   LT+FL  YF+P  I+ V+Y  + 
Sbjct:   29 YAIAGDRNMRKSVMNILLLNLAVADLANLIF----TIPEWIPPVFFGSTDWLFPSFLCPVCRYLECVFLFASISTQMIVCIERYIAIVLPMQARQLCSRRNVLITVLVDWIFVACFASPYAVWHSVKTKDRNTNSLRFKLFQLSATCSNTVGKSTWWQGYKLTEFLAFYFVPCFIITVVYTKVA 208          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Match: npr-22 (Neuropeptide receptor 22 [Source:UniProtKB/Swiss-Prot;Acc:Q59E83])

HSP 1 Score: 62.003 bits (149), Expect = 1.272e-10
Identity = 52/184 (28.26%), Postives = 93/184 (50.54%), Query Frame = 3
Query:  243 VILRLKEMRNKYTHLFLLNMAFADLAVSIFCVNFTLLEYIKGFVFHQ----LGLIACRFNFFXXXXXXXXXXXXXXXXXIERYIAIVFPMKVHRLMSKSHQLILLFAIWIISSLMGMPNLFIYKLMNNSS-----------FCHSSESFLRQYLHLTQFLTLYFLPLLIMAVLYCHIGMKLTES 749
            VI+  K +R   T++ +LN+A ADL +S+FC+ F+   Y +  ++       G + C    FLQ+++   S   L+++S +R++AI+F +  +  +++   L L+ A WI S LM +P LF  +   +             F  S E   + Y  +   L  Y +P  ++ + Y HIG+K+  S
Sbjct:   74 VIVYFKRLRTA-TNILILNLAVADLLISVFCIPFS---YWQVLIYDDQRWLFGSMMCSLLAFLQAMAVFLSAWTLVVISFDRWMAIMFLLTPNIRITRRRALYLVAATWIFSILMALPLLFTTRFFEDQDGLPNCGENWTYFGDSGEQVRKVYSSMVLILQ-YVVPQAVLIITYTHIGIKMWNS 252          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Match: npr-22 (Neuropeptide receptor 22 [Source:UniProtKB/Swiss-Prot;Acc:Q59E83])

HSP 1 Score: 61.6178 bits (148), Expect = 1.299e-10
Identity = 52/184 (28.26%), Postives = 93/184 (50.54%), Query Frame = 3
Query:  243 VILRLKEMRNKYTHLFLLNMAFADLAVSIFCVNFTLLEYIKGFVFHQ----LGLIACRFNFFXXXXXXXXXXXXXXXXXIERYIAIVFPMKVHRLMSKSHQLILLFAIWIISSLMGMPNLFIYKLMNNSS-----------FCHSSESFLRQYLHLTQFLTLYFLPLLIMAVLYCHIGMKLTES 749
            VI+  K +R   T++ +LN+A ADL +S+FC+ F+   Y +  ++       G + C    FLQ+++   S   L+++S +R++AI+F +  +  +++   L L+ A WI S LM +P LF  +   +             F  S E   + Y  +   L  Y +P  ++ + Y HIG+K+  S
Sbjct:   74 VIVYFKRLRTA-TNILILNLAVADLLISVFCIPFS---YWQVLIYDDQRWLFGSMMCSLLAFLQAMAVFLSAWTLVVISFDRWMAIMFLLTPNIRITRRRALYLVAATWIFSILMALPLLFTTRFFEDQDGLPNCGENWTYFGDSGEQVRKVYSSMVLILQ-YVVPQAVLIITYTHIGIKMWNS 252          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Match: tkr-2 (TachyKinin Receptor family [Source:UniProtKB/TrEMBL;Acc:O44148])

HSP 1 Score: 56.9954 bits (136), Expect = 4.402e-9
Identity = 52/191 (27.23%), Postives = 92/191 (48.17%), Query Frame = 3
Query:  240 FVILRLKEMRNKYTHLFLLNMAFADLAVSIFCVNFTLLEYIKGFVFHQLGLIACRFNFFXXXXXXXXXXXXXXXXXIERYIAIVFPMKVHRLMSKSHQLILLFAIWIISSLMGMPNLFI-----------YKLMNN-----SSFCHSSESFLRQYLHLTQFLTLYFLPLLIMAVLYCHIGMKLTESCNCCD 764
            ++IL  ++MR+  T+ +L N+A AD ++S+F   F+   Y   +V+ + G   CR N  +      ASV  ++++SIERY AI+ P+K  +   +   + ++  IW ++ L G+P               Y L  N      ++   +ES L Q  +       Y LPL I++  Y  +G++L +     D
Sbjct:   84 WIILYHRQMRSV-TNYYLFNLAVADASISVFNTGFS-WSYNYYYVW-KFGSFYCRINNLMGITPICASVFTMIVMSIERYYAIIHPLK--KRPGRRSTVTIIIMIWFMAFLFGVPAFLASKVDVYYFYDGYTLYENPLCLADNYPGGNESLLGQVYNNGLITVQYILPLCILSAAYYRVGVELRKDKTVGD 269          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Match: TrissinR (gene:FBgn0085410 transcript:FBtr0330222)

HSP 1 Score: 68.9366 bits (167), Expect = 9.615e-13
Identity = 56/167 (33.53%), Postives = 88/167 (52.69%), Query Frame = 3
Query:  279 THLFLLNMAFADLAVSIFCVNFTLLEY-IKGFVFHQLGLIACRFNFFXXXXXXXXXXXXXXXXXIERYIAIVFPMKVHRLMSKSHQLILLFAIWIISSLMGMPNLFIYKLMNNSSFCHSSES---------FLRQYLHLTQFLTLYFLPLLIMAVLYCHIGMKLTES 749
            T+ FL N+AFAD  V +FCV   L  Y I+ +VF   G   CR   F+ S+SY AS+ +L+++ +ERY AIV P+   ++++ +   +++  +WI S++   P     K + N       E          F  + L +  F+ LY +PLL+M VLY  I + L  S
Sbjct:  219 TNFFLANLAFADFCVGLFCVMQNLSIYLIESWVF---GEFLCRMYQFVHSLSYTASIFILVVICMERYFAIVHPITCKQILTAARLRMVIVTVWITSAVYSTPKFVFSKTIKNIHTQDGQEEEICVLDREMFNSKLLDMINFVLLYVMPLLVMTVLYSKIAIALWRS 382          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Match: TrissinR (gene:FBgn0085410 transcript:FBtr0330221)

HSP 1 Score: 68.5514 bits (166), Expect = 1.097e-12
Identity = 56/167 (33.53%), Postives = 88/167 (52.69%), Query Frame = 3
Query:  279 THLFLLNMAFADLAVSIFCVNFTLLEY-IKGFVFHQLGLIACRFNFFXXXXXXXXXXXXXXXXXIERYIAIVFPMKVHRLMSKSHQLILLFAIWIISSLMGMPNLFIYKLMNNSSFCHSSES---------FLRQYLHLTQFLTLYFLPLLIMAVLYCHIGMKLTES 749
            T+ FL N+AFAD  V +FCV   L  Y I+ +VF   G   CR   F+ S+SY AS+ +L+++ +ERY AIV P+   ++++ +   +++  +WI S++   P     K + N       E          F  + L +  F+ LY +PLL+M VLY  I + L  S
Sbjct:  219 TNFFLANLAFADFCVGLFCVMQNLSIYLIESWVF---GEFLCRMYQFVHSLSYTASIFILVVICMERYFAIVHPITCKQILTAARLRMVIVTVWITSAVYSTPKFVFSKTIKNIHTQDGQEEEICVLDREMFNSKLLDMINFVLLYVMPLLVMTVLYSKIAIALWRS 382          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Match: TrissinR (gene:FBgn0085410 transcript:FBtr0342612)

HSP 1 Score: 68.5514 bits (166), Expect = 1.097e-12
Identity = 56/167 (33.53%), Postives = 88/167 (52.69%), Query Frame = 3
Query:  279 THLFLLNMAFADLAVSIFCVNFTLLEY-IKGFVFHQLGLIACRFNFFXXXXXXXXXXXXXXXXXIERYIAIVFPMKVHRLMSKSHQLILLFAIWIISSLMGMPNLFIYKLMNNSSFCHSSES---------FLRQYLHLTQFLTLYFLPLLIMAVLYCHIGMKLTES 749
            T+ FL N+AFAD  V +FCV   L  Y I+ +VF   G   CR   F+ S+SY AS+ +L+++ +ERY AIV P+   ++++ +   +++  +WI S++   P     K + N       E          F  + L +  F+ LY +PLL+M VLY  I + L  S
Sbjct:  219 TNFFLANLAFADFCVGLFCVMQNLSIYLIESWVF---GEFLCRMYQFVHSLSYTASIFILVVICMERYFAIVHPITCKQILTAARLRMVIVTVWITSAVYSTPKFVFSKTIKNIHTQDGQEEEICVLDREMFNSKLLDMINFVLLYVMPLLVMTVLYSKIAIALWRS 382          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Match: TrissinR (gene:FBgn0085410 transcript:FBtr0112619)

HSP 1 Score: 68.5514 bits (166), Expect = 1.121e-12
Identity = 56/167 (33.53%), Postives = 88/167 (52.69%), Query Frame = 3
Query:  279 THLFLLNMAFADLAVSIFCVNFTLLEY-IKGFVFHQLGLIACRFNFFXXXXXXXXXXXXXXXXXIERYIAIVFPMKVHRLMSKSHQLILLFAIWIISSLMGMPNLFIYKLMNNSSFCHSSES---------FLRQYLHLTQFLTLYFLPLLIMAVLYCHIGMKLTES 749
            T+ FL N+AFAD  V +FCV   L  Y I+ +VF   G   CR   F+ S+SY AS+ +L+++ +ERY AIV P+   ++++ +   +++  +WI S++   P     K + N       E          F  + L +  F+ LY +PLL+M VLY  I + L  S
Sbjct:  219 TNFFLANLAFADFCVGLFCVMQNLSIYLIESWVF---GEFLCRMYQFVHSLSYTASIFILVVICMERYFAIVHPITCKQILTAARLRMVIVTVWITSAVYSTPKFVFSKTIKNIHTQDGQEEEICVLDREMFNSKLLDMINFVLLYVMPLLVMTVLYSKIAIALWRS 382          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Match: SIFaR (gene:FBgn0038880 transcript:FBtr0084098)

HSP 1 Score: 59.6918 bits (143), Expect = 1.118e-9
Identity = 59/185 (31.89%), Postives = 97/185 (52.43%), Query Frame = 3
Query:  243 VILRLKEMRNKYTHLFLLNMAFADLAVSIFCVNFTLLEYIKGFVFHQLGLIACRFNFFXXXXXXXXXXXXXXXXXIERYIAIVFPMKVHRLMSKSHQLILLFAIWIISSLMGMPNLFIYKLMNNSSF-------CHSSESFLRQ-----------YLHLTQFLTLYFLPLLIMAVLYCHIGMKLT 743
            V+LR   MR   T+ F++N+A AD+ V +FC+  TL+  I  FV   LG + C+F  ++Q VS AASV  L+ +S++R+IAI +P+K    M+K    I++  IW+I+ +  +P L  + L+             +S   FL Q           Y  L   +  Y LP+ ++ + Y  I +K++
Sbjct:  232 VVLRAPRMRT-VTNYFIVNLAIADILVIVFCLPATLIGNI--FVPWMLGWLMCKFVPYIQGVSVAASVYSLIAVSLDRFIAIWWPLK---QMTKRRARIMIIGIWVIALVTTIPWLLFFDLVPAEEVFSDALVSAYSQPQFLCQEVWPPGTDGNLYFLLANLVACYLLPMSLITLCYVLIWIKVS 410          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Match: qrfpra (pyroglutamylated RFamide peptide receptor a [Source:ZFIN;Acc:ZDB-GENE-090313-105])

HSP 1 Score: 76.2554 bits (186), Expect = 1.360e-15
Identity = 51/177 (28.81%), Postives = 96/177 (54.24%), Query Frame = 3
Query:  240 FVILRLKEMRNKYTHLFLLNMAFADLAVSIFCVNFTLLEYIKGFVFHQLGLIACRFNFFXXXXXXXXXXXXXXXXXIERYIAIVFPMKVHRLMSKSHQLILLFAIWIISSLMGMPNLFIYKLMNNSSFCHSS-----ESFLRQYLHLTQFLT-----LYFLPLLIMAVLYCHIGMKL 740
            +++LR + ++   T++F+ ++A +DL +S FC+ FTLL+ I    F   G++ C+   F+Q+ +    +L +  +++ERY  IV P+K+ R  +      +L  +WI + ++G P LF+ +L     F + +     +   R   H  ++ T     L+ LPL  M +LY  IG++L
Sbjct:   68 YIVLRKRGIQTA-TNIFICSLAVSDLLISFFCIPFTLLQNISSEWFG--GVLVCKTVPFVQTTAVVTGILTMTCIAVERYQGIVHPLKIKRQCTPQRAYRMLGVVWIAAMMVGSPMLFVQQLEVKYDFLYDNHHVCCQERWRSSAHRKRYATFILVFLFLLPLAAMLILYTRIGIEL 241          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Match: CABZ01084347.1 (pyroglutamylated RFamide peptide receptor b [Source:NCBI gene;Acc:101886159])

HSP 1 Score: 66.6254 bits (161), Expect = 6.217e-12
Identity = 53/188 (28.19%), Postives = 98/188 (52.13%), Query Frame = 3
Query:  240 FVILRLKEMRNKYTHLFLLNMAFADLAVSIFCVNFTLLEYIKGFVFHQLGLIACRFNFFXXXXXXXXXXXXXXXXXIERYIAIVFPMKVHRLMSKSHQLILLFAIWIISSLMGMPNLFIYKL----MNNSSFCHSSESFLRQYLHL---------------TQFL--TLYFLPLLIMAVLYCHIGMKL 740
            +V++R + +R   T++F+ ++A +DL ++ FC+ FTLL+ I        G++ C+   F+Q+ +    +L +  ++IERY  IV+P+K+ R  +      +L  +WI + ++G P LF+ +L    ++ +    S   FL  + H+               T F+   L+ LPL  M  LY  IG++L
Sbjct:   69 YVVVRKRAIRTA-TNIFICSLAVSDLLITFFCIPFTLLQNISSEWLG--GVLVCKTVPFVQTTAIVTGILTMTCIAIERYQGIVYPLKMKRQYTPKRAYRMLGLVWIAAVMVGSPMLFVQQLEVMYISMALQYQSPYDFLYDHHHVCCQERWHSLLQRQLYTTFIMVALFLLPLAAMLFLYSRIGVEL 253          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Match: galr2b (galanin receptor 2b [Source:ZFIN;Acc:ZDB-GENE-131121-48])

HSP 1 Score: 66.2402 bits (160), Expect = 7.016e-12
Identity = 51/163 (31.29%), Postives = 89/163 (54.60%), Query Frame = 3
Query:  243 VILRLKEMRNKYTHLFLLNMAFADLAVSIFCVNFTLLEY-IKGFVFHQLGLIACRFNFFXXXXXXXXXXXXXXXXXIERYIAIVFPMKVHRLMSKSHQLILLFAIWIISSLMGMPNLFIYKLMN--NSSFCHSS-ESFLRQYLHLTQFLTLYFLPLLIMAVLY 719
            V+LR  ++    T+LF+LN++ AD    IFCV F    Y ++G+VF   G   C+   F  +++  AS   L  +S++RY+AI +P++   L +  + ++ +  IW +S +   P L  Y L++  NS+ C    E   R+ L    F+  Y +P+LI+++ Y
Sbjct:   50 VLLRSGQVGYNTTNLFILNLSVADFFFIIFCVPFQATIYSLEGWVF---GSFMCKVVHFFINLTMYASSFTLAAVSVDRYLAIRYPLRSRELRTPCNAVVAMVVIWGLSLVFAGPYLSYYDLIDFENSNVCVPGWEEHNRKVLDTCTFVFGYVIPVLIVSLSY 209          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Match: galr2b (galanin receptor 2b [Source:ZFIN;Acc:ZDB-GENE-131121-48])

HSP 1 Score: 66.2402 bits (160), Expect = 7.016e-12
Identity = 51/163 (31.29%), Postives = 89/163 (54.60%), Query Frame = 3
Query:  243 VILRLKEMRNKYTHLFLLNMAFADLAVSIFCVNFTLLEY-IKGFVFHQLGLIACRFNFFXXXXXXXXXXXXXXXXXIERYIAIVFPMKVHRLMSKSHQLILLFAIWIISSLMGMPNLFIYKLMN--NSSFCHSS-ESFLRQYLHLTQFLTLYFLPLLIMAVLY 719
            V+LR  ++    T+LF+LN++ AD    IFCV F    Y ++G+VF   G   C+   F  +++  AS   L  +S++RY+AI +P++   L +  + ++ +  IW +S +   P L  Y L++  NS+ C    E   R+ L    F+  Y +P+LI+++ Y
Sbjct:   50 VLLRSGQVGYNTTNLFILNLSVADFFFIIFCVPFQATIYSLEGWVF---GSFMCKVVHFFINLTMYASSFTLAAVSVDRYLAIRYPLRSRELRTPCNAVVAMVVIWGLSLVFAGPYLSYYDLIDFENSNVCVPGWEEHNRKVLDTCTFVFGYVIPVLIVSLSY 209          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Match: CCKAR (cholecystokinin A receptor [Source:NCBI gene;Acc:569038])

HSP 1 Score: 65.4698 bits (158), Expect = 1.298e-11
Identity = 58/175 (33.14%), Postives = 96/175 (54.86%), Query Frame = 3
Query:  243 VILRLKEMRNKYTHLFLLNMAFADLAVSIFCVNFTLL-EYIKGFVFHQLGLIACRFNFFXXXXXXXXXXXXXXXXXIERYIAIVFPMKVHRLMSKSHQLILLFAIWIISSLMGMP-----NLFIYKLMNNSS--FCH-SSESFLRQYLHLTQFLTLYFLPLLIMAVLYCHIGMKL 740
            V+LR + MR   T+LFLL++A +DL + +FC+ FTL+   +K F+F   G   C+   +   +S + S L L+ +S+ERY AI  P+K     +KSH + ++ A W++S L+ +P      L  +   NNS+   C     S + Q  ++   LTL+ +P +IM   Y    ++L
Sbjct:   71 VLLRNRRMRT-VTNLFLLSLAVSDLMLCVFCMPFTLIPNLMKDFIF---GSGMCKVATYFMGISVSVSTLNLVAISLERYSAICNPLKSRAWQTKSHAVKVISATWVVSFLLMLPYPIGSTLVPFIRSNNSTGNMCRLVWPSDVMQTWYIFLLLTLFLVPGIIMMTAYGLTSLEL 241          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000041298.1 (galanin receptor 3 [Source:NCBI gene;Acc:100488248])

HSP 1 Score: 63.929 bits (154), Expect = 5.323e-11
Identity = 52/165 (31.52%), Postives = 83/165 (50.30%), Query Frame = 3
Query:  243 VILRLKEMRNKYTHLFLLNMAFADLAVSIFCVNFTLLEY-IKGFVFHQLGLIACRFNFFXXXXXXXXXXXXXXXXXIERYIAIVFPMKVHRLMSKSHQLILLFAIWIISSLMGMPNLFIYK--LMNNSSFC-HSSESFLRQYLHLTQFLTLYFLPLLIMAVLYCH 725
            V+LR  + +   T+LF+LN+  ADL   + CV F    Y + G++F   G   C+   F   +S  AS   L  +S++RY+AI +P+K   L +  + L  +  IW +S L   P L  Y   L N    C  + E   R+ + ++ F+  Y LP+LI+ + Y  
Sbjct:   41 VLLRNGQTKYNTTNLFILNLGVADLCFILLCVPFQATIYTLDGWLF---GAFLCKAVHFSIYLSMYASSFTLAAVSVDRYLAIRYPLKSRDLRTSRNALAAIGVIWALSILFAGPYLSYYHIILYNQVPICIPNWEDRRRKIMDVSTFVFGYLLPVLILGLSYAR 202          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Xenopus
Match: sp3 (Sp3 transcription factor [Source:Xenbase;Acc:XB-GENE-977158])

HSP 1 Score: 63.5438 bits (153), Expect = 6.629e-11
Identity = 48/163 (29.45%), Postives = 87/163 (53.37%), Query Frame = 3
Query:  243 VILRLKEMRNKYTHLFLLNMAFADLAVSIFCVNFTLLEY-IKGFVFHQLGLIACRFNFFXXXXXXXXXXXXXXXXXIERYIAIVFPMKVHRLMSKSHQLILLFAIWIISSLMGMPNLFIYKLMN--NSSFCHSS-ESFLRQYLHLTQFLTLYFLPLLIMAVLY 719
            V+LR  +  +  T+LF+LN++ AD++  IFCV F    Y ++ +VF   G   C+   F   ++  AS   L  +S++RY+AI +P++   L +  + +  +  IW +S +   P L  Y LM+  +S  C    +   R+ +    F+  Y +P+LI+++ Y
Sbjct:   73 VLLRSGQRTHNTTNLFILNLSVADVSFIIFCVPFQATIYSLEDWVF---GAFMCKAVHFFIYLTMYASSFTLAAVSVDRYLAIRYPLRSRELRTPCNAIATMAIIWGLSVVFAGPYLSYYDLMDYESSHICMPGWKERTRKIMDTGTFIVGYVIPVLIVSLSY 232          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Xenopus
Match: sp3 (Sp3 transcription factor [Source:Xenbase;Acc:XB-GENE-977158])

HSP 1 Score: 63.5438 bits (153), Expect = 7.817e-11
Identity = 48/163 (29.45%), Postives = 87/163 (53.37%), Query Frame = 3
Query:  243 VILRLKEMRNKYTHLFLLNMAFADLAVSIFCVNFTLLEY-IKGFVFHQLGLIACRFNFFXXXXXXXXXXXXXXXXXIERYIAIVFPMKVHRLMSKSHQLILLFAIWIISSLMGMPNLFIYKLMN--NSSFCHSS-ESFLRQYLHLTQFLTLYFLPLLIMAVLY 719
            V+LR  +  +  T+LF+LN++ AD++  IFCV F    Y ++ +VF   G   C+   F   ++  AS   L  +S++RY+AI +P++   L +  + +  +  IW +S +   P L  Y LM+  +S  C    +   R+ +    F+  Y +P+LI+++ Y
Sbjct:   50 VLLRSGQRTHNTTNLFILNLSVADVSFIIFCVPFQATIYSLEDWVF---GAFMCKAVHFFIYLTMYASSFTLAAVSVDRYLAIRYPLRSRELRTPCNAIATMAIIWGLSVVFAGPYLSYYDLMDYESSHICMPGWKERTRKIMDTGTFIVGYVIPVLIVSLSY 209          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Xenopus
Match: c16orf87 (chromosome 16 open reading frame 87 [Source:Xenbase;Acc:XB-GENE-998359])

HSP 1 Score: 63.5438 bits (153), Expect = 8.719e-11
Identity = 71/252 (28.17%), Postives = 124/252 (49.21%), Query Frame = 3
Query:   30 NVSIDQISALCRAVHENCPSCIEKCILDAYKTPEESTDLRSDIHNIIERWMTITFPXXXXXXXXXXXXXXFVILRLKEMRNKYTHLFLLNMAFADLAVSIF--CVNFTLLEYIKGFVFHQ---LGLIACRFNFFXXXXXXXXXXXXXXXXXIERYIAIVFPMKVHRLMSKSHQLILLFAIWIISSLMGMPNLFIYKLMNNSS----FCHSSESFLRQYLHLTQ---FLTLYFLPLLIMAVLYCHIGMKLTES 749
            N+S+ Q S++C +   N     E CI++ +  P     L S  ++II            I+ ++GN +V+++IL  K MR   T+ FL+N+AFA+ ++S F   +NFT       +  H     GLI C+F+ F    +  +S+  +  ++++RY+AI+ P+K    +S +   I++  IW  +  +  P  +   +         +    ES  R++  + Q   F  +YFLPLL++   Y  IGM L  S
Sbjct:    2 NISM-QNSSICNSTGGN-----ETCIVNPFLQPAWQIALWSIAYSII-----------VIVSVVGNIIVMWIILAHKRMRT-VTNYFLVNLAFAEASMSAFNTVINFT-------YAIHNHWYYGLIYCKFHNFFPISAVFSSIYSMTAIALDRYMAIIHPLKPR--LSATATRIVIAVIWGFAFALAFPQGYFATVEPTPDRVVCYMEWPESENRKFEKVYQVLLFGLIYFLPLLVIGCSYTFIGMTLWAS 226          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Xenopus
Match: c16orf87 (chromosome 16 open reading frame 87 [Source:Xenbase;Acc:XB-GENE-998359])

HSP 1 Score: 63.1586 bits (152), Expect = 9.660e-11
Identity = 71/252 (28.17%), Postives = 124/252 (49.21%), Query Frame = 3
Query:   30 NVSIDQISALCRAVHENCPSCIEKCILDAYKTPEESTDLRSDIHNIIERWMTITFPXXXXXXXXXXXXXXFVILRLKEMRNKYTHLFLLNMAFADLAVSIF--CVNFTLLEYIKGFVFHQ---LGLIACRFNFFXXXXXXXXXXXXXXXXXIERYIAIVFPMKVHRLMSKSHQLILLFAIWIISSLMGMPNLFIYKLMNNSS----FCHSSESFLRQYLHLTQ---FLTLYFLPLLIMAVLYCHIGMKLTES 749
            N+S+ Q S++C +   N     E CI++ +  P     L S  ++II            I+ ++GN +V+++IL  K MR   T+ FL+N+AFA+ ++S F   +NFT       +  H     GLI C+F+ F    +  +S+  +  ++++RY+AI+ P+K    +S +   I++  IW  +  +  P  +   +         +    ES  R++  + Q   F  +YFLPLL++   Y  IGM L  S
Sbjct:    2 NISM-QNSSICNSTGGN-----ETCIVNPFLQPAWQIALWSIAYSII-----------VIVSVVGNIIVMWIILAHKRMRT-VTNYFLVNLAFAEASMSAFNTVINFT-------YAIHNHWYYGLIYCKFHNFFPISAVFSSIYSMTAIALDRYMAIIHPLKPR--LSATATRIVIAVIWGFAFALAFPQGYFATVEPTPDRVVCYMEWPESENRKFEKVYQVLLFGLIYFLPLLVIGCSYTFIGMTLWAS 226          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Mouse
Match: Nmur1 (neuromedin U receptor 1 [Source:MGI Symbol;Acc:MGI:1341898])

HSP 1 Score: 68.1662 bits (165), Expect = 1.571e-12
Identity = 56/175 (32.00%), Postives = 95/175 (54.29%), Query Frame = 3
Query:  243 VILRLKEMRNKYTHLFLLNMAFADLAVSIFCVNFTLLEYIKGFVFHQLGLIACRFNFFXXXXXXXXXXXXXXXXXIERYIAIVFPMKVHRLMSKSHQLILLFAIWIISSLMGMPNLFIYKL----------MNNSSFCH--SSESFLRQYLHLTQFLTLYFLPLLIMAVLYCHIG 731
            VILR K MR   T+ +L ++A +D+ V +  +   L E  + + F QLG  AC F   L      ASVL +  LS+ERY+A+V P++   +M+++H   ++ AIW++++L  +PN  ++ L          + +S+ C       F +  + LT  L  + LP++ ++VLY  IG
Sbjct:   84 VILRNKTMRTP-TNFYLFSLAVSDMLVLLVGLPLELYEMQQNYPF-QLGASACYFRILLLETVCLASVLNVTALSVERYVAVVRPLQAKSVMTRAHVRRMVGAIWVLATLFSLPNTSLHGLSQLTVPCRGPVPDSAICSLVGPMDFYKLVV-LTTALLFFCLPMVTISVLYLLIG 255          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Mouse
Match: Nmur1 (neuromedin U receptor 1 [Source:MGI Symbol;Acc:MGI:1341898])

HSP 1 Score: 68.1662 bits (165), Expect = 1.616e-12
Identity = 56/175 (32.00%), Postives = 95/175 (54.29%), Query Frame = 3
Query:  243 VILRLKEMRNKYTHLFLLNMAFADLAVSIFCVNFTLLEYIKGFVFHQLGLIACRFNFFXXXXXXXXXXXXXXXXXIERYIAIVFPMKVHRLMSKSHQLILLFAIWIISSLMGMPNLFIYKL----------MNNSSFCH--SSESFLRQYLHLTQFLTLYFLPLLIMAVLYCHIG 731
            VILR K MR   T+ +L ++A +D+ V +  +   L E  + + F QLG  AC F   L      ASVL +  LS+ERY+A+V P++   +M+++H   ++ AIW++++L  +PN  ++ L          + +S+ C       F +  + LT  L  + LP++ ++VLY  IG
Sbjct:   61 VILRNKTMRTP-TNFYLFSLAVSDMLVLLVGLPLELYEMQQNYPF-QLGASACYFRILLLETVCLASVLNVTALSVERYVAVVRPLQAKSVMTRAHVRRMVGAIWVLATLFSLPNTSLHGLSQLTVPCRGPVPDSAICSLVGPMDFYKLVV-LTTALLFFCLPMVTISVLYLLIG 232          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Mouse
Match: Nmur1 (neuromedin U receptor 1 [Source:MGI Symbol;Acc:MGI:1341898])

HSP 1 Score: 67.781 bits (164), Expect = 1.977e-12
Identity = 56/175 (32.00%), Postives = 95/175 (54.29%), Query Frame = 3
Query:  243 VILRLKEMRNKYTHLFLLNMAFADLAVSIFCVNFTLLEYIKGFVFHQLGLIACRFNFFXXXXXXXXXXXXXXXXXIERYIAIVFPMKVHRLMSKSHQLILLFAIWIISSLMGMPNLFIYKL----------MNNSSFCH--SSESFLRQYLHLTQFLTLYFLPLLIMAVLYCHIG 731
            VILR K MR   T+ +L ++A +D+ V +  +   L E  + + F QLG  AC F   L      ASVL +  LS+ERY+A+V P++   +M+++H   ++ AIW++++L  +PN  ++ L          + +S+ C       F +  + LT  L  + LP++ ++VLY  IG
Sbjct:   28 VILRNKTMRTP-TNFYLFSLAVSDMLVLLVGLPLELYEMQQNYPF-QLGASACYFRILLLETVCLASVLNVTALSVERYVAVVRPLQAKSVMTRAHVRRMVGAIWVLATLFSLPNTSLHGLSQLTVPCRGPVPDSAICSLVGPMDFYKLVV-LTTALLFFCLPMVTISVLYLLIG 199          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Mouse
Match: Tacr3 (tachykinin receptor 3 [Source:MGI Symbol;Acc:MGI:892968])

HSP 1 Score: 63.1586 bits (152), Expect = 8.020e-11
Identity = 56/187 (29.95%), Postives = 96/187 (51.34%), Query Frame = 3
Query:  240 FVILRLKEMRNKYTHLFLLNMAFADLAVSIFCVNFTLLEYIKGFVFHQ---LGLIACRFNFFXXXXXXXXXXXXXXXXXIERYIAIVFPMKVHRLMSKSHQLILLFAIWIISSLMGMPNLFIYKL--MNNSSFCHSS-ESFLRQYL--HLTQFLTLYFLPLLIMAVLYCHIGMKLTES---CNCCDQ 767
            ++IL  K MR   T+ FL+N+AF+D +V+ F    TL+ +I G   H     G   CRF  F    +  AS+  +  ++++RY+AI+ P+K    +S +   I++ +IWI++ L+  P     K+  M   + C+       +Q+   H+   + +Y  PLLIM V Y  +G+ L       + CD+
Sbjct:   95 WIILAHKRMRT-VTNYFLVNLAFSDASVAAFN---TLVNFIYG--VHSEWYFGANYCRFQNFFPITAVFASIYSMTAIAVDRYMAIIDPLKPR--LSATATKIVIGSIWILAFLLAFPQCLYSKIKVMPGRTLCYVQWPEGPKQHFTYHIIVIILVYCFPLLIMGVTYTIVGITLWGGEIPGDTCDK 273          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Mouse
Match: Tacr1 (tachykinin receptor 1 [Source:MGI Symbol;Acc:MGI:98475])

HSP 1 Score: 62.3882 bits (150), Expect = 1.541e-10
Identity = 51/183 (27.87%), Postives = 96/183 (52.46%), Query Frame = 3
Query:  240 FVILRLKEMRNKYTHLFLLNMAFADLAVSIF--CVNFTLLEYIKGFVFHQL---GLIACRFNFFXXXXXXXXXXXXXXXXXIERYIAIVFPMKVHRLMSKSHQLILLFAIWIISSLMGMPNLF--IYKLMNNSSFC------HSSESFLRQYLHLTQFLTLYFLPLLIMAVLYCHIGMKLTES 749
            ++IL  K MR   T+ FL+N+AFA+  ++ F   VNFT       +  H +   GL  C+F+ F    +  AS+  +  ++ +RY+AI+ P++    +S +   +++F IW+++ L+  P  +    + M +   C      H + ++ + Y H+   + +YFLPLL++   Y  +G+ L  S
Sbjct:   55 WIILAHKRMRT-VTNYFLVNLAFAEACMAAFNTVVNFT-------YAVHNVWYYGLFYCKFHNFFPIAALFASIYSMTAVAFDRYMAIIHPLQPR--LSATATKVVIFVIWVLALLLAFPQGYYSTTETMPSRVVCMIEWPEHPNRTYEKAY-HICVTVLIYFLPLLVIGYAYTVVGITLWAS 226          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Match: sp|O55040|NMUR1_MOUSE (Neuromedin-U receptor 1 OS=Mus musculus OX=10090 GN=Nmur1 PE=2 SV=2)

HSP 1 Score: 68.1662 bits (165), Expect = 1.099e-11
Identity = 56/175 (32.00%), Postives = 95/175 (54.29%), Query Frame = 3
Query:  243 VILRLKEMRNKYTHLFLLNMAFADLAVSIFCVNFTLLEYIKGFVFHQLGLIACRFNFFXXXXXXXXXXXXXXXXXIERYIAIVFPMKVHRLMSKSHQLILLFAIWIISSLMGMPNLFIYKL----------MNNSSFCH--SSESFLRQYLHLTQFLTLYFLPLLIMAVLYCHIG 731
            VILR K MR   T+ +L ++A +D+ V +  +   L E  + + F QLG  AC F   L      ASVL +  LS+ERY+A+V P++   +M+++H   ++ AIW++++L  +PN  ++ L          + +S+ C       F +  + LT  L  + LP++ ++VLY  IG
Sbjct:   84 VILRNKTMRTP-TNFYLFSLAVSDMLVLLVGLPLELYEMQQNYPF-QLGASACYFRILLLETVCLASVLNVTALSVERYVAVVRPLQAKSVMTRAHVRRMVGAIWVLATLFSLPNTSLHGLSQLTVPCRGPVPDSAICSLVGPMDFYKLVV-LTTALLFFCLPMVTISVLYLLIG 255          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9VML9|TRISR_DROME (Trissin receptor OS=Drosophila melanogaster OX=7227 GN=TrissinR PE=2 SV=4)

HSP 1 Score: 68.5514 bits (166), Expect = 1.124e-11
Identity = 56/167 (33.53%), Postives = 88/167 (52.69%), Query Frame = 3
Query:  279 THLFLLNMAFADLAVSIFCVNFTLLEY-IKGFVFHQLGLIACRFNFFXXXXXXXXXXXXXXXXXIERYIAIVFPMKVHRLMSKSHQLILLFAIWIISSLMGMPNLFIYKLMNNSSFCHSSES---------FLRQYLHLTQFLTLYFLPLLIMAVLYCHIGMKLTES 749
            T+ FL N+AFAD  V +FCV   L  Y I+ +VF   G   CR   F+ S+SY AS+ +L+++ +ERY AIV P+   ++++ +   +++  +WI S++   P     K + N       E          F  + L +  F+ LY +PLL+M VLY  I + L  S
Sbjct:  219 TNFFLANLAFADFCVGLFCVMQNLSIYLIESWVF---GEFLCRMYQFVHSLSYTASIFILVVICMERYFAIVHPITCKQILTAARLRMVIVTVWITSAVYSTPKFVFSKTIKNIHTQDGQEEEICVLDREMFNSKLLDMINFVLLYVMPLLVMTVLYSKIAIALWRS 382          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Match: sp|E7F7V7|GAL2B_DANRE (Galanin receptor 2b OS=Danio rerio OX=7955 GN=galr2b PE=2 SV=1)

HSP 1 Score: 66.2402 bits (160), Expect = 5.296e-11
Identity = 51/163 (31.29%), Postives = 89/163 (54.60%), Query Frame = 3
Query:  243 VILRLKEMRNKYTHLFLLNMAFADLAVSIFCVNFTLLEY-IKGFVFHQLGLIACRFNFFXXXXXXXXXXXXXXXXXIERYIAIVFPMKVHRLMSKSHQLILLFAIWIISSLMGMPNLFIYKLMN--NSSFCHSS-ESFLRQYLHLTQFLTLYFLPLLIMAVLY 719
            V+LR  ++    T+LF+LN++ AD    IFCV F    Y ++G+VF   G   C+   F  +++  AS   L  +S++RY+AI +P++   L +  + ++ +  IW +S +   P L  Y L++  NS+ C    E   R+ L    F+  Y +P+LI+++ Y
Sbjct:   50 VLLRSGQVGYNTTNLFILNLSVADFFFIIFCVPFQATIYSLEGWVF---GSFMCKVVHFFINLTMYASSFTLAAVSVDRYLAIRYPLRSRELRTPCNAVVAMVVIWGLSLVFAGPYLSYYDLIDFENSNVCVPGWEEHNRKVLDTCTFVFGYVIPVLIVSLSY 209          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Match: sp|P30552|GASR_CANLF (Gastrin/cholecystokinin type B receptor OS=Canis lupus familiaris OX=9615 GN=CCKBR PE=2 SV=1)

HSP 1 Score: 64.6994 bits (156), Expect = 1.782e-10
Identity = 52/174 (29.89%), Postives = 93/174 (53.45%), Query Frame = 3
Query:  243 VILRLKEMRNKYTHLFLLNMAFADLAVSIFCVNFTLLEYIKG-FVFHQLGLIACRFNFFXXXXXXXXXXXXXXXXXIERYIAIVFPMKVHRLMSKSHQLILLFAIWIISSLMGMPNLFIYKLMNNSSFCHS-------SESFLRQYLHLTQFLTLYFLPLLIMAVLYCHIGMKL 740
            V+L L       T+ FLL++A +DL +++ C+ FTLL  + G F+F   G + C+   +L  VS + S L L+ +++ERY AI  P++     ++SH   ++ A W++S L+ +P   +Y  +  +    +         + +RQ   +   L L+F+P ++MAV Y  I  +L
Sbjct:   77 VVLGLSRRLRTVTNAFLLSLAVSDLLLAVACMPFTLLPNLMGTFIF---GTVVCKAVSYLMGVSVSVSTLSLVAIALERYSAICRPLQARVWQTRSHAARVIIATWMLSGLLMVP-YPVYTAVQPAGGARALQCVHRWPSARVRQTWSVLLLLLLFFVPGVVMAVAYGLISREL 246          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Match: sp|A0A287A2K5|GASR_PIG (Gastrin/cholecystokinin type B receptor OS=Sus scrofa OX=9823 GN=CCKBR PE=3 SV=1)

HSP 1 Score: 64.6994 bits (156), Expect = 1.933e-10
Identity = 52/189 (27.51%), Postives = 97/189 (51.32%), Query Frame = 3
Query:  243 VILRLKEMRNKYTHLFLLNMAFADLAVSIFCVNFTLLEYIKG-FVFHQLGLIACRFNFFXXXXXXXXXXXXXXXXXIERYIAIVFPMKVHRLMSKSHQLILLFAIWIISSLMGMPNLFIYKLMNNSS------FCHSSESFLRQYLHLTQFLTLYFLPLLIMAVLYC------HIGMKLTESCNCCDQT 770
            V+L L       T+ FLL++A +DL +++ C+ FTLL  + G F+F   G + C+   +   VS + S L L+ +++ERY AI  P++     ++SH   ++ A W++S L+ +P   +Y  +  +             + +RQ   +   L L+F+P ++MAV Y       ++G++     +C  Q+
Sbjct:   75 VVLGLSRRLRTVTNAFLLSLAVSDLLLAVACMPFTLLPNLMGTFIF---GTVVCKAVSYFMGVSVSVSTLSLVAIALERYSAICRPLQARVWQTRSHAARVIVATWMLSGLLMVP-YPVYTAVQPAGPRVLQCMHRWPSARIRQTWSVLLLLLLFFVPGVVMAVAYGLISRELYLGLRFDGDSDCESQS 259          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A193KU80 (GCR041 OS=Schmidtea mediterranea OX=79327 GN=gcr041 PE=2 SV=1)

HSP 1 Score: 145.206 bits (365), Expect = 8.046e-37
Identity = 96/240 (40.00%), Postives = 155/240 (64.58%), Query Frame = 3
Query:   57 LCRAVHENCPSCIEKCILDAYKTPEESTDLRSD-------IHNIIERWMTITFPXXXXXXXXXXXXXXFVILRLKEMRNKYTHLFLLNMAFADLAVSIFCVNFTLLEYIKGFVFHQLGLIACRFNFFXXXXXXXXXXXXXXXXXIERYIAIVFPMKVHRLMSKSHQLILLFAIWIISSLMGMPNLFIYKL--MNNSSFCHSSESFLRQYLHLTQFLTLYFLPLLIMAVLYCHIGMKLTES 749
            LC+++++ C  CIE C+  + K      +++ +       + N +  ++ I FPI+SI+G I N L+IFV+LRL  +R  YT+ FL+NMA ADL V I+CVN T +EY+   +F  +G   C+ N FLQ +SY AS+LLL+++ +ERYIAI+FPMKV  ++SK   ++LL  IW++S    +P+LF Y+L  ++N + C  +E   ++  +++ F+ LY +PL++M  LY HI + L +S
Sbjct:    8 LCKSIYKECTYCIEICLNASLKDTNTPNNMKHETEGSFNCVKNNVNLFIKIFFPIISIVGCIANILIIFVVLRLPSLRRSYTNFFLVNMALADLGVVIWCVNLTTIEYVDAELFWIVGPALCKMNHFLQIMSYTASILLLMLICLERYIAIIFPMKVKNMLSKRIYIVLLIFIWLLSIGFSLPSLFEYELRRIHNVTRCEKTEKISKKTYYISSFVLLYIIPLVLMGSLYGHICLSLVKS 247          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A3P8T4P8 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Amphiprion percula OX=161767 PE=3 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 1.162e-14
Identity = 57/168 (33.93%), Postives = 92/168 (54.76%), Query Frame = 3
Query:  246 ILRLKEMRNKYTHLFLLNMAFADLAVSIFCVNFTLLEYIKGFVFHQLGLIACRFNFFXXXXXXXXXXXXXXXXXIERYIAIVFPMKVHRLMSKSHQLILLFAIWIISSLMGMPNLFIYKLMNNSSFCHSSESFLRQYLHL-TQFL--TLYFLPLLIMAVLYCHIGMKL 740
            I+  K      T +F+ ++A +DL ++ FC+ FTLL+ I    F   G++ C+   F+Q+ +    +L +  ++IERY  IVFP+K+ R  S      +L  +WI S ++G P LF+ +L   S  C  +  FL  + H+ T F+   L+ LPL  M  LY  IG++L
Sbjct:   79 IITKKRAIQTATDIFICSLAVSDLLITFFCIPFTLLQNISSEWFG--GVLVCKTVPFVQTTAIVTGILTMTCIAIERYQGIVFPLKMRRQYSSQRAFKMLGIVWIASVIVGSPMLFVQQLKVTSFSCDCTYDFLYDHYHVYTTFIMVALFLLPLAAMLFLYTRIGIEL 244          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: W4YRA6 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Strongylocentrotus purpuratus OX=7668 PE=3 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 5.138e-14
Identity = 66/173 (38.15%), Postives = 102/173 (58.96%), Query Frame = 3
Query:  240 FVILRLKEMRNKYTHLFLLNMAFADLAVSIFCVNFTLLEYIKGFVFHQLGLIACRFNFFXXXXXXXXXXXXXXXXXIERYIAIVFPMKVHRLMSKSHQLILLFAIWIISSLMGMPNLFIYKLM--NNSSFCHS---SESFLRQYLHLTQFLT-LYFLPLLIMAVLYCHIGMKL 740
            FVI R K M +  T+ FL N+AFADL V++FCV   LL Y+       LGL+ CR + ++ S +  AS+L+L ++S+ERYIAI+ P++  R+++     I +  +W++S+++ +P    Y L+   ++ +C     SE   R  +H   F    Y +PLLIMAVLY  I  KL
Sbjct:   92 FVIARNKSM-HTVTNFFLANLAFADLLVAVFCVIPQLLWYV--LESWPLGLLICRLHKYMTSAATTASILILTVISVERYIAILHPLETRRVLTSRRLTITVMLVWMLSAVVNIPVALFYNLLHYGDNKYCTPSTLSEGVAR--VHSILFCVFFYTIPLLIMAVLYGIISRKL 259          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: V3ZZR6 (G_PROTEIN_RECEP_F1_2 domain-containing protein (Fragment) OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_62390 PE=3 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 2.850e-13
Identity = 63/185 (34.05%), Postives = 102/185 (55.14%), Query Frame = 3
Query:  240 FVILRLKEMRNKYTHLFLLNMAFADLAVSIFCVNFTLLEYI--KGFVFHQLGLIACRFNFFXXXXXXXXXXXXXXXXXIERYIAIVFPMKVHRLMSKSHQLILLFAIWIISSLMGMPNLFIYKLM-----NNSSFCHSSESFLRQYLHLTQFLT--------LYFLPLLIMAVLYCHIGMKLTES 749
            FVIL  ++MR   T++F++N+A AD  +  F +   L+++I  +G++   LG   CRFN F   VS  ASV+ L+ + IER++AIVFP+K H L ++   + ++  IW  +   G+P +   +++     +  + C      +  Y HL+ FL+         YFLP+L   +LYC IG KL  S
Sbjct:   12 FVILIDRKMRKSVTNIFIMNLAIADFLIMTFGIP-ELVQFILNRGWL---LGEGLCRFNRFTLVVSLYASVMSLVSVCIERFVAIVFPIKAHILCTRKKIICIIMLIWPAAVFCGLPTVLFNRVIPLRPGHEIALCQ----LIFPYNHLSVFLSFKYVESGIFYFLPILTQVILYCVIGRKLYAS 188          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A3Q2DKF3 (Pyroglutamylated RFamide peptide receptor OS=Cyprinodon variegatus OX=28743 GN=QRFPR PE=3 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 3.299e-13
Identity = 56/177 (31.64%), Postives = 95/177 (53.67%), Query Frame = 3
Query:  240 FVILRLKEMRNKYTHLFLLNMAFADLAVSIFCVNFTLLEYIKGFVFHQLGLIACRFNFFXXXXXXXXXXXXXXXXXIERYIAIVFPMKVHRLMSKSHQLILLFAIWIISSLMGMPNLFIYKLMNNSSF--------CHSSESFLRQYLHLTQFL--TLYFLPLLIMAVLYCHIGMKL 740
            +++L+ + ++   T +F+ ++AF+DL ++ FC+ FTLL+ I    F   G++ C+   F+Q+ +    +L +  ++IERY  IVFP+K+ R  S      +L  +WI S ++G P LF+ +L+    F        C  S S L      T F+   L+ LPL  M  LY  I ++L
Sbjct:   77 YIVLKKRAIQTA-TDIFICSLAFSDLLITFFCIPFTLLQNISSEWFG--GVLVCKTVPFVQTTAIVTGILTMTCIAIERYQGIVFPLKMRRQYSSKRAYKILGLVWIASVIVGSPMLFVQQLIEGYDFLYDHYHVCCQESWSSLTYRQAYTTFIMVALFLLPLAAMLFLYTRIAIEL 250          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Match: galr2b (galanin receptor type 2-like [Source:NCBI gene;Acc:103040671])

HSP 1 Score: 65.855 bits (159), Expect = 7.293e-12
Identity = 51/163 (31.29%), Postives = 89/163 (54.60%), Query Frame = 3
Query:  243 VILRLKEMRNKYTHLFLLNMAFADLAVSIFCVNFTLLEY-IKGFVFHQLGLIACRFNFFXXXXXXXXXXXXXXXXXIERYIAIVFPMKVHRLMSKSHQLILLFAIWIISSLMGMPNLFIYKLMN--NSSFCHSS-ESFLRQYLHLTQFLTLYFLPLLIMAVLY 719
            V+LR  ++    T+LF+LN++ AD    IFCV F    Y ++G+VF   G   C+   F  +++  AS   L  +S++RY+AI +P++   L +  + ++ +  IW +S +   P L  Y L++  NS+ C    E   R+ L    F+  Y +P+LI+++ Y
Sbjct:   50 VLLRSGQVGYNTTNLFILNLSVADFFFIIFCVPFQATIYSLEGWVF---GSFMCKVVHFFINLTMYASSFTLAAVSVDRYLAIRYPLRSRELRTPCNAVVAMVIIWGLSLIFAGPYLSYYDLIDFENSNVCVPGWEEHNRKVLDTCTFVFGYVIPVLIVSLSY 209          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Match: galr2a (galanin receptor type 2 [Source:NCBI gene;Acc:103028491])

HSP 1 Score: 64.3142 bits (155), Expect = 2.330e-11
Identity = 45/167 (26.95%), Postives = 88/167 (52.69%), Query Frame = 3
Query:  243 VILRLKEMRNKYTHLFLLNMAFADLAVSIFCVN-----FTLLEYIKGFVFHQLGLIACRFNFFXXXXXXXXXXXXXXXXXIERYIAIVFPMKVHRLMSKSHQLILLFAIWIISSLMGMPNLFIYKLM--NNSSFCHSSESF-LRQYLHLTQFLTLYFLPLLIMAVLY 719
            V+LR      K T +F++N+  ADL   + CV      +TL E+       + G +ACR   F   ++  AS L L  +S++RY+AI +P++   + +  + LI +  +W +S ++  P L  Y+ M  + ++ C  +  +  R+ + +  F+  Y +P+L++++ Y
Sbjct:   41 VVLRGGRASAKITSVFIVNLCAADLGFIVLCVPVQAAVYTLPEW-------RFGSLACRTAHFAVYLTMHASALTLTAVSLDRYLAIRYPLRAREMRTPRNALICIGVVWAVSLVLSSPYLSYYQQMDLDGTTVCIPAWDYQQRRAMDVCTFVFGYLIPVLVLSLTY 200          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Match: QRFPR (pyroglutamylated RFamide peptide receptor-like [Source:NCBI gene;Acc:103023541])

HSP 1 Score: 63.5438 bits (153), Expect = 4.586e-11
Identity = 48/175 (27.43%), Postives = 87/175 (49.71%), Query Frame = 3
Query:  246 ILRLKEMRNKYTHLFLLNMAFADLAVSIFCVNFTLLEYIKGFVFHQLGLIACRFNFFXXXXXXXXXXXXXXXXXIERYIAIVFPMKVHRLMSKSHQLILLFAIWIISSLMGMPNLFIYKLMNNSSFCHS-----SESFLRQYLHLTQFLT-----LYFLPLLIMAVLYCHIGMKL 740
            +L  +    + + LF+ ++A +DL ++ FCV FTLL+ I        G++ C+   F+Q+ +    +L +  +++ERY  IV P+K+ R  +      +L  +W++S ++G P LF+ +L     F +       +      LH   + T     L+ LPL  M  LY  I ++L
Sbjct:  134 VLAREGAARRASSLFMCSLALSDLLITFFCVPFTLLQNISSQ--WSGGVLVCKTVPFVQTTAIVTGILTMTCIAVERYQGIVHPLKMKRQYTPKRAYKMLGLVWVVSIMVGSPMLFVQQLEVKYDFLYEHHHVCCQELWGSELHRKIYTTFIMVALFLLPLAAMLFLYTRISIEL 306          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Match: QRFPR (pyroglutamylated RFamide peptide receptor-like [Source:NCBI gene;Acc:103023541])

HSP 1 Score: 63.5438 bits (153), Expect = 4.586e-11
Identity = 48/175 (27.43%), Postives = 87/175 (49.71%), Query Frame = 3
Query:  246 ILRLKEMRNKYTHLFLLNMAFADLAVSIFCVNFTLLEYIKGFVFHQLGLIACRFNFFXXXXXXXXXXXXXXXXXIERYIAIVFPMKVHRLMSKSHQLILLFAIWIISSLMGMPNLFIYKLMNNSSFCHS-----SESFLRQYLHLTQFLT-----LYFLPLLIMAVLYCHIGMKL 740
            +L  +    + + LF+ ++A +DL ++ FCV FTLL+ I        G++ C+   F+Q+ +    +L +  +++ERY  IV P+K+ R  +      +L  +W++S ++G P LF+ +L     F +       +      LH   + T     L+ LPL  M  LY  I ++L
Sbjct:  134 VLAREGAARRASSLFMCSLALSDLLITFFCVPFTLLQNISSQ--WSGGVLVCKTVPFVQTTAIVTGILTMTCIAVERYQGIVHPLKMKRQYTPKRAYKMLGLVWVVSIMVGSPMLFVQQLEVKYDFLYEHHHVCCQELWGSELHRKIYTTFIMVALFLLPLAAMLFLYTRISIEL 306          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Match: nmur3 (neuromedin-U receptor 2-like [Source:NCBI gene;Acc:103035443])

HSP 1 Score: 62.3882 bits (150), Expect = 1.042e-10
Identity = 52/176 (29.55%), Postives = 94/176 (53.41%), Query Frame = 3
Query:  243 VILRLKEMRNKYTHLFLLNMAFADLAVSIFCVNFTLLEYIKGFVFHQLGLIACRFNFFXXXXXXXXXXXXXXXXXIERYIAIVFPMKVHRLMSKSHQLILLFAIWIISSLMGMPNLFIYKL--------MNNSSFCH--SSESFLRQYLHLTQFLTLYFLPLLIMAVLYCHIGMKL 740
            VI++ ++MR   T+L+L ++A +DL V +F +   + E  + + F   G   C F  FL      ASVL + +LS+ERY+A+V P+K    ++  H   ++  +WI+S +  +PN  ++ +        +  S+ C+    +      + +T  L  YF+P++++  LY  IGMKL
Sbjct:   80 VIIKHRKMRTP-TNLYLFSLAVSDLLVLLFGMPLEIYELWQNYPF-PFGESVCCFKVFLFETVCFASVLNVTVLSVERYVAVVHPLKTRYALTNKHAQKMIGGVWIVSLVCAVPNTSLHGIHYYYLPEKVLESATCNLLKPQWIYNLVIQVTTVL-FYFVPMMVICGLYLVIGMKL 252          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Sea Lamprey
Match: npffr1l3 (neuropeptide FF receptor 1 like 3 [Source:ZFIN;Acc:ZDB-GENE-070424-44])

HSP 1 Score: 58.5362 bits (140), Expect = 3.454e-10
Identity = 53/186 (28.49%), Postives = 97/186 (52.15%), Query Frame = 3
Query:  240 FVILRLKEMRNKYTHLFLLNMAFADLAVSIFCVNFTLLE-YIKGFVFHQLGLIACRFNFFXXXXXXXXXXXXXXXXXIERYIAIVFPMKVHRLMSKSHQLILLFAIWIISSLMGMPNLF------------IYKLMNNSSF----CHSS--ESFLRQYLHLTQFLTLYFLPLLIMAVLYCHIGMKL 740
            +V+L+ + MR   T+LF+LN+A +DL V IFC+  TL++  I G+ F   G++ C+ +  +Q  S +ASV  L+ ++++R+  IV+P K  R +  SH L  +  IW ++  +  P+              +Y   +N +     C  +  +  +R+      F  +Y  PL ++ ++Y  IG +L
Sbjct:   72 YVVLQSRRMRT-VTNLFILNLAVSDLLVGIFCMPITLVDNLITGWPF---GVVVCKMSGLVQGTSVSASVFTLVAIAVDRFRCIVYPFK--RKLRISHALFTILVIWALALSIMCPSALMLTAEVSRGHYMVYSDGSNDTHPLHQCWEAWPDPRMRKAYTTVLFANVYLAPLALILLMYARIGFRL 251          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Sea Lamprey
Match: galr2a (galanin receptor 2a [Source:ZFIN;Acc:ZDB-GENE-130603-37])

HSP 1 Score: 54.299 bits (129), Expect = 7.867e-9
Identity = 43/160 (26.88%), Postives = 82/160 (51.25%), Query Frame = 3
Query:  258 KEMRNKYTHLFLLNMAFADLAVSIFCVNFTLLEY-IKGFVFHQLGLIACRFNFFXXXXXXXXXXXXXXXXXIERYIAIVFPMKVHRLMSKSHQLILLFAIWIISSLMGMPNLFIYKLM--NNSSFC---HSSESFLRQYLHLTQFLTLYFLPLLIMAVLY 719
            +   N  T++F+LN++ ADL   +FCV F    Y + G++F   G   C+   F+  ++  AS   L  +S++RY+AI +P++   L +      ++ AIW ++ +   P L  Y+ +   N S C    + E   R+ + +  F+  Y +P+ ++ + Y
Sbjct:   56 RGSSNTTTNIFILNLSVADLCFILFCVPFQATIYTLDGWIF---GSFLCKAVHFIIFLTMFASSFTLAAVSVDRYLAIRYPLRSRELRTPRKAAAVIAAIWGLALVFAGPYLSYYQAVTFQNMSMCMPVWAKEP--RKLMDMVTFVCGYLVPVSVLGLAY 210          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006953.1 (pep scaffold:Pmarinus_7.0:GL477632:7596:14007:1 gene:ENSPMAG00000006283.1 transcript:ENSPMAT00000006953.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 52.373 bits (124), Expect = 5.017e-8
Identity = 51/176 (28.98%), Postives = 85/176 (48.30%), Query Frame = 3
Query:  249 LRLKEMRNKYTHLFLLNMAFADLAVSIFCVNFTLLEYIKGFVFHQLGLIACRFNFFXXXXXXXXXXXXXXXXXIERYIAIVFPMKVHRLMSKSHQLILLFAIWIISSLMGMP----NLFIYKLMNNSSFCHSSESFLRQYLHLTQFLTLYFLPLLIMAVLYCHIGMKLTESCNCCD 764
            + L++     T+ FL+++A AD+ V I  +  +LL  + GF +  L L  C    +L  +   AS++ L  +S++RYIAI  P++  R  S++  L+ + A+W+IS  + MP     L     +     C  + S    Y  L+ F    FLPL+IM   Y      L +    C+
Sbjct:   49 VSLEKKLQTATNYFLMSLAVADMLVGILVMPISLLNILYGFKW-PLPLSLCPVWIYLDVLFSTASIMHLCAISLDRYIAIKKPIEHSRFNSRTKALLKILAVWVISVGISMPVPVLGLQDLAYVYTDGSCQMNISDFIIYGSLSSF----FLPLIIMVASYVSTTRVLRQQALLCE 219          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Sea Lamprey
Match: qrfpr4 (pyroglutamylated RFamide peptide receptor 4 [Source:ZFIN;Acc:ZDB-GENE-091204-354])

HSP 1 Score: 50.8322 bits (120), Expect = 1.440e-7
Identity = 41/178 (23.03%), Postives = 87/178 (48.88%), Query Frame = 3
Query:  240 FVILRLKEMRNKYTHLFLLNMAFADLAVSIFCVNFTLLE-YIKGFVFHQLGLIACRFNFFXXXXXXXXXXXXXXXXXIERYIAIVFPMKVHRLMSKSHQLILLFAIWIISSLMGMPNLF------IYKLMNNSSFCHSSESFL----RQYLHLTQFLTLYFLPLLIMAVLYCHIGMKL 740
            FV+ R K + +   ++F+ ++A +DL +++FC+  TL++ +   ++    G+  C+   F+Q  +   S+L +  +++ER+  I+ P++     + +    +L  +W++   +  P  +       Y ++ + S    SE +     RQ    T  L  + LPLL M  LY  +  +L
Sbjct:   68 FVVARRKAL-HTVANVFVCSLAVSDLMITVFCIPITLMQNFFSNWI---AGVALCKLVPFIQVTAVTTSMLTMACIAVERFQGILHPLRSRSRYTTARAASMLCGVWLVGLCVAAPMFYAHTVQVTYDVLYDVSHTGCSEQWSHAEHRQAYTTTLLLVTFVLPLLTMTALYTRLAHEL 241          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010165.1 (pep scaffold:Pmarinus_7.0:GL493405:1402:3508:1 gene:ENSPMAG00000009199.1 transcript:ENSPMAT00000010165.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 49.2914 bits (116), Expect = 2.705e-7
Identity = 41/167 (24.55%), Postives = 91/167 (54.49%), Query Frame = 3
Query:  273 KYTHLFLLNMAFADLAVSIFCVNFTLLEYIKGFVFHQLGLIACRFNFFXXXXXXXXXXXXXXXXXIERYIAIVFPMKVHRLMSKSHQLILLFAIWIISSLMGMPNLFIYKLMN---NSSF--CHSSESFLRQYLH----LTQFLTLYFLPLLIMAVLYCHIGMKLTE 746
             +  + ++N+  ADL ++   +    + +I    +   G  ACR   FL+ ++  +S  + +++S++R+ AI+ P+ + +  +K+    +L   W++S L+ +P LF++ + +   N +F  C +  +F+ Q+ H    +  F+ L+ LPL IM   YC I +++++
Sbjct:   85 SHVRILIVNLTTADLLITFIVMPLDAVWHITTQWY--AGEFACRLLMFLRLLAMYSSAFITVVISLDRHSAILNPLGIGK--AKAKNKTMLSVAWVLSVLLAVPQLFLFHVKSPKGNKNFVQCVTHGNFVEQWHHNLYYMFTFVFLFILPLFIMIFCYCRILLEISK 247          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Nematostella
Match: EDO36453 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIH9])

HSP 1 Score: 65.4698 bits (158), Expect = 2.331e-12
Identity = 54/170 (31.76%), Postives = 94/170 (55.29%), Query Frame = 3
Query:  243 VILRLKEMRNKYTHLFLLNMAFADLAVSIFCVNFTLLEYIKGFVFHQLGLIACRFNFFXXXXXXXXXXXXXXXXXIERYIAIVFPMKVHRLMSKSHQLILLFAIWIISSLMGMPNLFIYKLMNNSSFCHSS--ESFLRQYLHLTQFLTLYFLPLLIMAVLYCHIGMKLTE 746
            VIL+ K+M+   T+ F+LN+A ADLA++  C+ F +     G+++   G + C+  + LQ+++  ASV  L  +S+ RY AIV P++    +SK+  L++  AIW++S L   P +     + +S +C  +      R+    + F   Y +PL I+A  YC I  +L+ 
Sbjct:   59 VILKRKKMKT-VTNYFILNLAVADLALTCICIPFDIPVQEMGYIW-PYGAVMCKVLYPLQTLTLFASVYTLTAVSLTRYWAIVHPLRKQLSVSKAKTLVI--AIWVLSLLPVAPYMNSLSYVPHSKYCEENWDNHNARKGYTASLFAFQYVIPLTIIATAYCSITRELSR 224          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Nematostella
Match: EDO27481 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T950])

HSP 1 Score: 64.6994 bits (156), Expect = 3.709e-12
Identity = 54/170 (31.76%), Postives = 94/170 (55.29%), Query Frame = 3
Query:  243 VILRLKEMRNKYTHLFLLNMAFADLAVSIFCVNFTLLEYIKGFVFHQLGLIACRFNFFXXXXXXXXXXXXXXXXXIERYIAIVFPMKVHRLMSKSHQLILLFAIWIISSLMGMPNLFIYKLMNNSSFCHSS--ESFLRQYLHLTQFLTLYFLPLLIMAVLYCHIGMKLTE 746
            VIL+ K+M+   T+ F+LN+A ADLA++  C+ F +     G+++   G + C+  + LQ+++  ASV  L  +S+ RY AIV P++    +SK+  L++  AIW++S L   P +     + +S +C  +      R+    + F   Y +PL I+A  YC I  +L+ 
Sbjct:   27 VILKRKKMKT-VTNYFILNLAVADLALTCICIPFDIPVQEMGYIW-PYGAVMCKVLYPLQTLTLFASVYTLTAVSLTRYWAIVHPLRKQLSVSKAKTLVI--AIWVLSLLPVAPYMNSLSYVPHSKYCEENWDNHNARKGYTASLFAFQYVIPLTIIATAYCSITSELSR 192          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Nematostella
Match: EDO40944 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5Q4])

HSP 1 Score: 63.1586 bits (152), Expect = 1.084e-11
Identity = 55/170 (32.35%), Postives = 94/170 (55.29%), Query Frame = 3
Query:  243 VILRLKEMRNKYTHLFLLNMAFADLAVSIFCVNFTLLEYIKGFVFHQLGLIACRFNFFXXXXXXXXXXXXXXXXXIERYIAIVFPMKVHRLMSKSHQLILLFAIWIISSLMGMPNLFIYKLMNNSSFCHS--SESFLRQYLHLTQFLTLYFLPLLIMAVLYCHIGMKLTE 746
            VILR + M+   T+ F+LN+A ADLA++  C+ F +      +V+   G + C+  + LQ++S  ASV  L  +S+ RY AIV P++    +S S ++I+  AIW+IS +   P  ++    + S  C     ++ +R+      F+  Y LPL ++A  Y  IG++L +
Sbjct:   17 VILRRRRMKT-VTNYFVLNLAIADLALTCICIPFDIPVQEMNYVWPYGGFM-CKILYPLQTLSLFASVFTLTAVSLTRYWAIVHPLRQQLSVSNSKRIIV--AIWVISIIPVSPYSYVLSHEDGSLSCEENWGDTSMRKVYTAVLFMFQYVLPLTVIAGAYIGIGIELRK 182          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Nematostella
Match: EDO49619 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFL1])

HSP 1 Score: 61.6178 bits (148), Expect = 5.225e-11
Identity = 53/200 (26.50%), Postives = 98/200 (49.00%), Query Frame = 3
Query:  243 VILRLKEMRNKYTHLFLLNMAFADLAVSIFCVNFTLLEYIKGFVFHQLGLIACRFNFFXXXXXXXXXXXXXXXXXIERYIAIVFPMKVHRLMSKSHQLILLFAIWIISSLMGMPNLFIYKLMNNSSFCHSSESFLRQYLHLTQFLTLYFLPLLIMAVLYCHIGMKLTESCNCCDQT*TFLTSPSISHF-IDCRLLISAVL 839
            VI +   MRN   +L ++N+A AD+ V++ C+ F ++  + G  +  LG   C+  +   +     S   L  +S +RY A+V P K    +S    L ++ + W++S L+ +P + +  +  +S      +   RQ   +  F+  Y LPL+I+A  Y  + +KL E  N  ++       PS S +    ++L++ VL
Sbjct:   19 VIFKTPNMRNTRNYL-IVNLAIADITVALVCIPFDVVIRVYGDTW-VLGAAMCKMVWPSMTFVATCSAATLAAISFDRYRAVVHPWKPR--LSMRQTLAVIVSTWLVSFLVVLPYILVLGMDGHSCTEFWLKDIHRQLYTVFLFVFAYALPLVIIAFAYSRVALKLREQSNRIEKNKLASGIPSSSKYNWITKMLVTVVL 214          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Nematostella
Match: EDO46030 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR08])

HSP 1 Score: 61.2326 bits (147), Expect = 5.260e-11
Identity = 51/173 (29.48%), Postives = 97/173 (56.07%), Query Frame = 3
Query:  240 FVILRLKEMRNKYTHLFLLNMAFADLAVSIFCVNFTL----LEYIKGFVFHQLGLIACRFNFFXXXXXXXXXXXXXXXXXIERYIAIVFPMKVHRLMSKSHQLILLFAIWIISSLMGMPNLFIYKLMNNSSFC--HSSESFLRQYLHLTQFLTLYFLPLLIMAVLYCHIGMKL 740
            FVI+R ++M+   T+ F+LN+A ADL +++ C+ F +    ++YI  +     G   C+  + LQ++   ASV  L  +S+ RY AI+ P++  +L  K  ++I +F IW++S +   P +++ +    + +C  H  ++  R+   +T F+  Y +PL ++   Y  IG +L
Sbjct:   27 FVIMRRRKMKT-VTNYFILNLAIADLTLTLICIPFDIPVQEMDYIWPY-----GPFMCKILYPLQTMCLFASVFTLTSVSVARYRAIIHPLR-PQLTVKRAKVITVF-IWMLSVVPVSPYIYVLEHKEETQYCEEHWVDTKSRKIYTVTLFVIQYIIPLSLITAAYARIGKEL 191          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Match: QRFPR (pyroglutamylated RFamide peptide receptor [Source:NCBI gene;Acc:101157401])

HSP 1 Score: 75.8702 bits (185), Expect = 3.492e-15
Identity = 54/175 (30.86%), Postives = 95/175 (54.29%), Query Frame = 3
Query:  240 FVILRLKEMRNKYTHLFLLNMAFADLAVSIFCVNFTLLEYIKGFVFHQLGLIACRFNFFXXXXXXXXXXXXXXXXXIERYIAIVFPMKVHRLMSKSHQLILLFAIWIISSLMGMPNLFIYKLMNNSSF------CHSSESFLRQYLHLTQFL--TLYFLPLLIMAVLYCHIGMKL 740
            +++++ + ++   T +F+ ++A +DL ++ FC+ FTLL+ I    F   G++ C+   F+Q+ +    +L +  ++IERY  IVFP+K+ R  S      +L  +WI S ++G P LF+ +L  +  +      C  S S L      T F+   L+ LPL  M  LY  IG++L
Sbjct:   77 YIVVKKRAIQTA-TDIFICSLAVSDLLITFFCIPFTLLQNISSEWFG--GVLVCKTVPFVQTTAIVTGILTMTCIAIERYQGIVFPLKMRRQYSSKRAYKVLGLVWIASVVVGSPMLFVQQLQYDFLYDHYHVCCQESWSSLTYRQAYTTFIMVALFLLPLTAMLFLYTRIGIEL 248          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Match: galr2a (galanin receptor type 2 [Source:NCBI gene;Acc:101155603])

HSP 1 Score: 67.0106 bits (162), Expect = 2.766e-12
Identity = 52/163 (31.90%), Postives = 89/163 (54.60%), Query Frame = 3
Query:  243 VILRLKEMRNKYTHLFLLNMAFADLAVSIFCVNFTLLEY-IKGFVFHQLGLIACRFNFFXXXXXXXXXXXXXXXXXIERYIAIVFPMKVHRLMSKSHQLILLFAIWIISSLMGMPNLFIYKLMN--NSSFCHSS-ESFLRQYLHLTQFLTLYFLPLLIMAVLY 719
            V+LR  ++    T+LF+LN++ AD    IFCV F    Y ++G+VF   G   C+   F  +++  AS   L  +S++RY+AI +P++   L +  + ++ +  IW +S +   P L  Y L++  NS+ C    E   R+ L    FL  Y +P+LI+++ Y
Sbjct:   50 VLLRSGQVGYNTTNLFILNLSVADFFFIIFCVPFQATIYSLEGWVF---GSFMCKVVHFFINLTMYASSFTLAAVSVDRYLAIRYPLRSRELRTPCNAVVAMVVIWGLSLVFAGPYLSYYDLIDYANSTVCIPGWEEQDRKVLDTCTFLFGYVIPVLIVSLSY 209          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Match: nmur3 (neuromedin-U receptor 2-like [Source:NCBI gene;Acc:101165474])

HSP 1 Score: 65.4698 bits (158), Expect = 1.319e-11
Identity = 55/174 (31.61%), Postives = 93/174 (53.45%), Query Frame = 3
Query:  243 VILRLKEMRNKYTHLFLLNMAFADLAVSIFCVNFTLLEYIKGFVFHQLGLIACRFNFFXXXXXXXXXXXXXXXXXIERYIAIVFPMKVHRLMSKSHQLILLFAIWIISSLMGMPNLFIYKL------MNNSSFCHSSESFLRQYLHLTQFLT--LYFLPLLIMAVLYCHIGMKL 740
            VI + K MRN  T+ +L+++A +DL V +F +   + +  + + F   G   C F  FL      AS+L +  LS+ERYIA+V P+K   L +  H   ++  +W++S +  +PN  ++ +      M  S+ C   +  L  Y  L Q  T   YF+P++I++VLY  +G+ L
Sbjct:  114 VIAKHKRMRNP-TNFYLVSLAVSDLLVLMFGMPLEIYDLWQNYPF-PFGEGGCYFKTFLFETVCFASILNVTALSVERYIAVVHPLKTRYLSTNQHAKRVITVVWVVSMVCAIPNTSLHGIFYLPEKMEESAICTVLKP-LWIYNLLMQITTACFYFIPMMIISVLYLVMGIHL 284          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Match: CCKAR (cholecystokinin A receptor [Source:NCBI gene;Acc:101166993])

HSP 1 Score: 63.5438 bits (153), Expect = 4.868e-11
Identity = 54/174 (31.03%), Postives = 92/174 (52.87%), Query Frame = 3
Query:  243 VILRLKEMRNKYTHLFLLNMAFADLAVSIFCVNFTLL-EYIKGFVFHQLGLIACRFNFFXXXXXXXXXXXXXXXXXIERYIAIVFPMKVHRLMSKSHQLILLFAIWIISSLMGMPNLFIYKLMNNSS---FCH----SSESFLRQYLHLTQFLTLYFLPLLIMAVLYCHIGMKL 740
            V++R + MR   T+LFLL++A +DL VS+ C+ FTL+   +K F+F   G+  C+   +   V+ + S   L+ +S+ERY AI  P+      +KSH   ++   W+ S ++ +P      + +N+S    C     +  SF   Y+ L   L L+ +P +IM   Y  I ++L
Sbjct:   70 VLVRNRRMRT-VTNLFLLSLAVSDLMVSLVCIPFTLIPNLMKNFIF---GIGMCKLVMYFMGVAVSVSTFNLVAISLERYSAICNPLTSRVWQTKSHAAKVITTTWVASFILMLPYAIFSTVESNNSPIKMCRLVMPNDTSFQSWYVSL--LLVLFLIPGIIMMTAYGLISLEL 237          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Match: si:dkey-1h24.2 (cholecystokinin receptor [Source:NCBI gene;Acc:101175467])

HSP 1 Score: 63.5438 bits (153), Expect = 4.916e-11
Identity = 55/178 (30.90%), Postives = 93/178 (52.25%), Query Frame = 3
Query:  243 VILRLKEMRNKYTHLFLLNMAFADLAVSIFCVNFTLLEYI-KGFVFHQLGLIACRFNFFXXXXXXXXXXXXXXXXXIERYIAIVFPMKVHRLMSKSHQLILLFAIWIISSLMGMPNLFIYKLMN----NSSFCH-------SSESFLRQYLHLTQFLTLYFLPLLIMAVLYCHIGMKL 740
            V+L L +     T+ FLL++A +DL +++FC+ FTL+  I K F+F   G   C+   +L  VS + S   L+ ++IERY AI  P++     ++SH   ++ A W+IS L+ +P  F   L +    N +  H       S ++   Q  ++    TL+F+P ++M   Y  I  +L
Sbjct:   46 VVLTLNKRMRTVTNSFLLSLAVSDLMMAVFCMPFTLIPNILKDFIF---GATMCKIVTYLMGVSVSISTFSLVAIAIERYSAICNPLQSRAWQTRSHAYRVIAATWVISLLIMVPYPFFSALKSFPKTNGTMGHMCRLDWPSQQA--EQTWYVLLLFTLFFVPGVVMITAYGLISREL 218          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000020911.1 (SMESG000020911.1)

HSP 1 Score: 427.943 bits (1099), Expect = 1.231e-150
Identity = 244/245 (99.59%), Postives = 244/245 (99.59%), Query Frame = 3
Query:   15 MSQLFNVSIDQISALCRAVHENCPSCIEKCILDAYKTPEESTDLRSDIHNIIERWMTITFPXXXXXXXXXXXXXXFVILRLKEMRNKYTHLFLLNMAFADLAVSIFCVNFTLLEYIKGFVFHQLGLIACRFNFFXXXXXXXXXXXXXXXXXIERYIAIVFPMKVHRLMSKSHQLILLFAIWIISSLMGMPNLFIYKLMNNSSFCHSSESFLRQYLHLTQFLTLYFLPLLIMAVLYCHIGMKLTES 749
            MSQLFNVSIDQISALCRAVHENCPSCIEKCILDAYKTPEESTDLRSDIHNIIERWMTITFPILSILGIIGNSLVIFVILRLKEMRNKYTHLFLLNMA ADLAVSIFCVNFTLLEYIKGFVFHQLGLIACRFNFFLQSVSYAASVLLLLMLSIERYIAIVFPMKVHRLMSKSHQLILLFAIWIISSLMGMPNLFIYKLMNNSSFCHSSESFLRQYLHLTQFLTLYFLPLLIMAVLYCHIGMKLTES
Sbjct:    1 MSQLFNVSIDQISALCRAVHENCPSCIEKCILDAYKTPEESTDLRSDIHNIIERWMTITFPILSILGIIGNSLVIFVILRLKEMRNKYTHLFLLNMALADLAVSIFCVNFTLLEYIKGFVFHQLGLIACRFNFFLQSVSYAASVLLLLMLSIERYIAIVFPMKVHRLMSKSHQLILLFAIWIISSLMGMPNLFIYKLMNNSSFCHSSESFLRQYLHLTQFLTLYFLPLLIMAVLYCHIGMKLTES 245          

HSP 2 Score: 88.9669 bits (219), Expect = 6.940e-20
Identity = 42/42 (100.00%), Postives = 42/42 (100.00%), Query Frame = 2
Query:  749 MQLLRSNMNISDITINKSFHRLSTVDFSCTQTGLNGANKQNL 874
            MQLLRSNMNISDITINKSFHRLSTVDFSCTQTGLNGANKQNL
Sbjct:  246 MQLLRSNMNISDITINKSFHRLSTVDFSCTQTGLNGANKQNL 287          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000062683.1 (SMESG000062683.1)

HSP 1 Score: 147.132 bits (370), Expect = 3.522e-41
Identity = 97/240 (40.42%), Postives = 155/240 (64.58%), Query Frame = 3
Query:   57 LCRAVHENCPSCIEKCILDAYKTPEESTDLRSD-------IHNIIERWMTITFPXXXXXXXXXXXXXXFVILRLKEMRNKYTHLFLLNMAFADLAVSIFCVNFTLLEYIKGFVFHQLGLIACRFNFFXXXXXXXXXXXXXXXXXIERYIAIVFPMKVHRLMSKSHQLILLFAIWIISSLMGMPNLFIYKL--MNNSSFCHSSESFLRQYLHLTQFLTLYFLPLLIMAVLYCHIGMKLTES 749
            LC+++++ C  CIE C+  + K      +++ D       + N +  ++ I FPI+SI+G I N L+IFV+LRL  +R  YT+ FL+NMA ADL V I+CVN T +EY+   +F  +G   C+ N FLQ +SY AS+LLL+++ +ERYIAI+FPMKV  ++SK   ++LL  IW++S    +P+LF Y+L  ++N + C  +E   ++  +++ F+ LY +PL++M  LY HI + L +S
Sbjct:    4 LCKSIYKECTYCIEICLNASLKDTNTENNMKHDTEGSFNCVKNNVNLFIKIFFPIISIVGCIANILIIFVVLRLPSLRRSYTNFFLVNMALADLGVVIWCVNLTTIEYVDAELFWIVGPALCKMNHFLQIMSYTASILLLMLICLERYIAIIFPMKVKNMLSKRIYIVLLIFIWLLSIGFSLPSLFEYELRRIHNVTRCEKTEKISKKTYYISSFVLLYIIPLVLMGSLYGHICLSLVKS 243          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000062683.1 (SMESG000062683.1)

HSP 1 Score: 147.132 bits (370), Expect = 4.083e-41
Identity = 97/240 (40.42%), Postives = 155/240 (64.58%), Query Frame = 3
Query:   57 LCRAVHENCPSCIEKCILDAYKTPEESTDLRSD-------IHNIIERWMTITFPXXXXXXXXXXXXXXFVILRLKEMRNKYTHLFLLNMAFADLAVSIFCVNFTLLEYIKGFVFHQLGLIACRFNFFXXXXXXXXXXXXXXXXXIERYIAIVFPMKVHRLMSKSHQLILLFAIWIISSLMGMPNLFIYKL--MNNSSFCHSSESFLRQYLHLTQFLTLYFLPLLIMAVLYCHIGMKLTES 749
            LC+++++ C  CIE C+  + K      +++ D       + N +  ++ I FPI+SI+G I N L+IFV+LRL  +R  YT+ FL+NMA ADL V I+CVN T +EY+   +F  +G   C+ N FLQ +SY AS+LLL+++ +ERYIAI+FPMKV  ++SK   ++LL  IW++S    +P+LF Y+L  ++N + C  +E   ++  +++ F+ LY +PL++M  LY HI + L +S
Sbjct:    8 LCKSIYKECTYCIEICLNASLKDTNTENNMKHDTEGSFNCVKNNVNLFIKIFFPIISIVGCIANILIIFVVLRLPSLRRSYTNFFLVNMALADLGVVIWCVNLTTIEYVDAELFWIVGPALCKMNHFLQIMSYTASILLLMLICLERYIAIIFPMKVKNMLSKRIYIVLLIFIWLLSIGFSLPSLFEYELRRIHNVTRCEKTEKISKKTYYISSFVLLYIIPLVLMGSLYGHICLSLVKS 247          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000069107.1 (SMESG000069107.1)

HSP 1 Score: 72.4034 bits (176), Expect = 3.377e-14
Identity = 61/184 (33.15%), Postives = 97/184 (52.72%), Query Frame = 3
Query:  240 FVILRLKEMRNKYTHLFLLNMAFADLAVSIFCVNFTLLEYI--KGFVFHQLGLIACRFNFFXXXXXXXXXXXXXXXXXIERYIAIVFPMKVHRLMSKSHQLILLFAIWIISSLMGMPNLFIYKL----MNNSS--------FCHSSESFLRQY-------LHLTQFLTLYFLPLLIMAVLYCHI 728
            +VIL+ ++MR   T++F+LNMA ADL + +  V   ++ +I  KG++   LG +AC+   +  +     SVL L+ + IERYIAI++P+K H   +K H LI+L  IWI + L G+P +   +     M+NS          C    S  R+        +   +F   YF+P+L   +LY  I
Sbjct:   61 YVILKERKMRILPTNIFILNMAMADLVIMLVGVE-EIVHHILDKGWL---LGSVACKILRYGMTTCLYVSVLTLIAVCIERYIAIIYPIKAHIWCNKKHTLIVLITIWIAAILCGLPTVIFVQAFVPPMSNSKEITNYSIIRCMRVFSMNRKVHYKILLIVQYVEFFLYYFIPILTQIILYTKI 240          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000046633.1 (SMESG000046633.1)

HSP 1 Score: 56.9954 bits (136), Expect = 3.925e-9
Identity = 52/183 (28.42%), Postives = 98/183 (53.55%), Query Frame = 3
Query:  246 ILRLKEMRNKYTHLFLLNMAFADLAVSIFCVNFTLLEYIKGFVFHQLGLIACRFNFFXXXXXXXXXXXXXXXXXIERYIAIVFPMKVHRLMSKSHQLILLFAIWIISSLMGMPNLFIYK-------LMNNSSF------C---HSSESFLRQYLHLTQFLTLYFLPLLIMAVLYCHIGMKLTE 746
            ++R   MR    ++F+ N++ AD+  ++F +  TLL+ I    +H  G + CR + +LQ  +  AS+  L +++ +RY+AI  PMK  R+++K    I++  IWI S+++ +P    YK       L  N SF      C     ++   ++Y     F+ LY +PL ++++ Y  +G+K+ +
Sbjct:   17 VIRHVSMRT-VINIFICNLSIADILCALFVLPITLLQSIHN-EWH-FGTLLCRASPYLQGTTVCASISTLTIIAFDRYVAICHPMK--RVINKKTTYIIVIGIWISSAIILLPWAVYYKIQIKVTNLTWNGSFQLHRKICLMEWPNKGEGKEYFLGVIFIILYVIPLTLISIFYAAVGLKVWQ 194          
The following BLAST results are available for this feature:
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CCKBR5.580e-1030.64cholecystokinin B receptor [Source:HGNC Symbol;Acc... [more]
QRFPR5.668e-1026.55pyroglutamylated RFamide peptide receptor [Source:... [more]
CCKBR6.733e-1030.64cholecystokinin B receptor [Source:HGNC Symbol;Acc... [more]
TACR31.631e-928.34tachykinin receptor 3 [Source:HGNC Symbol;Acc:HGNC... [more]
CCKAR3.609e-930.68cholecystokinin A receptor [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ckr-16.448e-1533.66CholecystoKinin Receptor homolog [Source:UniProtK... [more]
npr-154.616e-1130.43Neuropeptide receptor 15 [Source:UniProtKB/Swiss-... [more]
npr-221.272e-1028.26Neuropeptide receptor 22 [Source:UniProtKB/Swiss-... [more]
npr-221.299e-1028.26Neuropeptide receptor 22 [Source:UniProtKB/Swiss-... [more]
tkr-24.402e-927.23TachyKinin Receptor family [Source:UniProtKB/TrEM... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TrissinR9.615e-1333.53gene:FBgn0085410 transcript:FBtr0330222[more]
TrissinR1.097e-1233.53gene:FBgn0085410 transcript:FBtr0330221[more]
TrissinR1.097e-1233.53gene:FBgn0085410 transcript:FBtr0342612[more]
TrissinR1.121e-1233.53gene:FBgn0085410 transcript:FBtr0112619[more]
SIFaR1.118e-931.89gene:FBgn0038880 transcript:FBtr0084098[more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
qrfpra1.360e-1528.81pyroglutamylated RFamide peptide receptor a [Sourc... [more]
CABZ01084347.16.217e-1228.19pyroglutamylated RFamide peptide receptor b [Sourc... [more]
galr2b7.016e-1231.29galanin receptor 2b [Source:ZFIN;Acc:ZDB-GENE-1311... [more]
galr2b7.016e-1231.29galanin receptor 2b [Source:ZFIN;Acc:ZDB-GENE-1311... [more]
CCKAR1.298e-1133.14cholecystokinin A receptor [Source:NCBI gene;Acc:5... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000041298.15.323e-1131.52galanin receptor 3 [Source:NCBI gene;Acc:100488248... [more]
sp36.629e-1129.45Sp3 transcription factor [Source:Xenbase;Acc:XB-GE... [more]
sp37.817e-1129.45Sp3 transcription factor [Source:Xenbase;Acc:XB-GE... [more]
c16orf878.719e-1128.17chromosome 16 open reading frame 87 [Source:Xenbas... [more]
c16orf879.660e-1128.17chromosome 16 open reading frame 87 [Source:Xenbas... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nmur11.571e-1232.00neuromedin U receptor 1 [Source:MGI Symbol;Acc:MGI... [more]
Nmur11.616e-1232.00neuromedin U receptor 1 [Source:MGI Symbol;Acc:MGI... [more]
Nmur11.977e-1232.00neuromedin U receptor 1 [Source:MGI Symbol;Acc:MGI... [more]
Tacr38.020e-1129.95tachykinin receptor 3 [Source:MGI Symbol;Acc:MGI:8... [more]
Tacr11.541e-1027.87tachykinin receptor 1 [Source:MGI Symbol;Acc:MGI:9... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O55040|NMUR1_MOUSE1.099e-1132.00Neuromedin-U receptor 1 OS=Mus musculus OX=10090 G... [more]
sp|Q9VML9|TRISR_DROME1.124e-1133.53Trissin receptor OS=Drosophila melanogaster OX=722... [more]
sp|E7F7V7|GAL2B_DANRE5.296e-1131.29Galanin receptor 2b OS=Danio rerio OX=7955 GN=galr... [more]
sp|P30552|GASR_CANLF1.782e-1029.89Gastrin/cholecystokinin type B receptor OS=Canis l... [more]
sp|A0A287A2K5|GASR_PIG1.933e-1027.51Gastrin/cholecystokinin type B receptor OS=Sus scr... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A193KU808.046e-3740.00GCR041 OS=Schmidtea mediterranea OX=79327 GN=gcr04... [more]
A0A3P8T4P81.162e-1433.93G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
W4YRA65.138e-1438.15G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
V3ZZR62.850e-1334.05G_PROTEIN_RECEP_F1_2 domain-containing protein (Fr... [more]
A0A3Q2DKF33.299e-1331.64Pyroglutamylated RFamide peptide receptor OS=Cypri... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
galr2b7.293e-1231.29galanin receptor type 2-like [Source:NCBI gene;Acc... [more]
galr2a2.330e-1126.95galanin receptor type 2 [Source:NCBI gene;Acc:1030... [more]
QRFPR4.586e-1127.43pyroglutamylated RFamide peptide receptor-like [So... [more]
QRFPR4.586e-1127.43pyroglutamylated RFamide peptide receptor-like [So... [more]
nmur31.042e-1029.55neuromedin-U receptor 2-like [Source:NCBI gene;Acc... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
npffr1l33.454e-1028.49neuropeptide FF receptor 1 like 3 [Source:ZFIN;Acc... [more]
galr2a7.867e-926.88galanin receptor 2a [Source:ZFIN;Acc:ZDB-GENE-1306... [more]
ENSPMAT00000006953.15.017e-828.98pep scaffold:Pmarinus_7.0:GL477632:7596:14007:1 ge... [more]
qrfpr41.440e-723.03pyroglutamylated RFamide peptide receptor 4 [Sourc... [more]
ENSPMAT00000010165.12.705e-724.55pep scaffold:Pmarinus_7.0:GL493405:1402:3508:1 gen... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO364532.331e-1231.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO274813.709e-1231.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO409441.084e-1132.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO496195.225e-1126.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO460305.260e-1129.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
QRFPR3.492e-1530.86pyroglutamylated RFamide peptide receptor [Source:... [more]
galr2a2.766e-1231.90galanin receptor type 2 [Source:NCBI gene;Acc:1011... [more]
nmur31.319e-1131.61neuromedin-U receptor 2-like [Source:NCBI gene;Acc... [more]
CCKAR4.868e-1131.03cholecystokinin A receptor [Source:NCBI gene;Acc:1... [more]
si:dkey-1h24.24.916e-1130.90cholecystokinin receptor [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000020911.11.231e-15099.59SMESG000020911.1[more]
SMESG000062683.13.522e-4140.42SMESG000062683.1[more]
SMESG000062683.14.083e-4140.42SMESG000062683.1[more]
SMESG000069107.13.377e-1433.15SMESG000069107.1[more]
SMESG000046633.13.925e-928.42SMESG000046633.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011800 ID=SMED30011800|Name=G_PROTEIN_RECEP_F1_2 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=876bp
TTTTTTTGTTTTAGATGAGTCAGTTGTTTAATGTTTCGATAGATCAGATC
TCGGCACTTTGTCGAGCAGTTCACGAGAACTGTCCTTCATGTATAGAGAA
ATGCATTCTTGATGCGTATAAAACTCCAGAAGAAAGTACTGATCTAAGAT
CTGATATCCACAATATCATAGAAAGATGGATGACAATTACTTTCCCTATT
CTTTCCATATTGGGTATTATTGGTAATTCGCTGGTAATCTTTGTCATTCT
CCGGCTGAAAGAAATGAGAAATAAATATACTCATTTATTTCTTTTAAACA
TGGCATTTGCAGATTTGGCAGTCAGCATTTTTTGCGTAAATTTCACCCTT
CTAGAATACATCAAAGGTTTTGTTTTTCATCAGCTTGGACTGATTGCATG
TCGTTTTAATTTTTTCCTTCAATCCGTTTCATATGCCGCTAGTGTTTTAT
TATTGCTCATGCTTAGCATTGAAAGATACATAGCAATTGTTTTTCCTATG
AAAGTTCATAGACTAATGTCTAAAAGTCATCAGTTGATCTTGTTATTTGC
CATTTGGATTATTAGTTCATTAATGGGTATGCCGAATCTCTTTATTTATA
AATTAATGAATAACAGTTCATTTTGTCATTCCTCGGAATCTTTCCTTCGA
CAATATCTTCATTTGACTCAATTTCTCACTCTTTATTTTCTGCCATTGCT
CATCATGGCAGTTTTGTATTGTCATATTGGAATGAAGCTGACCGAGTCAT
GCAATTGTTGCGATCAAACATGAACATTTCTGACATCACCATCAATAAGT
CATTTCATAGACTGTCGACTGTTGATTTCAGCTGTACTCAAACTGGATTG
AATGGAGCTAACAAGCAAAACCTTCC
back to top

protein sequence of SMED30011800-orf-1

>SMED30011800-orf-1 ID=SMED30011800-orf-1|Name=SMED30011800-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=253bp
MSQLFNVSIDQISALCRAVHENCPSCIEKCILDAYKTPEESTDLRSDIHN
IIERWMTITFPILSILGIIGNSLVIFVILRLKEMRNKYTHLFLLNMAFAD
LAVSIFCVNFTLLEYIKGFVFHQLGLIACRFNFFLQSVSYAASVLLLLML
SIERYIAIVFPMKVHRLMSKSHQLILLFAIWIISSLMGMPNLFIYKLMNN
SSFCHSSESFLRQYLHLTQFLTLYFLPLLIMAVLYCHIGMKLTESCNCCD
QT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004983neuropeptide Y receptor activity
GO:0004930G-protein coupled receptor activity
GO:0004871signal transducer activity
Vocabulary: biological process
TermDefinition
GO:0007218neuropeptide signaling pathway
GO:0007186G-protein coupled receptor signaling pathway
GO:0007165signal transduction
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0002028dorsal-ventral muscle cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR000276GPCR_Rhodpsn
IPR017452GPCR_Rhodpsn_7TM
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000276G protein-coupled receptor, rhodopsin-likePRINTSPR00237GPCRRHODOPSNcoord: 89..110
score: 31.84
coord: 136..158
score: 32.37
coord: 172..193
score: 21.06
coord: 55..79
score: 26.6
coord: 216..239
score: 27.42
IPR000276G protein-coupled receptor, rhodopsin-likePFAMPF000017tm_1coord: 70..246
e-value: 5.2E-32
score: 111.2
IPR000276G protein-coupled receptor, rhodopsin-likePROSITEPS00237G_PROTEIN_RECEP_F1_1coord: 142..158
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 36..253
e-value: 5.8E-47
score: 162.1
NoneNo IPR availablePANTHERPTHR24243G-PROTEIN COUPLED RECEPTORcoord: 39..249
NoneNo IPR availableCDDcd149937tmA_CCKR-likecoord: 65..242
e-value: 3.27565E-41
score: 141.198
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 42..248
NoneNo IPR availableTMHMMTMhelixcoord: 57..79
NoneNo IPR availableTMHMMTMhelixcoord: 133..152
NoneNo IPR availableTMHMMTMhelixcoord: 215..237
NoneNo IPR availableTMHMMTMhelixcoord: 91..113
NoneNo IPR availableTMHMMTMhelixcoord: 173..195
IPR017452GPCR, rhodopsin-like, 7TMPROSITEPS50262G_PROTEIN_RECEP_F1_2coord: 70..253
score: 31.686