E3 ubiquitin-protein ligase MIB2

Overview
NameE3 ubiquitin-protein ligase MIB2
Smed IDSMED30011798
Length (bp)1721
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of E3 ubiquitin-protein ligase MIB2 (SMED30011798) t-SNE clustered cells

Violin plots show distribution of expression levels for E3 ubiquitin-protein ligase MIB2 (SMED30011798) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of E3 ubiquitin-protein ligase MIB2 (SMED30011798) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for E3 ubiquitin-protein ligase MIB2 (SMED30011798) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011798

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 21

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30011798SMESG000043477.1 SMESG000010549.1 SMESG000010347.1 SMESG000010327.1 dd_Smed_v4_593_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30011798SMESG000043477.1 SMESG000010549.1 SMESG000010347.1 SMESG000010327.1 dd_Smed_v4_593_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30011798SMESG000043477.1 SMESG000010549.1 SMESG000010347.1 SMESG000010327.1 dd_Smed_v4_593_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30011798SMESG000043477.1 SMESG000010549.1 SMESG000010347.1 SMESG000010327.1 dd_Smed_v4_593_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30011798SMESG000043477.1 SMESG000010549.1 SMESG000010347.1 SMESG000010327.1 dd_Smed_v4_593_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30011798SMESG000043477.1 SMESG000010549.1 SMESG000010347.1 SMESG000010327.1 dd_Smed_v4_593_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30011798SMESG000043477.1 SMESG000010549.1 SMESG000010347.1 SMESG000010327.1 dd_Smed_v4_593_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30011798SMESG000043477.1 SMESG000010549.1 SMESG000010347.1 SMESG000010327.1 dd_Smed_v4_593_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30011798SMESG000043477.1 SMESG000010549.1 SMESG000010347.1 SMESG000010327.1 dd_Smed_v4_593_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30011798SMESG000078691.1 SMESG000070088.1 SMESG000066677.1 SMESG000051450.1 SMESG000049178.1 SMESG000048320.1 SMESG000047889.1 SMESG000042542.1 SMESG000033144.1 SMESG000022579.1 SMESG000010579.1 SMESG000010549.1 SMESG000010548.1 SMESG000010546.1 SMESG000010469.1 SMESG000010468.1 SMESG000010222.1 SMESG000010218.1 SMESG000009697.1 Contig19174uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30011798SMESG000078691.1 SMESG000070088.1 SMESG000066677.1 SMESG000051450.1 SMESG000049178.1 SMESG000048320.1 SMESG000047889.1 SMESG000042542.1 SMESG000033144.1 SMESG000022579.1 SMESG000010579.1 SMESG000010549.1 SMESG000010548.1 SMESG000010546.1 SMESG000010469.1 SMESG000010468.1 SMESG000010222.1 SMESG000010218.1 SMESG000009697.1 Contig19174newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30011798SMESG000051647.1 SMESG000049178.1 SMESG000024483.1 SMESG000016676.1 SMESG000010581.1 SMESG000010580.1 SMESG000010579.1 SMESG000010549.1 SMESG000010548.1 SMESG000010546.1 SMESG000010468.1 SMESG000010222.1 SMESG000010218.1 SMESG000003397.1 Contig13357uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30011798SMESG000051647.1 SMESG000049178.1 SMESG000024483.1 SMESG000016676.1 SMESG000010581.1 SMESG000010580.1 SMESG000010579.1 SMESG000010549.1 SMESG000010548.1 SMESG000010546.1 SMESG000010468.1 SMESG000010222.1 SMESG000010218.1 SMESG000003397.1 Contig13357newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30011798SMESG000019970.1 SMESG000019968.1 SMESG000019959.1 SMESG000019761.1 SMESG000010368.1 SMESG000010348.1 SMESG000010322.1 SMESG000019776.1 SMESG000010338.1 SMESG000010333.1 SMESG000010321.1 SMESG000043477.1 SMESG000010347.1 SMESG000010327.1 SMESG000043474.1 SMESG000049178.1 SMESG000010579.1 SMESG000010549.1 SMESG000010548.1 SMESG000010546.1 SMESG000010468.1 SMESG000010467.1 SMESG000010222.1 SMESG000010218.1 SMESG000010217.1 SMESG000019966.1 SMESG000010464.1 SMESG000010469.1 SMESG000019962.1 dd_Smed_v6_593_1dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30011798SMESG000019970.1 SMESG000019968.1 SMESG000019959.1 SMESG000019761.1 SMESG000010368.1 SMESG000010348.1 SMESG000010322.1 SMESG000019776.1 SMESG000010338.1 SMESG000010333.1 SMESG000010321.1 SMESG000043477.1 SMESG000010347.1 SMESG000010327.1 SMESG000043474.1 SMESG000049178.1 SMESG000010579.1 SMESG000010549.1 SMESG000010548.1 SMESG000010546.1 SMESG000010468.1 SMESG000010467.1 SMESG000010222.1 SMESG000010218.1 SMESG000010217.1 SMESG000019966.1 SMESG000010464.1 SMESG000010469.1 SMESG000019962.1 dd_Smed_v6_593_1dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
intestinal phagocyteSMED30011798SMESG000019970.1 SMESG000019968.1 SMESG000019959.1 SMESG000019761.1 SMESG000010368.1 SMESG000010348.1 SMESG000010322.1 SMESG000019776.1 SMESG000010338.1 SMESG000010333.1 SMESG000010321.1 SMESG000043477.1 SMESG000010347.1 SMESG000010327.1 SMESG000043474.1 SMESG000049178.1 SMESG000010579.1 SMESG000010549.1 SMESG000010548.1 SMESG000010546.1 SMESG000010468.1 SMESG000010467.1 SMESG000010222.1 SMESG000010218.1 SMESG000010217.1 SMESG000019966.1 SMESG000010464.1 SMESG000010469.1 SMESG000019962.1 dd_Smed_v6_593_1dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30011798SMESG000019970.1 SMESG000019968.1 SMESG000019959.1 SMESG000019761.1 SMESG000010368.1 SMESG000010348.1 SMESG000010322.1 SMESG000019776.1 SMESG000010338.1 SMESG000010333.1 SMESG000010321.1 SMESG000043477.1 SMESG000010347.1 SMESG000010327.1 SMESG000043474.1 SMESG000049178.1 SMESG000010579.1 SMESG000010549.1 SMESG000010548.1 SMESG000010546.1 SMESG000010468.1 SMESG000010467.1 SMESG000010222.1 SMESG000010218.1 SMESG000010217.1 SMESG000019966.1 SMESG000010464.1 SMESG000010469.1 SMESG000019962.1 dd_Smed_v6_593_1dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30011798SMESG000019970.1 SMESG000019968.1 SMESG000019959.1 SMESG000019761.1 SMESG000010368.1 SMESG000010348.1 SMESG000010322.1 SMESG000019776.1 SMESG000010338.1 SMESG000010333.1 SMESG000010321.1 SMESG000043477.1 SMESG000010347.1 SMESG000010327.1 SMESG000043474.1 SMESG000049178.1 SMESG000010579.1 SMESG000010549.1 SMESG000010548.1 SMESG000010546.1 SMESG000010468.1 SMESG000010467.1 SMESG000010222.1 SMESG000010218.1 SMESG000010217.1 SMESG000019966.1 SMESG000010464.1 SMESG000010469.1 SMESG000019962.1 dd_Smed_v6_593_1dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30011798SMESG000043477.1 SMESG000010549.1 SMESG000010347.1 SMESG000010327.1 dd_Smed_v4_593_1_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30011798SMESG000043477.1 SMESG000010549.1 SMESG000010347.1 SMESG000010327.1 dd_Smed_v4_593_1_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30011798SMESG000043477.1 SMESG000010549.1 SMESG000010347.1 SMESG000010327.1 dd_Smed_v4_593_1_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Human
Match: EHMT1 (euchromatic histone lysine methyltransferase 1 [Source:HGNC Symbol;Acc:HGNC:24650])

HSP 1 Score: 50.0618 bits (118), Expect = 1.316e-6
Identity = 36/104 (34.62%), Postives = 52/104 (50.00%), Query Frame = 1
Query:  172 SLLHLAVKCLKPDICSSLLNAGAHVNNINNFGNSPLLEMLNDAQLVANENNLNKSIEITKILIGSGADVSAQLSNGITAFQLAANIGSEELMLALVSNNPKLIN 483
            S LH A +    DIC  L+ AGA+++  +    +PL+E        A ENN    +E  K LI +GA V  + + G T   LAA  G  E++  L+SN    +N
Sbjct:    1 SPLHAAAEAGHVDICHMLVQAGANIDTCSEDQRTPLME--------AAENN---HLEAVKYLIKAGALVDPKDAEGSTCLHLAAKKGHYEVVQYLLSNGQMDVN 93          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Human
Match: EHMT1 (euchromatic histone lysine methyltransferase 1 [Source:HGNC Symbol;Acc:HGNC:24650])

HSP 1 Score: 52.373 bits (124), Expect = 2.621e-6
Identity = 41/122 (33.61%), Postives = 58/122 (47.54%), Query Frame = 1
Query:  118 FVDRLDLRSSNVHDGNNNSLLHLAVKCLKPDICSSLLNAGAHVNNINNFGNSPLLEMLNDAQLVANENNLNKSIEITKILIGSGADVSAQLSNGITAFQLAANIGSEELMLALVSNNPKLIN 483
             VD +D      H  N  S LH A +    DIC  L+ AGA+++  +    +PL+E        A ENN    +E  K LI +GA V  + + G T   LAA  G  E++  L+SN    +N
Sbjct:  727 LVDGIDPNFKMEHQ-NKRSPLHAAAEAGHVDICHMLVQAGANIDTCSEDQRTPLME--------AAENN---HLEAVKYLIKAGALVDPKDAEGSTCLHLAAKKGHYEVVQYLLSNGQMDVN 836          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Human
Match: EHMT1 (euchromatic histone lysine methyltransferase 1 [Source:HGNC Symbol;Acc:HGNC:24650])

HSP 1 Score: 52.373 bits (124), Expect = 2.655e-6
Identity = 41/122 (33.61%), Postives = 58/122 (47.54%), Query Frame = 1
Query:  118 FVDRLDLRSSNVHDGNNNSLLHLAVKCLKPDICSSLLNAGAHVNNINNFGNSPLLEMLNDAQLVANENNLNKSIEITKILIGSGADVSAQLSNGITAFQLAANIGSEELMLALVSNNPKLIN 483
             VD +D      H  N  S LH A +    DIC  L+ AGA+++  +    +PL+E        A ENN    +E  K LI +GA V  + + G T   LAA  G  E++  L+SN    +N
Sbjct:  758 LVDGIDPNFKMEHQ-NKRSPLHAAAEAGHVDICHMLVQAGANIDTCSEDQRTPLME--------AAENN---HLEAVKYLIKAGALVDPKDAEGSTCLHLAAKKGHYEVVQYLLSNGQMDVN 867          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Human
Match: EHMT1 (euchromatic histone lysine methyltransferase 1 [Source:HGNC Symbol;Acc:HGNC:24650])

HSP 1 Score: 50.8322 bits (120), Expect = 3.838e-6
Identity = 36/102 (35.29%), Postives = 51/102 (50.00%), Query Frame = 1
Query:  163 NNNSLLHLAVKCLKPDICSSLLNAGAHVNNINNFGNSPLLEMLNDAQLVANENNLNKSIEITKILIGSGADVSAQLSNGITAFQLAANIGSEELMLALVSNN 468
            N  S LH A +    DIC  L+ AGA+++  +    +PL+E        A ENN    +E  K LI +GA V  + + G T   LAA  G  E++  L+SN 
Sbjct:   70 NKRSPLHAAAEAGHVDICHMLVQAGANIDTCSEDQRTPLME--------AAENN---HLEAVKYLIKAGALVDPKDAEGSTCLHLAAKKGHYEVVQYLLSNG 160          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Human
Match: EHMT1 (euchromatic histone lysine methyltransferase 1 [Source:HGNC Symbol;Acc:HGNC:24650])

HSP 1 Score: 50.8322 bits (120), Expect = 7.411e-6
Identity = 37/107 (34.58%), Postives = 53/107 (49.53%), Query Frame = 1
Query:  163 NNNSLLHLAVKCLKPDICSSLLNAGAHVNNINNFGNSPLLEMLNDAQLVANENNLNKSIEITKILIGSGADVSAQLSNGITAFQLAANIGSEELMLALVSNNPKLIN 483
            N  S LH A +    DIC  L+ AGA+++  +    +PL+E        A ENN    +E  K LI +GA V  + + G T   LAA  G  E++  L+SN    +N
Sbjct:  391 NKRSPLHAAAEAGHVDICHMLVQAGANIDTCSEDQRTPLME--------AAENN---HLEAVKYLIKAGALVDPKDAEGSTCLHLAAKKGHYEVVQYLLSNGQMDVN 486          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Fly
Match: mib2 (gene:FBgn0086442 transcript:FBtr0336840)

HSP 1 Score: 55.8398 bits (133), Expect = 9.794e-8
Identity = 21/48 (43.75%), Postives = 32/48 (66.67%), Query Frame = 1
Query: 1213 DANICTICMEKRLNIRFQCGHLCCSDCADQIFNCHMCRIEILSKERIF 1356
            +++ C ICME++ ++ F CGH  CS CA+ +  CHMCR  IL K  ++
Sbjct: 1002 ESHFCGICMERKRDVAFLCGHGACSHCAETLRTCHMCRKTILKKINLY 1049          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Fly
Match: mib2 (gene:FBgn0086442 transcript:FBtr0081142)

HSP 1 Score: 55.8398 bits (133), Expect = 9.794e-8
Identity = 21/48 (43.75%), Postives = 32/48 (66.67%), Query Frame = 1
Query: 1213 DANICTICMEKRLNIRFQCGHLCCSDCADQIFNCHMCRIEILSKERIF 1356
            +++ C ICME++ ++ F CGH  CS CA+ +  CHMCR  IL K  ++
Sbjct: 1002 ESHFCGICMERKRDVAFLCGHGACSHCAETLRTCHMCRKTILKKINLY 1049          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Fly
Match: mib2 (gene:FBgn0086442 transcript:FBtr0336841)

HSP 1 Score: 55.8398 bits (133), Expect = 9.794e-8
Identity = 21/48 (43.75%), Postives = 32/48 (66.67%), Query Frame = 1
Query: 1213 DANICTICMEKRLNIRFQCGHLCCSDCADQIFNCHMCRIEILSKERIF 1356
            +++ C ICME++ ++ F CGH  CS CA+ +  CHMCR  IL K  ++
Sbjct: 1002 ESHFCGICMERKRDVAFLCGHGACSHCAETLRTCHMCRKTILKKINLY 1049          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. UniProt/SwissProt
Match: sp|Q4UMH6|Y381_RICFE (Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) OX=315456 GN=RF_0381 PE=4 SV=1)

HSP 1 Score: 62.7734 bits (151), Expect = 6.230e-9
Identity = 68/281 (24.20%), Postives = 123/281 (43.77%), Query Frame = 1
Query:  178 LHLAVKCLKPDICSSLLNAGAHVNNINNFGNSPLLEMLNDAQLVANENNLNKSIEITKILIGSGADVSAQLSNGITAFQLAANIGSEELMLALVSNNPKLINFISIDFKLPFQNQWFAYAEALIKLLPDNFLSSNITKNIFHLCR---NEHKLIQLLFDKSSPELQQSILESLLYDAVNADENELFKHLVRTEILLPGQLETGETLLTFMIKENKFLFAKNLLKSINKKKFVNLKNRRNQSAVQLAIEADQFDLIDLMIHETEGLDCEDSDGKSALAQLME 1011
            LH AV     D+ S L++ GA VN   N G + L   ++             S ++  +LI  GADV+A+  NG T    A   G+ +L+  L+ N   + N  +I      ++        LIK   D    +N  + I H      N + +  L+ +K+    + +  E++L+ A  +    L   L++ +  +  +  +GET+L F  K         L+K+   K  ++ K    ++ +  A E+   +L+ L+IH    ++ +  DG +AL   +E
Sbjct:  741 LHYAVYDGNLDLVSLLISHGADVNAKTNSGETILYSAVDYG-----------SPDLVYLLIAYGADVNAKTDNGETVLHYAVESGNLDLVSLLIHNGANVNNAKTI-LHFAAKSGNLNLVNWLIKNKADIHAKTNSGETILHFAAESGNLNLVNWLIKNKADIHAKTNSGETILHFAAKSGNLNLVNWLIKNKADIHAKTNSGETILHFAAKSGNLNLVNWLIKN---KADIHAKTNSGETILHFAAESGNLNLVSLLIHNGTDINTKTDDGLTALHYAVE 1006          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. UniProt/SwissProt
Match: sp|Q9SAL0|RGLG4_ARATH (E3 ubiquitin-protein ligase RGLG4 OS=Arabidopsis thaliana OX=3702 GN=RGLG4 PE=1 SV=1)

HSP 1 Score: 57.3806 bits (137), Expect = 1.983e-7
Identity = 21/62 (33.87%), Postives = 37/62 (59.68%), Query Frame = 1
Query: 1174 HGRLPTFLNPAGND-ANICTICMEKRLNIRFQCGHLCCSDCADQIFNCHMCRIEILSKERIF 1356
            +  LP+  +PA  +    C IC+  R ++ F CGH+ C DC  +I NC +CR+ I ++ +++
Sbjct:  339 NAELPSTASPASPEQTQSCPICLTNRKDVAFSCGHMTCGDCGSKISNCPICRVRITNRLKLY 400          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. TrEMBL
Match: A0A3M7P2D4 (Spectrin beta non-erythrocytic 1-like OS=Brachionus plicatilis OX=10195 GN=BpHYR1_003323 PE=4 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 2.726e-9
Identity = 47/142 (33.10%), Postives = 69/142 (48.59%), Query Frame = 1
Query:  949 ETEGLDCEDSDGKSALAQLMEKLSICNNDQNYGRLISTVKSAMRSGGDIYKIRSNGRRIVDSCTNMDA----KAEIEEFHGRLPTFLNPAGNDANICTICMEKRLNIRFQCGHLCCSDCADQIFNCHMCRIEILSKERIFLN 1362
            + E +D +D D KS +  +            Y  + S +K+    G  I        +IVDS  N D+    K EI E   +L         +A +C ICME + +  FQCGH  C+ CA  + NCH+CR +ILSK +I++N
Sbjct:  175 DAEDIDVDDPDEKSIVTYV----------STYYHIFSKMKNEAVDGKSI-------DKIVDS--NEDSLNFSKTEIGELIEKLKNL-----EEAQLCPICMEHKKDTTFQCGHTVCNICAKPLVNCHICREKILSKIKIYVN 292          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. TrEMBL
Match: A0A224XE36 (Putative e3 ubiquitin-protein ligase mib1 isoform x2 (Fragment) OS=Panstrongylus lignarius OX=156445 PE=4 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 8.581e-9
Identity = 88/399 (22.06%), Postives = 170/399 (42.61%), Query Frame = 1
Query:  328 NKSIEITKILIGSGADVSAQLSNGITAFQLAANIGSEELMLALVSNNPKLINFISIDFKLPFQ----NQWFAYAEALIKLLPDNFLSSNITKNIFH--LCRNEHKLIQLLFDKSS--PELQQSILESLLYDAVNADENELFKHLVRT--EILLPGQLETGETLLTFMIKENKFLFAKNLLKSINKKKFVNLKNRRNQSAVQLAIEADQFDLIDLMIHETEGLDCEDSDGKSALAQLMEKLSICNNDQ-----NYGRLISTVKSA----------------MRSGGDIYKIRSNGRRIVDSCTNMD-AKAEIEEFHGRLPTFLNPAGNDANI----CTICMEKRLNIRFQ-CGHL-CCSDCADQIFNCHMCRIEILSKERI-------FLN*SIMNF*PC 1389
            N  I + K+L+   ADV  +  +G  A   AA  G+E  ++ L++     +N  +   + P        +    + L+KL     L  +      H  + +    ++ LL D ++      ++   +L + A+  + + ++  LV +    ++    + G T L      N F  AK L+   + K  ++++N   Q+A+ LA+E     ++ L++ E   L+  D DG + + + +   ++    Q     + GRL+  + S                   SG D+      G+  +D C + +  KA  +  + +    L+P   D ++    C +C + +    FQ CGH+ CCS CA ++  C +CR  +LS  +I       + N S++ F PC
Sbjct:  368 NGHINVVKLLLKQNADVEIEDKDGDRAVHHAA-FGNEPAVIELLAKAGADLNIRNSRRQTPLHIAVNKGYIGVVKTLLKLGCHPSLQDSEGDTPLHDAITKKYDDMVTLLLDHNADIKVANKNGFNALHHAALRGNPSAMWMLLVMSPRRWVVDEPKDDGYTALHLAALNNHFSVAKLLIH--HGKADMDIQNHNLQTALHLAVERQHAQIVRLLVREGANLNITDKDGDTPMHEALRHHTLSQIKQLQGVKDIGRLLMGLGSQDEVHEAKSSAAIACFLAGSGADLTIKNKKGQTPLDLCPDPNLYKALTKAHNDKEIDQLDPRKGDVDLCLEECLVCSDHKRETLFQPCGHVACCSTCAPRVKRCLICRESVLSTAKIDECMVCSYKNASVL-FKPC 762          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. TrEMBL
Match: A0A0P4VNN6 (Putative e3 ubiquitin-protein ligase mib1 OS=Rhodnius neglectus OX=72488 PE=2 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 1.333e-8
Identity = 88/399 (22.06%), Postives = 170/399 (42.61%), Query Frame = 1
Query:  328 NKSIEITKILIGSGADVSAQLSNGITAFQLAANIGSEELMLALVSNNPKLINFISIDFKLPFQ----NQWFAYAEALIKLLPDNFLSSNITKNIFH--LCRNEHKLIQLLFDKSS--PELQQSILESLLYDAVNADENELFKHLVRT--EILLPGQLETGETLLTFMIKENKFLFAKNLLKSINKKKFVNLKNRRNQSAVQLAIEADQFDLIDLMIHETEGLDCEDSDGKSALAQLMEKLSICNNDQ-----NYGRLISTVKSA----------------MRSGGDIYKIRSNGRRIVDSCTNMD-AKAEIEEFHGRLPTFLNPAGNDANI----CTICMEKRLNIRFQ-CGHL-CCSDCADQIFNCHMCRIEILSKERI-------FLN*SIMNF*PC 1389
            N  I + K+L+   ADV  +  +G  A   AA  G+E  ++ L++     +N  +   + P        +    + L+KL     L  +      H  + +    ++ LL D ++      ++   +L + A+  + + ++  LV +    ++    + G T L      N F  AK L+   + K  ++++N   Q+A+ LA+E     ++ L++ E   L+  D DG + + + +   ++    Q     + GRL+  + S                   SG D+      G+  +D C + +  KA  +  + +    L+P   D ++    C +C + +    FQ CGH+ CCS CA ++  C +CR  +LS  +I       + N S++ F PC
Sbjct:  464 NGHINVVKLLLKQNADVEIEDKDGDRAVHHAA-FGNEPAVIELLAKAGADLNIRNSRRQTPLHIAVNKGYIGVVKTLLKLGCHPSLQDSEGDTPLHDAITKKYDDMVTLLLDHNADIKVANKNGFNALHHAALRGNPSAMWMLLVMSPRRWVVDEPKDDGYTALHLAALNNHFSVAKLLIH--HGKADMDIQNHNLQTALHLAVERQHAQIVRLLVREGANLNITDKDGDTPMHEALRHHTLSQIKQLQGVKDIGRLLMGLGSQDEVHEAKSSAAIACFLAGSGADLTIKNKKGQTPLDLCPDPNLYKALTKAHNDKEIDQLDPRKGDVDLCLEECLVCSDHKRETLFQPCGHVACCSTCAPRVKRCLICRESVLSTAKIDECMVCSYKNASVL-FKPC 858          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. TrEMBL
Match: A0A069DZQ0 (Putative e3 ubiquitin-protein ligase mib1 OS=Panstrongylus megistus OX=65343 PE=2 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 1.348e-8
Identity = 88/399 (22.06%), Postives = 170/399 (42.61%), Query Frame = 1
Query:  328 NKSIEITKILIGSGADVSAQLSNGITAFQLAANIGSEELMLALVSNNPKLINFISIDFKLPFQ----NQWFAYAEALIKLLPDNFLSSNITKNIFH--LCRNEHKLIQLLFDKSS--PELQQSILESLLYDAVNADENELFKHLVRT--EILLPGQLETGETLLTFMIKENKFLFAKNLLKSINKKKFVNLKNRRNQSAVQLAIEADQFDLIDLMIHETEGLDCEDSDGKSALAQLMEKLSICNNDQ-----NYGRLISTVKSA----------------MRSGGDIYKIRSNGRRIVDSCTNMD-AKAEIEEFHGRLPTFLNPAGNDANI----CTICMEKRLNIRFQ-CGHL-CCSDCADQIFNCHMCRIEILSKERI-------FLN*SIMNF*PC 1389
            N  I + K+L+   ADV  +  +G  A   AA  G+E  ++ L++     +N  +   + P        +    + L+KL     L  +      H  + +    ++ LL D ++      ++   +L + A+  + + ++  LV +    ++    + G T L      N F  AK L+   + K  ++++N   Q+A+ LA+E     ++ L++ E   L+  D DG + + + +   ++    Q     + GRL+  + S                   SG D+      G+  +D C + +  KA  +  + +    L+P   D ++    C +C + +    FQ CGH+ CCS CA ++  C +CR  +LS  +I       + N S++ F PC
Sbjct:  464 NGHINVVKLLLKQNADVEIEDKDGDRAVHHAA-FGNEPAVIELLAKAGADLNIRNSRRQTPLHIAVNKGYIGVVKTLLKLGCHPSLQDSEGDTPLHDAITKKYDDMVTLLLDHNADIKVANKNGFNALHHAALRGNPSAMWMLLVMSPRRWVVDEPKDDGYTALHLAALNNHFSVAKLLIH--HGKADMDIQNHNLQTALHLAVERQHAQIVRLLVREGANLNITDKDGDTPMHEALRHHTLSQIKQLQGVKDIGRLLMGLGSQDEVHEAKSSAAIACFLAGSGADLTIKNKKGQTPLDLCPDPNLYKALTKAHNDKEIDQLDPRKGDVDLCLEECLVCSDHKRETLFQPCGHVACCSTCAPRVKRCLICRESVLSTAKIDECMVCSYKNASVL-FKPC 858          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. TrEMBL
Match: A0A0V0G4N4 (Putative e3 ubiquitin-protein ligase mib1 OS=Triatoma dimidiata OX=72491 PE=4 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 1.522e-8
Identity = 88/399 (22.06%), Postives = 170/399 (42.61%), Query Frame = 1
Query:  328 NKSIEITKILIGSGADVSAQLSNGITAFQLAANIGSEELMLALVSNNPKLINFISIDFKLPFQ----NQWFAYAEALIKLLPDNFLSSNITKNIFH--LCRNEHKLIQLLFDKSS--PELQQSILESLLYDAVNADENELFKHLVRT--EILLPGQLETGETLLTFMIKENKFLFAKNLLKSINKKKFVNLKNRRNQSAVQLAIEADQFDLIDLMIHETEGLDCEDSDGKSALAQLMEKLSICNNDQ-----NYGRLISTVKSA----------------MRSGGDIYKIRSNGRRIVDSCTNMD-AKAEIEEFHGRLPTFLNPAGNDANI----CTICMEKRLNIRFQ-CGHL-CCSDCADQIFNCHMCRIEILSKERI-------FLN*SIMNF*PC 1389
            N  I + K+L+   ADV  +  +G  A   AA  G+E  ++ L++     +N  +   + P        +    + L+KL     L  +      H  + +    ++ LL D ++      ++   +L + A+  + + ++  LV +    ++    + G T L      N F  AK L+   + K  ++++N   Q+A+ LA+E     ++ L++ E   L+  D DG + + + +   ++    Q     + GRL+  + S                   SG D+      G+  +D C + +  KA  +  + +    L+P   D ++    C +C + +    FQ CGH+ CCS CA ++  C +CR  +LS  +I       + N S++ F PC
Sbjct:  464 NGHINVVKLLLKQNADVEIEDKDGDRAVHHAA-FGNEPAVIELLAKAGADLNIRNSRRQTPLHIAVNKGYIGVVKTLLKLGCHPSLQDSEGDTPLHDAITKKYDDMVTLLLDHNADIKVANKNGFNALHHAALRGNPSAMWMLLVMSPRRWVVDEPKDDGYTALHLAALNNHFSVAKLLIH--HGKADMDIQNHNLQTALHLAVERQHAQIVRLLVREGANLNITDKDGDTPMHEALRHHTLSQIKQLQGVKDIGRLLMGLGSQDEVHEAKSSAAIACFLAGSGADLTIKNKKGQTPLDLCPDPNLYKALTKAHNDKEIDQLDPRKGDVDLCLEECLVCSDHKRETLFQPCGHVACCSTCAPRVKRCLICRESVLSTAKIDECMVCSYKNASVL-FKPC 858          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Cavefish
Match: ENSAMXT00000048767.1 (serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B-like [Source:NCBI gene;Acc:103025232])

HSP 1 Score: 52.373 bits (124), Expect = 1.522e-6
Identity = 64/286 (22.38%), Postives = 124/286 (43.36%), Query Frame = 1
Query:  163 NNNSLLHLAVKCLKPDICSSLLNAGAHVNNINNFGNSPLLEMLNDAQLVANENNLNKSIEITKILIGSGADVSAQLSNGITAFQLAANIGSEELMLALVSNNPKLINFISIDFKLPFQNQWFAYAEALIKLLPDNFLSSNITKNIFHLCRNEHKLIQLLFDKSSPELQQSILESLLYDAVNADENELFKHLVRTEI-----LLPGQLETGETLLTFMIKENKFLFAKNLLKSINKKKF---VNLKNRRNQSAVQLAIEADQFDLIDLMIHETEGLDCEDSDGKSAL 996
            +  + LH+AV+  KP +   LL  GA V      G   L   L+ A  V       +  ++ ++L+ SGA+V+A+  NG TA  +AA  G+ ++M AL      L  + S   + P           +++ +  N LSS  ++    LC  +        +  S E    +   L  + V+ DE ++   ++RT +     +     + GET L +  +       + +L ++   +    +N  ++  +S + LA E     ++ +++  +  +D  D +G +AL
Sbjct:  353 DGQTALHIAVQNCKPQVVQMLLGFGAQVQL---RGGKDLETPLHVAARV------KEGEKVAEMLLKSGAEVNAEQENGETAMHVAARYGALQMMRALTEEGADL-TWRSKVGETPLHVAVHHCHAHMVEAI-LNSLSSERSREEAELCVRQ--------ENQSGETALHLAAELKNETVHRDEEDVV--IIRTLMEYNADITAATRQMGETPLHYCARVGNAAVLQEMLDNVPSSRLQSAINKHSKNGRSPLLLAAERGHTAVVRVLLENSARVDVFDEEGIAAL 617          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Cavefish
Match: ENSAMXT00000016978.2 (serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B-like [Source:NCBI gene;Acc:103025232])

HSP 1 Score: 51.9878 bits (123), Expect = 1.854e-6
Identity = 64/286 (22.38%), Postives = 124/286 (43.36%), Query Frame = 1
Query:  163 NNNSLLHLAVKCLKPDICSSLLNAGAHVNNINNFGNSPLLEMLNDAQLVANENNLNKSIEITKILIGSGADVSAQLSNGITAFQLAANIGSEELMLALVSNNPKLINFISIDFKLPFQNQWFAYAEALIKLLPDNFLSSNITKNIFHLCRNEHKLIQLLFDKSSPELQQSILESLLYDAVNADENELFKHLVRTEI-----LLPGQLETGETLLTFMIKENKFLFAKNLLKSINKKKF---VNLKNRRNQSAVQLAIEADQFDLIDLMIHETEGLDCEDSDGKSAL 996
            +  + LH+AV+  KP +   LL  GA V      G   L   L+ A  V       +  ++ ++L+ SGA+V+A+  NG TA  +AA  G+ ++M AL      L  + S   + P           +++ +  N LSS  ++    LC  +        +  S E    +   L  + V+ DE ++   ++RT +     +     + GET L +  +       + +L ++   +    +N  ++  +S + LA E     ++ +++  +  +D  D +G +AL
Sbjct:  353 DGQTALHIAVQNCKPQVVQMLLGFGAQVQL---RGGKDLETPLHVAARV------KEGEKVAEMLLKSGAEVNAEQENGETAMHVAARYGALQMMRALTEEGADL-TWRSKVGETPLHVAVHHCHAHMVEAI-LNSLSSERSREEAELCVRQ--------ENQSGETALHLAAELKNETVHRDEEDVV--IIRTLMEYNADITAATRQMGETPLHYCARVGNAAVLQEMLDNVPSSRLQSAINKHSKNGRSPLLLAAERGHTAVVRVLLENSARVDVFDEEGIAAL 617          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Cavefish
Match: mib2 (mindbomb E3 ubiquitin protein ligase 2 [Source:NCBI gene;Acc:103034310])

HSP 1 Score: 50.447 bits (119), Expect = 4.965e-6
Identity = 94/406 (23.15%), Postives = 156/406 (38.42%), Query Frame = 1
Query:  397 GITAFQLAANIGSEELMLALVSNNPKLINFISIDFKLPFQNQWFAYAEALIKLLPDNFLSSNITKN----IFHLCRNEH--KLIQLLFDKSSP-ELQQSILESLLYDAVNADENELFKHLVRTEILLPG-----QLETGETLLTFM-IKENKFL-------------------FAKNLLKSINKKKFV------------NLKNRRNQSAVQLAIEADQFDLIDLMIHETEGLDCEDSDGKSAL------AQLMEKLSICNNDQN--YGRLIST---------VKSAM-----RSGGDIYKIRSNGRRIVDSCTNMDAKAEIEEF-----------------HGRLPTFLN---PAGNDANICTICMEKRLNIRFQ-CGH-LCCSDCADQIFNCHMCRIEILSKER 1350
            G TA Q+AA+ G  E++  L+  N   I     D         F     + +LL     + N+  N      H+  N+    ++++L + S+   LQ S  ++ L+DA+  D    F+ ++    ++P      Q   G  LL    +K NK                     F+   L ++N  + V            N++N RNQ+ +QLA+      L+ L++ E   ++ ED +G +A+       QL   LS    + +  Y RL S+         V +A+     + G DI      G+  +D  T+      I  F                 H    T  N   P+    + C IC E  L + F  C H + C +CA ++  C  C++ I  K R
Sbjct:  466 GKTALQVAAHQGHMEVVKVLLQANSS-IEAKDEDGDAALHYTAFGNQAEIARLLLSKGANVNLLNNSMCTALHIAVNKGFTDVVRVLTEHSADVNLQDSYGDTPLHDAIAKD----FRSIIEILTVVPNIDFTQQNNRGFNLLHHAALKGNKLATEMILSRARQLADVKKEDGFSALHLAALNNHRDVAEILVKEGRCDANIRNNRNQTPLQLAVTQGHVALVALLVSEGADVNAEDEEGDTAMHTALSRQQLTNMLSTSEREASALYCRLSSSGLLGNTELNVGAAIACFLAQEGADINYANHKGKSPLDLVTDSTTLQLIRSFSEKHRYVVSSSSSLRRVHTTPNTMTNLAMPSAPGPSECLICSELALLVLFSPCQHSVACEECAHRMKKCIKCQVTITKKIR 866          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Medaka
Match: mib2 (mindbomb E3 ubiquitin protein ligase 2 [Source:NCBI gene;Acc:101175479])

HSP 1 Score: 52.373 bits (124), Expect = 1.238e-6
Identity = 95/427 (22.25%), Postives = 163/427 (38.17%), Query Frame = 1
Query:  397 GITAFQLAANIGSEELMLALVSNNPKLINFISIDFKLPFQNQWFAYAEALIKLLPDNFLSSNITKN----IFHLCRNEH--KLIQLLFDKSSP-ELQQSILESLLYDAVNADENELFKHLVRTEILLPG-----QLETGETLLTFM-IKENKFLFAKNLLKS---INKKKF----------------------------VNLKNRRNQSAVQLAIEADQFDLIDLMIHETEGLDCEDSDGKSA---------LAQLMEKLSI-----------CNNDQNYGRLIS---------TVKSAM-----RSGGDIYKIRSNGRRIVD--------------------------SCTNMDAKAEIEEFHGRLPTFLN---PAGNDANICTICMEKRLNIRF-QCGH-LCCSDCADQIFNCHMCRIEILSKER 1350
            G TA Q+AA+ G  E++ AL+  N   +     D         F     + +LL     + N+  N      H+  N+    ++++L + S+   LQ S  ++ L+DA+  D    F+ ++   +++P      Q   G  LL    +K NK    K L ++   ++ KK                             +N++N RNQ+A+QLA+     +L+ L++ E   ++ ED DG +A         LA +M   ++           C+    +GRL S         +V +A+     + G DI      G+  +D                          +C    + A +   H    T  N   P     + C IC E  L + F  C H + C +CA ++  C  C++ I  K R
Sbjct:  457 GKTALQVAAHQGHMEVVKALLQANCS-VEVKDEDGDTALHYAAFGNQAEIARLLLSKGANVNLLNNSMCTALHIAVNKGFTDVVRVLTEHSADVNLQDSYGDTPLHDAIAKD----FRSIIEMLVVVPSIDFTQQNHRGFNLLHHAALKGNKLATEKILARARQLVDVKKDDGFSALHLAALNNHRDVAEVLVKEGRCDINVRNNRNQTALQLAVTQGHTELVQLLVDEGADVNMEDEDGDTAMHVALLRPQLANVMLSPAVGTGATEDNSEGCSPTTLHGRLSSSGLLGNGELSVGTAIACFLAQEGADINYANHKGKSPLDLLADSGALQLIKSFSEKHRLQRLQAITCGQGLSSASLRRVHTTPNTMTNLVLPTPPGPSECLICSELALLVLFCPCQHSVACEECAHRMKKCIKCQVTITKKIR 878          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Medaka
Match: mib2 (mindbomb E3 ubiquitin protein ligase 2 [Source:NCBI gene;Acc:101175479])

HSP 1 Score: 52.373 bits (124), Expect = 1.321e-6
Identity = 95/427 (22.25%), Postives = 163/427 (38.17%), Query Frame = 1
Query:  397 GITAFQLAANIGSEELMLALVSNNPKLINFISIDFKLPFQNQWFAYAEALIKLLPDNFLSSNITKN----IFHLCRNEH--KLIQLLFDKSSP-ELQQSILESLLYDAVNADENELFKHLVRTEILLPG-----QLETGETLLTFM-IKENKFLFAKNLLKS---INKKKF----------------------------VNLKNRRNQSAVQLAIEADQFDLIDLMIHETEGLDCEDSDGKSA---------LAQLMEKLSI-----------CNNDQNYGRLIS---------TVKSAM-----RSGGDIYKIRSNGRRIVD--------------------------SCTNMDAKAEIEEFHGRLPTFLN---PAGNDANICTICMEKRLNIRF-QCGH-LCCSDCADQIFNCHMCRIEILSKER 1350
            G TA Q+AA+ G  E++ AL+  N   +     D         F     + +LL     + N+  N      H+  N+    ++++L + S+   LQ S  ++ L+DA+  D    F+ ++   +++P      Q   G  LL    +K NK    K L ++   ++ KK                             +N++N RNQ+A+QLA+     +L+ L++ E   ++ ED DG +A         LA +M   ++           C+    +GRL S         +V +A+     + G DI      G+  +D                          +C    + A +   H    T  N   P     + C IC E  L + F  C H + C +CA ++  C  C++ I  K R
Sbjct:  582 GKTALQVAAHQGHMEVVKALLQANCS-VEVKDEDGDTALHYAAFGNQAEIARLLLSKGANVNLLNNSMCTALHIAVNKGFTDVVRVLTEHSADVNLQDSYGDTPLHDAIAKD----FRSIIEMLVVVPSIDFTQQNHRGFNLLHHAALKGNKLATEKILARARQLVDVKKDDGFSALHLAALNNHRDVAEVLVKEGRCDINVRNNRNQTALQLAVTQGHTELVQLLVDEGADVNMEDEDGDTAMHVALLRPQLANVMLSPAVGTGATEDNSEGCSPTTLHGRLSSSGLLGNGELSVGTAIACFLAQEGADINYANHKGKSPLDLLADSGALQLIKSFSEKHRLQRLQAITCGQGLSSASLRRVHTTPNTMTNLVLPTPPGPSECLICSELALLVLFCPCQHSVACEECAHRMKKCIKCQVTITKKIR 1003          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Medaka
Match: mib2 (mindbomb E3 ubiquitin protein ligase 2 [Source:NCBI gene;Acc:101175479])

HSP 1 Score: 51.9878 bits (123), Expect = 1.730e-6
Identity = 95/428 (22.20%), Postives = 163/428 (38.08%), Query Frame = 1
Query:  394 NGITAFQLAANIGSEELMLALVSNNPKLINFISIDFKLPFQNQWFAYAEALIKLLPDNFLSSNITKN----IFHLCRNEH--KLIQLLFDKSSP-ELQQSILESLLYDAVNADENELFKHLVRTEILLPG-----QLETGETLLTFM-IKENKFLFAKNLLKS---INKKKF----------------------------VNLKNRRNQSAVQLAIEADQFDLIDLMIHETEGLDCEDSDGKSA---------LAQLMEKLSI-----------CNNDQNYGRLIS---------TVKSAM-----RSGGDIYKIRSNGRRIVD--------------------------SCTNMDAKAEIEEFHGRLPTFLN---PAGNDANICTICMEKRLNIRF-QCGH-LCCSDCADQIFNCHMCRIEILSKER 1350
             G TA Q+AA+ G  E++ AL+  N   +     D         F     + +LL     + N+  N      H+  N+    ++++L + S+   LQ S  ++ L+DA+  D    F+ ++   +++P      Q   G  LL    +K NK    K L ++   ++ KK                             +N++N RNQ+A+QLA+     +L+ L++ E   ++ ED DG +A         LA +M   ++           C+    +GRL S         +V +A+     + G DI      G+  +D                          +C    + A +   H    T  N   P     + C IC E  L + F  C H + C +CA ++  C  C++ I  K R
Sbjct:  581 QGKTALQVAAHQGHMEVVKALLQANCS-VEVKDEDGDTALHYAAFGNQAEIARLLLSKGANVNLLNNSMCTALHIAVNKGFTDVVRVLTEHSADVNLQDSYGDTPLHDAIAKD----FRSIIEMLVVVPSIDFTQQNHRGFNLLHHAALKGNKLATEKILARARQLVDVKKDDGFSALHLAALNNHRDVAEVLVKEGRCDINVRNNRNQTALQLAVTQGHTELVQLLVDEGADVNMEDEDGDTAMHVALLRPQLANVMLSPAVGTGATEDNSEGCSPTTLHGRLSSSGLLGNGELSVGTAIACFLAQEGADINYANHKGKSPLDLLADSGALQLIKSFSEKHRLQRLQAITCGQGLSSASLRRVHTTPNTMTNLVLPTPPGPSECLICSELALLVLFCPCQHSVACEECAHRMKKCIKCQVTITKKIR 1003          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Medaka
Match: mib2 (mindbomb E3 ubiquitin protein ligase 2 [Source:NCBI gene;Acc:101175479])

HSP 1 Score: 51.9878 bits (123), Expect = 1.830e-6
Identity = 95/427 (22.25%), Postives = 163/427 (38.17%), Query Frame = 1
Query:  397 GITAFQLAANIGSEELMLALVSNNPKLINFISIDFKLPFQNQWFAYAEALIKLLPDNFLSSNITKN----IFHLCRNEH--KLIQLLFDKSSP-ELQQSILESLLYDAVNADENELFKHLVRTEILLPG-----QLETGETLLTFM-IKENKFLFAKNLLKS---INKKKF----------------------------VNLKNRRNQSAVQLAIEADQFDLIDLMIHETEGLDCEDSDGKSA---------LAQLMEKLSI-----------CNNDQNYGRLIS---------TVKSAM-----RSGGDIYKIRSNGRRIVD--------------------------SCTNMDAKAEIEEFHGRLPTFLN---PAGNDANICTICMEKRLNIRF-QCGH-LCCSDCADQIFNCHMCRIEILSKER 1350
            G TA Q+AA+ G  E++ AL+  N   +     D         F     + +LL     + N+  N      H+  N+    ++++L + S+   LQ S  ++ L+DA+  D    F+ ++   +++P      Q   G  LL    +K NK    K L ++   ++ KK                             +N++N RNQ+A+QLA+     +L+ L++ E   ++ ED DG +A         LA +M   ++           C+    +GRL S         +V +A+     + G DI      G+  +D                          +C    + A +   H    T  N   P     + C IC E  L + F  C H + C +CA ++  C  C++ I  K R
Sbjct:  526 GKTALQVAAHQGHMEVVKALLQANCS-VEVKDEDGDTALHYAAFGNQAEIARLLLSKGANVNLLNNSMCTALHIAVNKGFTDVVRVLTEHSADVNLQDSYGDTPLHDAIAKD----FRSIIEMLVVVPSIDFTQQNHRGFNLLHHAALKGNKLATEKILARARQLVDVKKDDGFSALHLAALNNHRDVAEVLVKEGRCDINVRNNRNQTALQLAVTQGHTELVQLLVDEGADVNMEDEDGDTAMHVALLRPQLANVMLSPAVGTGATEDNSEGCSPTTLHGRLSSSGLLGNGELSVGTAIACFLAQEGADINYANHKGKSPLDLLADSGALQLIKSFSEKHRLQRLQAITCGQGLSSASLRRVHTTPNTMTNLVLPTPPGPSECLICSELALLVLFCPCQHSVACEECAHRMKKCIKCQVTITKKIR 947          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Planmine SMEST
Match: SMESG000010218.1 (SMESG000010218.1)

HSP 1 Score: 861.677 bits (2225), Expect = 0.000e+0
Identity = 420/448 (93.75%), Postives = 436/448 (97.32%), Query Frame = 1
Query:   19 APSIPFAQSIISLTCTENALTLSMKFHGTLFPCFVDRLDLRSSNVHDGNNNSLLHLAVKCLKPDICSSLLNAGAHVNNINNFGNSPLLEMLNDAQLVANENNLNKSIEITKILIGSGADVSAQLSNGITAFQLAANIGSEELMLALVSNNPKLINFISIDFKLPFQNQWFAYAEALIKLLPDNFLSSNITKNIFHLCRNEHKLIQLLFDKSSPELQQSILESLLYDAVNADENELFKHLVRTEILLPGQLETGETLLTFMIKENKFLFAKNLLKSINKKKFVNLKNRRNQSAVQLAIEADQFDLIDLMIHETEGLDCEDSDGKSALAQLMEKLSICNNDQNYGRLISTVKSAMRSGGDIYKIRSNGRRIVDSCTNMDAKAEIEEFHGRLPTFLNPAGNDANICTICMEKRLNIRFQCGHLCCSDCADQIFNCHMCRIEILSKERIFLN 1362
            AP+IPFAQSIISLTCTENALTLSMKFHGTLFPCFVDRL+LRSSNVHDGNNNSLLHLAVKCLKPDICSSLLNAGAHVNNINNFGNSP+LEMLNDAQLVANENNLNKSIEITKILIGSGADVSAQLSNGITAFQLAANIGSEELMLALVSNNPKLINFISIDF+LPFQNQWFAYAEALIKLLPDNFLSSNIT+NIF+LCR EHKLIQLLFDKSSPELQQSILESLLYDAVNADENELF+HL++T+IL+P QLE GETLLTFMIKENK +FA NLL+SINK KFVNLKNR NQSAVQLAI ADQFDLIDLMIHETEGLDCED+ GKSALAQLMEKLSICNN+Q YG+LISTVK AMRSGGDIYKI SNGRRIVDSCTNMDAKAEIEEFHGRLPTFLNPAGNDANICTICMEKRLNIRFQCGHLCCSDCADQIFNCHMCRIEILSKERIFLN
Sbjct:  476 APTIPFAQSIISLTCTENALTLSMKFHGTLFPCFVDRLNLRSSNVHDGNNNSLLHLAVKCLKPDICSSLLNAGAHVNNINNFGNSPMLEMLNDAQLVANENNLNKSIEITKILIGSGADVSAQLSNGITAFQLAANIGSEELMLALVSNNPKLINFISIDFQLPFQNQWFAYAEALIKLLPDNFLSSNITRNIFYLCRAEHKLIQLLFDKSSPELQQSILESLLYDAVNADENELFRHLIKTQILMPRQLEDGETLLTFMIKENKIVFATNLLQSINKMKFVNLKNRTNQSAVQLAIGADQFDLIDLMIHETEGLDCEDTVGKSALAQLMEKLSICNNEQKYGKLISTVKYAMRSGGDIYKITSNGRRIVDSCTNMDAKAEIEEFHGRLPTFLNPAGNDANICTICMEKRLNIRFQCGHLCCSDCADQIFNCHMCRIEILSKERIFLN 923          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Planmine SMEST
Match: SMESG000010549.1 (SMESG000010549.1)

HSP 1 Score: 857.825 bits (2215), Expect = 0.000e+0
Identity = 421/448 (93.97%), Postives = 434/448 (96.88%), Query Frame = 1
Query:   19 APSIPFAQSIISLTCTENALTLSMKFHGTLFPCFVDRLDLRSSNVHDGNNNSLLHLAVKCLKPDICSSLLNAGAHVNNINNFGNSPLLEMLNDAQLVANENNLNKSIEITKILIGSGADVSAQLSNGITAFQLAANIGSEELMLALVSNNPKLINFISIDFKLPFQNQWFAYAEALIKLLPDNFLSSNITKNIFHLCRNEHKLIQLLFDKSSPELQQSILESLLYDAVNADENELFKHLVRTEILLPGQLETGETLLTFMIKENKFLFAKNLLKSINKKKFVNLKNRRNQSAVQLAIEADQFDLIDLMIHETEGLDCEDSDGKSALAQLMEKLSICNNDQNYGRLISTVKSAMRSGGDIYKIRSNGRRIVDSCTNMDAKAEIEEFHGRLPTFLNPAGNDANICTICMEKRLNIRFQCGHLCCSDCADQIFNCHMCRIEILSKERIFLN 1362
            AP+IPFAQSIISLTCTENALTLSMKFHGTLFPCFVDRLDLRSSNVHDGNNNSLLHLAVKCLKPDICSSLLNAGA VN +NNFGNSPLLEMLNDAQLVAN+NNLNKSIEITKILIGSGADVSAQLSNGITAFQLAANIGSEELMLALVSNNPKLINFISIDFKLPFQNQWFAYAEALIKLLPDNFLSSNIT+NIFHLCR EHKLIQL+FDKSS ELQQSILESLLYDAVNADENELF+HL++T+IL+P QLE GETLLTFMIKENK +FA NLLKS+NK KFVNLKNR NQSAVQLAIEADQFD IDLMIHETEGLDCEDSDGKSALAQLMEKLSICNNDQNYGRLISTVKSAMRSGGDIYKIRSNGRRIVDSCTNMDAKAEIEEFH RLPT LNPAGNDANICTICM+K LNIRFQCGHLCCSDCADQIFNCHMCRIEILSKERIFLN
Sbjct:  565 APAIPFAQSIISLTCTENALTLSMKFHGTLFPCFVDRLDLRSSNVHDGNNNSLLHLAVKCLKPDICSSLLNAGAQVNTLNNFGNSPLLEMLNDAQLVANKNNLNKSIEITKILIGSGADVSAQLSNGITAFQLAANIGSEELMLALVSNNPKLINFISIDFKLPFQNQWFAYAEALIKLLPDNFLSSNITRNIFHLCRAEHKLIQLIFDKSSRELQQSILESLLYDAVNADENELFRHLIKTQILMPRQLEDGETLLTFMIKENKIVFATNLLKSVNKMKFVNLKNRTNQSAVQLAIEADQFDPIDLMIHETEGLDCEDSDGKSALAQLMEKLSICNNDQNYGRLISTVKSAMRSGGDIYKIRSNGRRIVDSCTNMDAKAEIEEFHDRLPTALNPAGNDANICTICMDKPLNIRFQCGHLCCSDCADQIFNCHMCRIEILSKERIFLN 1012          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Planmine SMEST
Match: SMESG000010549.1 (SMESG000010549.1)

HSP 1 Score: 857.44 bits (2214), Expect = 0.000e+0
Identity = 421/448 (93.97%), Postives = 434/448 (96.88%), Query Frame = 1
Query:   19 APSIPFAQSIISLTCTENALTLSMKFHGTLFPCFVDRLDLRSSNVHDGNNNSLLHLAVKCLKPDICSSLLNAGAHVNNINNFGNSPLLEMLNDAQLVANENNLNKSIEITKILIGSGADVSAQLSNGITAFQLAANIGSEELMLALVSNNPKLINFISIDFKLPFQNQWFAYAEALIKLLPDNFLSSNITKNIFHLCRNEHKLIQLLFDKSSPELQQSILESLLYDAVNADENELFKHLVRTEILLPGQLETGETLLTFMIKENKFLFAKNLLKSINKKKFVNLKNRRNQSAVQLAIEADQFDLIDLMIHETEGLDCEDSDGKSALAQLMEKLSICNNDQNYGRLISTVKSAMRSGGDIYKIRSNGRRIVDSCTNMDAKAEIEEFHGRLPTFLNPAGNDANICTICMEKRLNIRFQCGHLCCSDCADQIFNCHMCRIEILSKERIFLN 1362
            AP+IPFAQSIISLTCTENALTLSMKFHGTLFPCFVDRLDLRSSNVHDGNNNSLLHLAVKCLKPDICSSLLNAGA VN +NNFGNSPLLEMLNDAQLVAN+NNLNKSIEITKILIGSGADVSAQLSNGITAFQLAANIGSEELMLALVSNNPKLINFISIDFKLPFQNQWFAYAEALIKLLPDNFLSSNIT+NIFHLCR EHKLIQL+FDKSS ELQQSILESLLYDAVNADENELF+HL++T+IL+P QLE GETLLTFMIKENK +FA NLLKS+NK KFVNLKNR NQSAVQLAIEADQFD IDLMIHETEGLDCEDSDGKSALAQLMEKLSICNNDQNYGRLISTVKSAMRSGGDIYKIRSNGRRIVDSCTNMDAKAEIEEFH RLPT LNPAGNDANICTICM+K LNIRFQCGHLCCSDCADQIFNCHMCRIEILSKERIFLN
Sbjct:  597 APAIPFAQSIISLTCTENALTLSMKFHGTLFPCFVDRLDLRSSNVHDGNNNSLLHLAVKCLKPDICSSLLNAGAQVNTLNNFGNSPLLEMLNDAQLVANKNNLNKSIEITKILIGSGADVSAQLSNGITAFQLAANIGSEELMLALVSNNPKLINFISIDFKLPFQNQWFAYAEALIKLLPDNFLSSNITRNIFHLCRAEHKLIQLIFDKSSRELQQSILESLLYDAVNADENELFRHLIKTQILMPRQLEDGETLLTFMIKENKIVFATNLLKSVNKMKFVNLKNRTNQSAVQLAIEADQFDPIDLMIHETEGLDCEDSDGKSALAQLMEKLSICNNDQNYGRLISTVKSAMRSGGDIYKIRSNGRRIVDSCTNMDAKAEIEEFHDRLPTALNPAGNDANICTICMDKPLNIRFQCGHLCCSDCADQIFNCHMCRIEILSKERIFLN 1044          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Planmine SMEST
Match: SMESG000010222.1 (SMESG000010222.1)

HSP 1 Score: 850.892 bits (2197), Expect = 0.000e+0
Identity = 416/448 (92.86%), Postives = 433/448 (96.65%), Query Frame = 1
Query:   19 APSIPFAQSIISLTCTENALTLSMKFHGTLFPCFVDRLDLRSSNVHDGNNNSLLHLAVKCLKPDICSSLLNAGAHVNNINNFGNSPLLEMLNDAQLVANENNLNKSIEITKILIGSGADVSAQLSNGITAFQLAANIGSEELMLALVSNNPKLINFISIDFKLPFQNQWFAYAEALIKLLPDNFLSSNITKNIFHLCRNEHKLIQLLFDKSSPELQQSILESLLYDAVNADENELFKHLVRTEILLPGQLETGETLLTFMIKENKFLFAKNLLKSINKKKFVNLKNRRNQSAVQLAIEADQFDLIDLMIHETEGLDCEDSDGKSALAQLMEKLSICNNDQNYGRLISTVKSAMRSGGDIYKIRSNGRRIVDSCTNMDAKAEIEEFHGRLPTFLNPAGNDANICTICMEKRLNIRFQCGHLCCSDCADQIFNCHMCRIEILSKERIFLN 1362
            AP+IPFAQSIISLTCTENALTLSMKFHGTLFPCF+DRLDLRSSN+HDGNNNSLLHLAVKCLKPDICSSLLNAGAHVNNINNFGNSPLLEMLNDAQLV+NENNLNKSIEITKILIG GADVSAQLSNGITAF+LAANIGSEELMLALVSNNPKLINFISIDF+LPFQNQWFAYAEALIKLLPDNFLSSNIT+ IFHLCR EHKLIQLLFDKSS ELQQSILESLLY AVNADENELF+HL++T+IL+P QLE GETLLTFMIK+NK +FA NLLKS+NK KFVNLKNR NQSAVQLAIEADQ DLIDLMIHETEGLDCEDS GKSALAQLMEKLSICNNDQNYGRLISTVKSAMRSGGDIYKIRSNGRRIVDSCTNMDAKAEI+EFHGRLPTFLNPAGNDANICTICM+K LNIRFQCGHLC SDCADQIFNCHMCRIEILSKERIFLN
Sbjct:  148 APTIPFAQSIISLTCTENALTLSMKFHGTLFPCFLDRLDLRSSNLHDGNNNSLLHLAVKCLKPDICSSLLNAGAHVNNINNFGNSPLLEMLNDAQLVSNENNLNKSIEITKILIGKGADVSAQLSNGITAFRLAANIGSEELMLALVSNNPKLINFISIDFQLPFQNQWFAYAEALIKLLPDNFLSSNITRKIFHLCRAEHKLIQLLFDKSSSELQQSILESLLYHAVNADENELFRHLIKTQILMPRQLEDGETLLTFMIKKNKIVFATNLLKSVNKMKFVNLKNRTNQSAVQLAIEADQLDLIDLMIHETEGLDCEDSVGKSALAQLMEKLSICNNDQNYGRLISTVKSAMRSGGDIYKIRSNGRRIVDSCTNMDAKAEIKEFHGRLPTFLNPAGNDANICTICMDKPLNIRFQCGHLCSSDCADQIFNCHMCRIEILSKERIFLN 595          
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Planmine SMEST
Match: SMESG000010579.1 (SMESG000010579.1)

HSP 1 Score: 845.499 bits (2183), Expect = 0.000e+0
Identity = 415/448 (92.63%), Postives = 430/448 (95.98%), Query Frame = 1
Query:   19 APSIPFAQSIISLTCTENALTLSMKFHGTLFPCFVDRLDLRSSNVHDGNNNSLLHLAVKCLKPDICSSLLNAGAHVNNINNFGNSPLLEMLNDAQLVANENNLNKSIEITKILIGSGADVSAQLSNGITAFQLAANIGSEELMLALVSNNPKLINFISIDFKLPFQNQWFAYAEALIKLLPDNFLSSNITKNIFHLCRNEHKLIQLLFDKSSPELQQSILESLLYDAVNADENELFKHLVRTEILLPGQLETGETLLTFMIKENKFLFAKNLLKSINKKKFVNLKNRRNQSAVQLAIEADQFDLIDLMIHETEGLDCEDSDGKSALAQLMEKLSICNNDQNYGRLISTVKSAMRSGGDIYKIRSNGRRIVDSCTNMDAKAEIEEFHGRLPTFLNPAGNDANICTICMEKRLNIRFQCGHLCCSDCADQIFNCHMCRIEILSKERIFLN 1362
            APSIPFAQSIISLTCTENALTLSMKFHGTLFPCFVDRLDLRSSNVHDGNNNSLLHLAVKCLK DICSSLLNAGAHVN +NNFGNSPLLEMLNDAQLVANENNLNKSIEITKILIG+GAD++AQLSNGITAFQLAANIGSEELML LVSNNPKLINFISIDFKLPFQNQWF+YAEALIKLLPDNFLSSNITKNIFHLCRNEHKLIQLLFDKSSPELQQSILESLLYDAVNADENELFKHL++ +IL+P  LE GETLLTFMIKENK +FA NLLKS+NK KFVNLKNR NQSAVQLAIEADQFDLIDLMIHE+EGLDCEDSDGKSALAQLMEKLSI NNDQNYG+LISTVKSAMRSGGDIYKI +NGRRIVD CTNMDAKAEIEEFHGRLPT LN AGNDANICTICM+K LN RFQCGHLCCSDCADQIFNCHMCRIEILSKERIFLN
Sbjct:  528 APSIPFAQSIISLTCTENALTLSMKFHGTLFPCFVDRLDLRSSNVHDGNNNSLLHLAVKCLKQDICSSLLNAGAHVNTLNNFGNSPLLEMLNDAQLVANENNLNKSIEITKILIGNGADINAQLSNGITAFQLAANIGSEELMLTLVSNNPKLINFISIDFKLPFQNQWFSYAEALIKLLPDNFLSSNITKNIFHLCRNEHKLIQLLFDKSSPELQQSILESLLYDAVNADENELFKHLIKKQILMPRTLEDGETLLTFMIKENKIVFATNLLKSVNKMKFVNLKNRTNQSAVQLAIEADQFDLIDLMIHESEGLDCEDSDGKSALAQLMEKLSILNNDQNYGKLISTVKSAMRSGGDIYKITTNGRRIVDLCTNMDAKAEIEEFHGRLPTALNTAGNDANICTICMDKPLNTRFQCGHLCCSDCADQIFNCHMCRIEILSKERIFLN 975          
The following BLAST results are available for this feature:
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EHMT11.316e-634.62euchromatic histone lysine methyltransferase 1 [So... [more]
EHMT12.621e-633.61euchromatic histone lysine methyltransferase 1 [So... [more]
EHMT12.655e-633.61euchromatic histone lysine methyltransferase 1 [So... [more]
EHMT13.838e-635.29euchromatic histone lysine methyltransferase 1 [So... [more]
EHMT17.411e-634.58euchromatic histone lysine methyltransferase 1 [So... [more]
back to top
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
mib29.794e-843.75gene:FBgn0086442 transcript:FBtr0336840[more]
mib29.794e-843.75gene:FBgn0086442 transcript:FBtr0081142[more]
mib29.794e-843.75gene:FBgn0086442 transcript:FBtr0336841[more]
back to top
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of E3 ubiquitin-protein ligase MIB2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|Q4UMH6|Y381_RICFE6.230e-924.20Putative ankyrin repeat protein RF_0381 OS=Rickett... [more]
sp|Q9SAL0|RGLG4_ARATH1.983e-733.87E3 ubiquitin-protein ligase RGLG4 OS=Arabidopsis t... [more]
back to top
BLAST of E3 ubiquitin-protein ligase MIB2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3M7P2D42.726e-933.10Spectrin beta non-erythrocytic 1-like OS=Brachionu... [more]
A0A224XE368.581e-922.06Putative e3 ubiquitin-protein ligase mib1 isoform ... [more]
A0A0P4VNN61.333e-822.06Putative e3 ubiquitin-protein ligase mib1 OS=Rhodn... [more]
A0A069DZQ01.348e-822.06Putative e3 ubiquitin-protein ligase mib1 OS=Panst... [more]
A0A0V0G4N41.522e-822.06Putative e3 ubiquitin-protein ligase mib1 OS=Triat... [more]
back to top
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSAMXT00000048767.11.522e-622.38serine/threonine-protein phosphatase 6 regulatory ... [more]
ENSAMXT00000016978.21.854e-622.38serine/threonine-protein phosphatase 6 regulatory ... [more]
mib24.965e-623.15mindbomb E3 ubiquitin protein ligase 2 [Source:NCB... [more]
back to top
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
mib21.238e-622.25mindbomb E3 ubiquitin protein ligase 2 [Source:NCB... [more]
mib21.321e-622.25mindbomb E3 ubiquitin protein ligase 2 [Source:NCB... [more]
mib21.730e-622.20mindbomb E3 ubiquitin protein ligase 2 [Source:NCB... [more]
mib21.830e-622.25mindbomb E3 ubiquitin protein ligase 2 [Source:NCB... [more]
back to top
BLAST of E3 ubiquitin-protein ligase MIB2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000010218.10.000e+093.75SMESG000010218.1[more]
SMESG000010549.10.000e+093.97SMESG000010549.1[more]
SMESG000010549.10.000e+093.97SMESG000010549.1[more]
SMESG000010222.10.000e+092.86SMESG000010222.1[more]
SMESG000010579.10.000e+092.63SMESG000010579.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011798 ID=SMED30011798|Name=E3 ubiquitin-protein ligase MIB2|organism=Schmidtea mediterranea sexual|type=transcript|length=1721bp
GAATTGTATAATTGAGCAGCTCCCTCAATTCCGTTTGCGCAATCAATAAT
TTCACTGACTTGTACTGAAAACGCGCTAACTTTGTCAATGAAATTTCATG
GGACGCTTTTTCCATGTTTTGTTGACAGACTCGATTTAAGAAGTTCAAAT
GTTCATGATGGAAACAACAATTCGTTGCTTCATCTGGCAGTGAAATGCCT
CAAACCGGATATATGCAGTTCACTGCTTAATGCTGGAGCACATGTCAACA
ATATAAACAATTTTGGAAATTCTCCGTTGCTTGAGATGCTTAATGATGCA
CAACTAGTTGCTAATGAAAACAACTTGAATAAATCAATCGAGATCACAAA
AATATTGATTGGAAGTGGAGCTGACGTCAGTGCGCAATTATCCAATGGAA
TCACTGCATTTCAATTGGCAGCGAATATCGGAAGTGAAGAATTGATGCTT
GCTCTCGTATCCAATAATCCTAAATTGATCAATTTTATCTCAATCGATTT
CAAATTGCCTTTCCAAAATCAGTGGTTTGCATATGCAGAAGCATTGATTA
AGCTTTTGCCCGACAATTTTCTGTCATCCAATATCACAAAGAACATTTTT
CATTTATGTAGAAACGAGCATAAATTGATTCAATTGCTATTTGATAAATC
CAGTCCCGAGCTCCAGCAGTCAATTTTGGAAAGCCTTCTTTATGATGCTG
TAAATGCTGATGAGAACGAGCTATTTAAGCACTTGGTAAGGACAGAAATA
TTGCTGCCTGGACAACTCGAAACTGGAGAAACTTTGCTCACATTTATGAT
CAAAGAGAATAAATTTCTGTTTGCCAAGAATTTATTAAAGTCCATCAATA
AAAAGAAATTTGTTAACCTAAAAAACCGAAGAAATCAATCAGCTGTGCAA
TTGGCAATTGAAGCGGATCAATTCGATCTTATTGATTTGATGATTCACGA
GACAGAAGGATTGGATTGTGAGGACTCAGATGGCAAATCAGCATTGGCAC
AATTGATGGAGAAATTATCGATTTGCAATAATGATCAAAATTATGGAAGA
TTGATTTCCACAGTTAAATCTGCAATGAGATCCGGTGGAGATATTTACAA
GATTAGGTCTAACGGCCGACGGATTGTAGATTCGTGCACCAATATGGATG
CCAAGGCAGAAATCGAGGAATTTCACGGAAGACTGCCAACATTCCTAAAC
CCAGCTGGGAACGATGCAAATATATGCACAATTTGCATGGAGAAACGTTT
AAACATAAGGTTCCAATGTGGTCATTTGTGCTGCTCTGACTGTGCCGATC
AGATATTCAACTGCCACATGTGCAGGATCGAGATCCTTAGTAAAGAAAGA
ATATTTTTGAATTGATCAATTATGAACTTTTGACCTTGTATATTATTCTC
ATTTTTGTAATGTAATTTGTAACCCTTAGGCCTAGCATTGTCTGCTTTGC
CACAGAACGGATTGTCCCTTTTTTAGTTTGATTTTATTGAGTTTATGTTT
ATCTCTAAAAATGTCATTCTGATTTGATTGGTTTTGGCTATCGCTTTTGC
GCTTTTTGTTCTGGGGAATAAATTGCTTGATTTGAAATTCTCTGAAAGGA
AATCTGCATTTAATATGTACATGTAGTATTAGCAATGTAAGACGCTTATT
AAAAGGTTTTGAGCATTTTTGTAGTACATCATGCTCTTGGTTTAATTCTT
GGAATAAATTCTAGAGCAACG
back to top

protein sequence of SMED30011798-orf-1

>SMED30011798-orf-1 ID=SMED30011798-orf-1|Name=SMED30011798-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=426bp
MKFHGTLFPCFVDRLDLRSSNVHDGNNNSLLHLAVKCLKPDICSSLLNAG
AHVNNINNFGNSPLLEMLNDAQLVANENNLNKSIEITKILIGSGADVSAQ
LSNGITAFQLAANIGSEELMLALVSNNPKLINFISIDFKLPFQNQWFAYA
EALIKLLPDNFLSSNITKNIFHLCRNEHKLIQLLFDKSSPELQQSILESL
LYDAVNADENELFKHLVRTEILLPGQLETGETLLTFMIKENKFLFAKNLL
KSINKKKFVNLKNRRNQSAVQLAIEADQFDLIDLMIHETEGLDCEDSDGK
SALAQLMEKLSICNNDQNYGRLISTVKSAMRSGGDIYKIRSNGRRIVDSC
TNMDAKAEIEEFHGRLPTFLNPAGNDANICTICMEKRLNIRFQCGHLCCS
DCADQIFNCHMCRIEILSKERIFLN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000018Category 4 cell
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000106ciliated epithelial cell
PLANA:0000429neoblast
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR002110Ankyrin_rpt
IPR020683Ankyrin_rpt-contain_dom
IPR013083Znf_RING/FYVE/PHD
IPR001841Znf_RING
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0008270zinc ion binding
GO:0004842ubiquitin-protein transferase activity
GO:0016874ligase activity
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0016567protein ubiquitination