Serine/threonine-protein kinase

Overview
NameSerine/threonine-protein kinase
Smed IDSMED30011797
Length (bp)1602
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Serine/threonine-protein kinase (SMED30011797) t-SNE clustered cells

Violin plots show distribution of expression levels for Serine/threonine-protein kinase (SMED30011797) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Serine/threonine-protein kinase (SMED30011797) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Serine/threonine-protein kinase (SMED30011797) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011797

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pigment cellSMED30011797SMESG000072329.1 SmedASXL_019491SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
parenchymal cellSMED30011797SMESG000072329.1 dd_Smed_v4_7090_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Serine/threonine-protein kinase vs. Ensembl Human
Match: PIM1 (Pim-1 proto-oncogene, serine/threonine kinase [Source:HGNC Symbol;Acc:HGNC:8986])

HSP 1 Score: 206.453 bits (524), Expect = 1.211e-61
Identity = 108/284 (38.03%), Postives = 162/284 (57.04%), Query Frame = 1
Query:   82 HFFVMDCDYENYLRKFPFQQGKTKLELKYNYDKELGKGSYGNVLSGFRKKDHFSVAIKVLPTNLIDNWYFSKTLKMNIPMEILLLS-LASNIDGVISMIEYYNDLEQSEWYIVMERFAETIDLFNYICSEGFLTEHLASQIFYELTRIIIECHLRGILHRDIKEENILIDKYTKKIWLIDFGSGGLMNDDNHYSYNGTEEYAPPEWIKYGHYRGCQLESWSLGIVLYSMVCGRIPFEDNNEILSNTIKFPRKISNNCKELILKCIERDPKNRIQPSEILKHPWI 930
            H     C+  +  +  P ++ K  LE +Y     LG G +G+V SG R  D+  VAIK +  + I +W         +PME++LL  ++S   GVI +++++       + +++ER     DLF++I   G L E LA   F+++   +  CH  G+LHRDIK+ENILID    ++ LIDFGSG L+ D  +  ++GT  Y+PPEWI+Y  Y G     WSLGI+LY MVCG IPFE + EI+   + F +++S+ C+ LI  C+   P +R    EI  HPW+
Sbjct:   11 HLRAAPCNDLHATKLAPGKE-KEPLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRISDWGELPN-GTRVPMEVVLLKKVSSGFSGVIRLLDWFE--RPDSFVLILERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDIPFEHDEEIIRGQVFFRQRVSSECQHLIRWCLALRPSDRPTFEEIQNHPWM 290          
BLAST of Serine/threonine-protein kinase vs. Ensembl Human
Match: PIM2 (Pim-2 proto-oncogene, serine/threonine kinase [Source:HGNC Symbol;Acc:HGNC:8987])

HSP 1 Score: 202.986 bits (515), Expect = 2.917e-60
Identity = 105/265 (39.62%), Postives = 147/265 (55.47%), Query Frame = 1
Query:  145 KTKLELKYNYDKELGKGSYGNVLSGFRKKDHFSVAIKVLPTNLIDNWYFSKTLKMNIPMEILLL---SLASNIDGVISMIEYYNDLEQSEWYIVMERFAETIDLFNYICSEGFLTEHLASQIFYELTRIIIECHLRGILHRDIKEENILIDKYTKKIWLIDFGSGGLMNDDNHYSYNGTEEYAPPEWIKYGHYRGCQLESWSLGIVLYSMVCGRIPFEDNNEILSNTIKFPRKISNNCKELILKCIERDPKNRIQPSEILKHPWI 930
            +   E +Y     LGKG +G V +G R  D   VAIKV+P N +  W    +  +  P+E+ LL          GVI +++++    Q  + +V+ER     DLF+YI  +G L E  +   F ++   I  CH RG++HRDIK+ENILID       LIDFGSG L++D+ +  ++GT  Y+PPEWI    Y       WSLGI+LY MVCG IPFE + EIL   + FP  +S +C  LI +C+   P +R    EIL  PW+
Sbjct:   25 REAFEAEYRLGPLLGKGGFGTVFAGHRLTDRLQVAIKVIPRNRVLGWS-PLSDSVTCPLEVALLWKVGAGGGHPGVIRLLDWFE--TQEGFMLVLERPLPAQDLFDYITEKGPLGEGPSRCFFGQVVAAIQHCHSRGVVHRDIKDENILIDLRRGCAKLIDFGSGALLHDEPYTDFDGTRVYSPPEWISRHQYHALPATVWSLGILLYDMVCGDIPFERDQEILEAELHFPAHVSPDCCALIRRCLAPKPSSRPSLEEILLDPWM 286          
BLAST of Serine/threonine-protein kinase vs. Ensembl Human
Match: PIM3 (Pim-3 proto-oncogene, serine/threonine kinase [Source:HGNC Symbol;Acc:HGNC:19310])

HSP 1 Score: 193.741 bits (491), Expect = 1.138e-56
Identity = 100/273 (36.63%), Postives = 150/273 (54.95%), Query Frame = 1
Query:  130 PFQQGKTKLELKYNYDKELGKGSYGNVLSGFRKKDHFSVAIKVLPTNLIDNWYFSKTLKMNIPMEILLL---SLASNIDGVISMIEYYNDLEQSEWYIVMERFAETIDLFNYICSEGFLTEHLASQIFYELTRIIIECHLRGILHRDIKEENILIDKYTKKIWLIDFGSGGLMNDDNHYSYNGTEEYAPPEWIKYGHYRGCQLESWSLGIVLYSMVCGRIPFEDNNEILSNTIKFPRKISNNCKELILKCIERDPKNRIQPSEILKHPWIIAA 939
            P +  K   E  Y     LG G +G V +G R  D   VA+K +    +  W         +P+E++LL     A    GVI +++++       + +V+ER     DLF++I   G L E LA + F ++   +  CH  G++HRDIK+EN+L+D  + ++ LIDFGSG L+ D  +  ++GT  Y+PPEWI+Y  Y G     WSLG++LY MVCG IPFE + EIL   + F R++S  C++LI  C+   P  R    +I  HPW++ A
Sbjct:   28 PAKADKESFEKAYQVGAVLGSGGFGTVYAGSRIADGLPVAVKHVVKERVTEW--GSLGGATVPLEVVLLRKVGAAGGARGVIRLLDWFE--RPDGFLLVLERPEPAQDLFDFITERGALDEPLARRFFAQVLAAVRHCHSCGVVHRDIKDENLLVDLRSGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSATVWSLGVLLYDMVCGDIPFEQDEEILRGRLLFRRRVSPECQQLIRWCLSLRPSERPSLDQIAAHPWMLGA 296          
BLAST of Serine/threonine-protein kinase vs. Ensembl Human
Match: PIM2 (Pim-2 proto-oncogene, serine/threonine kinase [Source:HGNC Symbol;Acc:HGNC:8987])

HSP 1 Score: 139.043 bits (349), Expect = 2.020e-38
Identity = 67/143 (46.85%), Postives = 88/143 (61.54%), Query Frame = 1
Query:  412 IVMERFAETIDLFNYICSEGFLTEHLASQIFYELTRIIIECHLRGILHRDIKEENILIDKYTKKIWLIDFGSGGLMNDDNHYSYNGTEEYAPPEWIKYGHYRGCQLESWSLGIVLYSMVCGRIPFEDNNEILSNTIKFPRKIS 840
            +V+ER     DLF+YI  +G L E  +   F ++   I  CH RG++HRDIK+ENILID       LIDFGSG L++D+ +  ++GT  Y+PPEWI    Y       WSLGI+LY MVCG IPFE + EIL   + FP  +S
Sbjct:    2 LVLERPLPAQDLFDYITEKGPLGEGPSRCFFGQVVAAIQHCHSRGVVHRDIKDENILIDLRRGCAKLIDFGSGALLHDEPYTDFDGTRVYSPPEWISRHQYHALPATVWSLGILLYDMVCGDIPFERDQEILEAELHFPAHVS 144          
BLAST of Serine/threonine-protein kinase vs. Ensembl Human
Match: SIK1 (salt inducible kinase 1 [Source:HGNC Symbol;Acc:HGNC:11142])

HSP 1 Score: 134.806 bits (338), Expect = 1.076e-32
Identity = 85/274 (31.02%), Postives = 142/274 (51.82%), Query Frame = 1
Query:  166 YNYDKELGKGSYGNVLSGFRKKDHFSVAIKVLPTNLIDNWYFSKTLKMNIPMEILLLSLASNIDGVISMIEYYNDLEQSEWYIVMERFAETIDLFNYICSEGFLTEHLASQIFYELTRIIIECHLRGILHRDIKEENILIDKYTKKIWLIDFGSGGLMNDDNHYS-YNGTEEYAPPEWIKYGHYRGCQLESWSLGIVLYSMVCGRIPFEDNN------EILSNTIKFPRKISNNCKELILKCIERDPKNRIQPSEILKHPWIIAALDNCDSGRA 966
            Y+ ++ LGKG++  V     +     VAIK++    +D+    K  +     E+ L+ L ++      +I+ Y  +E  +   ++  FA+  ++F+Y+ S G L+E+ A + F+++   +  CH   I+HRD+K EN+L+D     I L DFG G         S + G+  YA PE  +   Y G QL+ WSLG+VLY +VCG +PF+  N       +L    + P  +S +C+ LI + +  DP  RI  ++I +H W+ A  + C  G A
Sbjct:   27 YDIERTLGKGNFAVVKLARHRVTKTQVAIKIIDKTRLDSSNLEKIYR-----EVQLMKLLNHPH----IIKLYQVMETKDMLYIVTEFAKNGEMFDYLTSNGHLSENEARKKFWQILSAVEYCHDHHIVHRDLKTENLLLDG-NMDIKLADFGFGNFYKSGEPLSTWCGSPPYAAPEVFEGKEYEGPQLDIWSLGVVLYVLVCGSLPFDGPNLPTLRQRVLEGRFRIPFFMSQDCESLIRRMLVVDPARRITIAQIRQHRWMRA--EPCLPGPA 288          
BLAST of Serine/threonine-protein kinase vs. Ensembl Celegans
Match: prk-2 (Serine/threonine-protein kinase prk-2 [Source:UniProtKB/Swiss-Prot;Acc:Q20443])

HSP 1 Score: 176.022 bits (445), Expect = 3.588e-49
Identity = 93/268 (34.70%), Postives = 149/268 (55.60%), Query Frame = 1
Query:  139 QGKTKLELKYNYDKELGKGSYGNVLSGFRKKDHFSVAIKVLPTNLIDNWYFSKTLKMNIPMEILLLSLASNIDGVISMIEYYNDLEQSEWYIVMERFAETIDLFNYICSEGFLTEHLASQIFYELTRIIIECHLRGILHRDIKEENILIDKYTKKIWLIDFGSGGLMNDDNHYSYNGTEEYAPPEWIKYGHYRGCQLESWSLGIVLYSMVCGRIPFEDNNEI----LSNTIKFPRKISNNCKELILKCIERDPKNRIQPSEILKHPWI 930
            +G +K +  Y    ELG+G +G V    R  D+  VA+K +  + +  W  ++     +PMEI +L+  S + GVI ++++Y+  E   + IVMER    ID+F++I  +G ++E +A  +F ++   + EC    +LHRD+K+ENI+ID  T    LIDFG+  ++    +  + GT  Y PPEW  +  Y G +   WSLG++LY+ + GR+PF +  +I    L   + F   +S   K+LI KC+  DP  R     IL HPW+
Sbjct:   22 RGFSKFKKNYKLKAELGRGGFGVVYRAVRTCDNALVAVKFIERSNVKEW--ARINGEQVPMEICMLAKCSKVRGVIRLLDWYSIPEG--FLIVMERPYPCIDMFDFIKGQGKISEDMARFLFRQIAVTVHECVQNRVLHRDLKDENIVIDLVTGSTKLIDFGAATVLRRSQYSDFQGTRLYCPPEWFLHSLYLGREAAVWSLGVLLYNSLNGRLPFRNEKDICTAHLLGPLPFFVPVSAEVKDLISKCLTFDPFQRCSLEAILNHPWV 285          
BLAST of Serine/threonine-protein kinase vs. Ensembl Celegans
Match: prk-2 (Serine/threonine-protein kinase prk-2 [Source:UniProtKB/Swiss-Prot;Acc:Q20443])

HSP 1 Score: 176.022 bits (445), Expect = 3.588e-49
Identity = 93/268 (34.70%), Postives = 149/268 (55.60%), Query Frame = 1
Query:  139 QGKTKLELKYNYDKELGKGSYGNVLSGFRKKDHFSVAIKVLPTNLIDNWYFSKTLKMNIPMEILLLSLASNIDGVISMIEYYNDLEQSEWYIVMERFAETIDLFNYICSEGFLTEHLASQIFYELTRIIIECHLRGILHRDIKEENILIDKYTKKIWLIDFGSGGLMNDDNHYSYNGTEEYAPPEWIKYGHYRGCQLESWSLGIVLYSMVCGRIPFEDNNEI----LSNTIKFPRKISNNCKELILKCIERDPKNRIQPSEILKHPWI 930
            +G +K +  Y    ELG+G +G V    R  D+  VA+K +  + +  W  ++     +PMEI +L+  S + GVI ++++Y+  E   + IVMER    ID+F++I  +G ++E +A  +F ++   + EC    +LHRD+K+ENI+ID  T    LIDFG+  ++    +  + GT  Y PPEW  +  Y G +   WSLG++LY+ + GR+PF +  +I    L   + F   +S   K+LI KC+  DP  R     IL HPW+
Sbjct:   22 RGFSKFKKNYKLKAELGRGGFGVVYRAVRTCDNALVAVKFIERSNVKEW--ARINGEQVPMEICMLAKCSKVRGVIRLLDWYSIPEG--FLIVMERPYPCIDMFDFIKGQGKISEDMARFLFRQIAVTVHECVQNRVLHRDLKDENIVIDLVTGSTKLIDFGAATVLRRSQYSDFQGTRLYCPPEWFLHSLYLGREAAVWSLGVLLYNSLNGRLPFRNEKDICTAHLLGPLPFFVPVSAEVKDLISKCLTFDPFQRCSLEAILNHPWV 285          
BLAST of Serine/threonine-protein kinase vs. Ensembl Celegans
Match: prk-1 (Pim (Mammalian oncogene) Related Kinase [Source:UniProtKB/TrEMBL;Acc:K8ESD7])

HSP 1 Score: 154.066 bits (388), Expect = 1.163e-41
Identity = 85/284 (29.93%), Postives = 146/284 (51.41%), Query Frame = 1
Query:  163 KYNYDKELGKGSYGNVLSGFRKKD-HFSVAIKVLPTNLIDNWYFSKTLKMNIPMEILLLSLASNIDGVISMIEYYNDLEQSEWYIVMERFAETIDLFNYICSEGFLTEHLASQIFYELTRIIIECHLR-GILHRDIKEENILIDKYTKKIWLIDFGSGGLMNDDNHYSYNGTEEYAPPEWIKYGHYRGCQLESWSLGIVLYSMVCGRIPFEDNNEILSNTIKFPRKISNNCKELILKCIERDPKNRIQPSEILKHPWIIAALDNCDSGRASFDEAFQEASKEIR 1008
            KY    E+G+G +G V     ++D    VA+K +    + +W  + T +  IP E+  L    +I GVI +++++ +     + IVMER A  +DLF+ +   G L E +   IF ++   +   + + G+LHRDIK+EN++++  T ++ L+DFG+           + GT  Y PPEW +   Y   +  SWSLG++L+ ++ G++PF +  +I    +KFP  +S    +L+  C+      R   ++I  HPW+       D      D  F+EA  EI+
Sbjct:   33 KYEVLDEIGRGGFGIVYEATTRQDGQQPVAVKFVQHKHVRSW--TMTCRQLIPSEVCHLETCEDIPGVIKILDWFAN--SKGFLIVMERPANCMDLFDMVSVHGPLNEDMGKFIFKQVITTVFNMYSKHGLLHRDIKDENLIVNMNTGEVKLVDFGATAYAEKATKKEFQGTRSYCPPEWFRDQLYLPLEATSWSLGVLLFILLTGKLPFRNEIQICLGNVKFPPDLSKEVCQLVKSCLTTSTSARASLAQIAAHPWM-----ETDKPFFGGDLTFEEALMEIK 307          
BLAST of Serine/threonine-protein kinase vs. Ensembl Celegans
Match: prk-1 (Pim (Mammalian oncogene) Related Kinase [Source:UniProtKB/TrEMBL;Acc:K8ESD7])

HSP 1 Score: 154.451 bits (389), Expect = 2.084e-40
Identity = 85/284 (29.93%), Postives = 146/284 (51.41%), Query Frame = 1
Query:  163 KYNYDKELGKGSYGNVLSGFRKKD-HFSVAIKVLPTNLIDNWYFSKTLKMNIPMEILLLSLASNIDGVISMIEYYNDLEQSEWYIVMERFAETIDLFNYICSEGFLTEHLASQIFYELTRIIIECHLR-GILHRDIKEENILIDKYTKKIWLIDFGSGGLMNDDNHYSYNGTEEYAPPEWIKYGHYRGCQLESWSLGIVLYSMVCGRIPFEDNNEILSNTIKFPRKISNNCKELILKCIERDPKNRIQPSEILKHPWIIAALDNCDSGRASFDEAFQEASKEIR 1008
            KY    E+G+G +G V     ++D    VA+K +    + +W  + T +  IP E+  L    +I GVI +++++ +     + IVMER A  +DLF+ +   G L E +   IF ++   +   + + G+LHRDIK+EN++++  T ++ L+DFG+           + GT  Y PPEW +   Y   +  SWSLG++L+ ++ G++PF +  +I    +KFP  +S    +L+  C+      R   ++I  HPW+       D      D  F+EA  EI+
Sbjct:   33 KYEVLDEIGRGGFGIVYEATTRQDGQQPVAVKFVQHKHVRSW--TMTCRQLIPSEVCHLETCEDIPGVIKILDWFAN--SKGFLIVMERPANCMDLFDMVSVHGPLNEDMGKFIFKQVITTVFNMYSKHGLLHRDIKDENLIVNMNTGEVKLVDFGATAYAEKATKKEFQGTRSYCPPEWFRDQLYLPLEATSWSLGVLLFILLTGKLPFRNEIQICLGNVKFPPDLSKEVCQLVKSCLTTSTSARASLAQIAAHPWM-----ETDKPFFGGDLTFEEALMEIK 307          
BLAST of Serine/threonine-protein kinase vs. Ensembl Celegans
Match: prk-1 (Pim (Mammalian oncogene) Related Kinase [Source:UniProtKB/TrEMBL;Acc:K8ESD7])

HSP 1 Score: 154.066 bits (388), Expect = 3.080e-40
Identity = 85/284 (29.93%), Postives = 146/284 (51.41%), Query Frame = 1
Query:  163 KYNYDKELGKGSYGNVLSGFRKKD-HFSVAIKVLPTNLIDNWYFSKTLKMNIPMEILLLSLASNIDGVISMIEYYNDLEQSEWYIVMERFAETIDLFNYICSEGFLTEHLASQIFYELTRIIIECHLR-GILHRDIKEENILIDKYTKKIWLIDFGSGGLMNDDNHYSYNGTEEYAPPEWIKYGHYRGCQLESWSLGIVLYSMVCGRIPFEDNNEILSNTIKFPRKISNNCKELILKCIERDPKNRIQPSEILKHPWIIAALDNCDSGRASFDEAFQEASKEIR 1008
            KY    E+G+G +G V     ++D    VA+K +    + +W  + T +  IP E+  L    +I GVI +++++ +     + IVMER A  +DLF+ +   G L E +   IF ++   +   + + G+LHRDIK+EN++++  T ++ L+DFG+           + GT  Y PPEW +   Y   +  SWSLG++L+ ++ G++PF +  +I    +KFP  +S    +L+  C+      R   ++I  HPW+       D      D  F+EA  EI+
Sbjct:   56 KYEVLDEIGRGGFGIVYEATTRQDGQQPVAVKFVQHKHVRSW--TMTCRQLIPSEVCHLETCEDIPGVIKILDWFAN--SKGFLIVMERPANCMDLFDMVSVHGPLNEDMGKFIFKQVITTVFNMYSKHGLLHRDIKDENLIVNMNTGEVKLVDFGATAYAEKATKKEFQGTRSYCPPEWFRDQLYLPLEATSWSLGVLLFILLTGKLPFRNEIQICLGNVKFPPDLSKEVCQLVKSCLTTSTSARASLAQIAAHPWM-----ETDKPFFGGDLTFEEALMEIK 330          
BLAST of Serine/threonine-protein kinase vs. Ensembl Fly
Match: Pask (gene:FBgn0034950 transcript:FBtr0072160)

HSP 1 Score: 137.887 bits (346), Expect = 6.310e-34
Identity = 86/258 (33.33%), Postives = 134/258 (51.94%), Query Frame = 1
Query:  166 YNYDKELGKGSYGNVLSGFRKKDHFSVAIK-VLPTNLIDNWYFSKTLKMNIPMEILLLSLASNIDGVISMIEYY-NDLEQSEWYIVMERFAETIDLFNYICSEGFLTEHLASQIFYELTRIIIECHLRGILHRDIKEENILIDKYTKKIWLIDFGSGGLMNDDNHYS-YNGTEEYAPPEWIKYGHYRGCQLESWSLGIVLYSMVCGRIPFEDNNEILSNTIKFPRKISNNCKELILKCIERDPKNRIQPSEILKHPWI 930
            Y   +++G+G+YG V   FR  D   V  K +L   L   +         +P+EI LL    N   ++S+++ + NDL    + +VME+    +DL+ +I     + E L S IF ++   +   H + ILHRDIK+ENI+ID+    I LIDFGS   M +   +S + GT EY  PE +    Y G +LE W+LG+ LY ++    PF D  E L   I+ P+ +S     L+   + +DPK R    +++  PW+
Sbjct:  576 YTSIRQIGRGAYGYVNMAFRNSDRLLVITKFILKEKLCSQFMVKSRDCKEVPIEIHLLQTL-NHKNIVSVLDVFENDLF---YQLVMEKHGSGMDLWTFIERRPLMDEKLGSYIFRQVADAVNYLHEQKILHRDIKDENIIIDQ-NFTIKLIDFGSATFMEEGKFFSTFYGTTEYCSPEVLAGNRYVGPELEIWALGVTLYVLMFFENPFIDVEETLKAEIQIPKAVSEQLSRLLSSMLNKDPKYRCTMHQLITDPWL 828          
BLAST of Serine/threonine-protein kinase vs. Ensembl Fly
Match: Sik3 (gene:FBgn0262103 transcript:FBtr0304024)

HSP 1 Score: 124.02 bits (310), Expect = 1.473e-29
Identity = 82/269 (30.48%), Postives = 137/269 (50.93%), Query Frame = 1
Query:  166 YNYDKELGKGSYGNVLSGFRKKDHFSVAIKVLPTNLIDNWYFSKTLKMNIPMEILLLSLASNIDGVISMIEYYNDLE-QSEWYIVMERFAETIDLFNYICSEGFLTEHLASQIFYELTRIIIECHLRGILHRDIKEENILIDKYTKKIWLIDFGSGGLMNDDNHY-------SYNGTEEYAPPEWIKYGHYRGCQLESWSLGIVLYSMVCGRIPF------EDNNEILSNTIKFPRKISNNCKELILKCIERDPKNRIQPSEILKHPWI 930
            Y  +K +GKG++  V           VAIK++    ++  Y +KT +     EI +L    +      +   Y  +E QS  Y+V E +A   ++F+++ + G + E  A+++F +L   +  CH RG++HRD+K EN+L+DK    I L DFG        NHY       ++ G+  YA PE  +   Y G + + WSLG+VLY++VCG +PF      E  + ++    + P  +S  C++LI   +  +P  R    +I+KH W+
Sbjct:   41 YELEKTIGKGNFAVVKLATNIVTKTKVAIKIIDKTCLNEEYLNKTFR-----EIAILKSLRHPH----ITRLYEVMESQSMIYLVTE-YAPNGEIFDHLVANGRMKEPEAARVFTQLVSAVHYCHRRGVVHRDLKAENVLLDK-DMNIKLADFGF------SNHYEEGATLKTWCGSPPYAAPEVFQGLEYDGPKSDIWSLGVVLYALVCGALPFDGKTILELKSRVVLGKFRIPFFMSQECEQLIRNMLVVEPDRRYTIKQIIKHRWL 292          
BLAST of Serine/threonine-protein kinase vs. Ensembl Fly
Match: Sik3 (gene:FBgn0262103 transcript:FBtr0344258)

HSP 1 Score: 123.635 bits (309), Expect = 3.549e-29
Identity = 82/269 (30.48%), Postives = 137/269 (50.93%), Query Frame = 1
Query:  166 YNYDKELGKGSYGNVLSGFRKKDHFSVAIKVLPTNLIDNWYFSKTLKMNIPMEILLLSLASNIDGVISMIEYYNDLE-QSEWYIVMERFAETIDLFNYICSEGFLTEHLASQIFYELTRIIIECHLRGILHRDIKEENILIDKYTKKIWLIDFGSGGLMNDDNHY-------SYNGTEEYAPPEWIKYGHYRGCQLESWSLGIVLYSMVCGRIPF------EDNNEILSNTIKFPRKISNNCKELILKCIERDPKNRIQPSEILKHPWI 930
            Y  +K +GKG++  V           VAIK++    ++  Y +KT +     EI +L    +      +   Y  +E QS  Y+V E +A   ++F+++ + G + E  A+++F +L   +  CH RG++HRD+K EN+L+DK    I L DFG        NHY       ++ G+  YA PE  +   Y G + + WSLG+VLY++VCG +PF      E  + ++    + P  +S  C++LI   +  +P  R    +I+KH W+
Sbjct:   41 YELEKTIGKGNFAVVKLATNIVTKTKVAIKIIDKTCLNEEYLNKTFR-----EIAILKSLRHPH----ITRLYEVMESQSMIYLVTE-YAPNGEIFDHLVANGRMKEPEAARVFTQLVSAVHYCHRRGVVHRDLKAENVLLDK-DMNIKLADFGF------SNHYEEGATLKTWCGSPPYAAPEVFQGLEYDGPKSDIWSLGVVLYALVCGALPFDGKTILELKSRVVLGKFRIPFFMSQECEQLIRNMLVVEPDRRYTIKQIIKHRWL 292          
BLAST of Serine/threonine-protein kinase vs. Ensembl Fly
Match: KP78a (gene:FBgn0026064 transcript:FBtr0301426)

HSP 1 Score: 122.479 bits (306), Expect = 3.863e-29
Identity = 86/290 (29.66%), Postives = 140/290 (48.28%), Query Frame = 1
Query:  166 YNYDKELGKGSYGNVLSGFRKKDHFSVAIKVLPTNLIDNWYFSKTLKMNIPMEILLLSLA--SNIDGVISMIEYYNDLEQSEWYIVMERFAETIDLFNYICSEGFLTEHLASQIFYELTRIIIECHLRGILHRDIKEENILIDKYTKKIWLIDFGSGGLMNDDNHY-SYNGTEEYAPPEWIKYGHYRGCQLESWSLGIVLYSMVCGRIPFEDNN------EILSNTIKFPRKISNNCKELILKCIERDPKNRIQPSEILKHPWIIAALDNCDSGRASFDEAFQEASKEIR 1008
            Y   K LGKG++  V           VAIKV     ID    + + +  +  E+ ++ L    NI  +  +IE    L     Y+VME +A   +LF+++   G + E  A  IF +L   I  CH + ++HRD+K EN+L+D++   I + DFG G   + +    ++ G+  YA PE      Y G ++++WSLG+VLY++V G +PF+          +L    + P  IS +C+ L+ K +  +P  R   S ++   WI    D  D  R      F+E   E++
Sbjct:   98 YKIIKTLGKGNFAKVKLAIHVPTGREVAIKV-----IDKTQLNTSARQKLYREVKIMKLLNHPNIVRLFQVIESERTL-----YLVME-YASRGELFDHLVKNGRMRERDARVIFRQLVSAIQYCHSKFVVHRDLKAENLLLDQHM-NIKIADFGFGNTFDPNAQLETFCGSPPYAAPELFMGRKYAGPEVDAWSLGVVLYTLVSGSLPFDGGTLKELRERVLRGKYRVPYYISMDCENLMRKFLVLNPAKRTSLSAVMSDKWINLGHDESDRLR-----PFREKPMELQ 370          
BLAST of Serine/threonine-protein kinase vs. Ensembl Fly
Match: Sik3 (gene:FBgn0262103 transcript:FBtr0344259)

HSP 1 Score: 123.25 bits (308), Expect = 4.097e-29
Identity = 82/269 (30.48%), Postives = 137/269 (50.93%), Query Frame = 1
Query:  166 YNYDKELGKGSYGNVLSGFRKKDHFSVAIKVLPTNLIDNWYFSKTLKMNIPMEILLLSLASNIDGVISMIEYYNDLE-QSEWYIVMERFAETIDLFNYICSEGFLTEHLASQIFYELTRIIIECHLRGILHRDIKEENILIDKYTKKIWLIDFGSGGLMNDDNHY-------SYNGTEEYAPPEWIKYGHYRGCQLESWSLGIVLYSMVCGRIPF------EDNNEILSNTIKFPRKISNNCKELILKCIERDPKNRIQPSEILKHPWI 930
            Y  +K +GKG++  V           VAIK++    ++  Y +KT +     EI +L    +      +   Y  +E QS  Y+V E +A   ++F+++ + G + E  A+++F +L   +  CH RG++HRD+K EN+L+DK    I L DFG        NHY       ++ G+  YA PE  +   Y G + + WSLG+VLY++VCG +PF      E  + ++    + P  +S  C++LI   +  +P  R    +I+KH W+
Sbjct:   41 YELEKTIGKGNFAVVKLATNIVTKTKVAIKIIDKTCLNEEYLNKTFR-----EIAILKSLRHPH----ITRLYEVMESQSMIYLVTE-YAPNGEIFDHLVANGRMKEPEAARVFTQLVSAVHYCHRRGVVHRDLKAENVLLDK-DMNIKLADFGF------SNHYEEGATLKTWCGSPPYAAPEVFQGLEYDGPKSDIWSLGVVLYALVCGALPFDGKTILELKSRVVLGKFRIPFFMSQECEQLIRNMLVVEPDRRYTIKQIIKHRWL 292          
BLAST of Serine/threonine-protein kinase vs. Ensembl Zebrafish
Match: pim1 (Pim-1 proto-oncogene, serine/threonine kinase [Source:ZFIN;Acc:ZDB-GENE-061013-139])

HSP 1 Score: 205.682 bits (522), Expect = 2.215e-61
Identity = 107/265 (40.38%), Postives = 149/265 (56.23%), Query Frame = 1
Query:  166 YNYDKELGKGSYGNVLSGFRKKDHFSVAIKVLPTNLIDNWYFSKTLKMNIPMEILLLS-LASNIDGVISMIEYYNDLEQSEWYIVMERFAETIDLFNYICSEGFLTEHLASQIFYELTRIIIECHLRGILHRDIKEENILIDKYTKKIWLIDFGSGGLMNDDNHYSYNGTEEYAPPEWIKYGHYRGCQLESWSLGIVLYSMVCGRIPFEDNNEILSNTIKFPRKISNNCKELILKCIERDPKNRIQPSEILKHPWIIAALDNCDS 957
            Y     LG G +G V +G R  D   VAIK +  + +  W         +PMEI+LL  + +   GVI M+++Y       + IVMER     DLF++I  +G L E LA   F ++   +  CH  G++HRDIK+ENILID  T  + LIDFGSG L+ D  +  ++GT  Y+PPEWIK+  Y G     WSLGI+LY MVCG IPFE + EI+   + F R+IS  C++LI  C+   P +R    +I+ H W+ +     DS
Sbjct:   35 YQVGTVLGSGGFGTVYAGLRIADGAPVAIKHVAKDRVTEWGELPN-GARVPMEIVLLKKVGTGFRGVIKMLDWYE--RPDSFIIVMERPEVVKDLFDFITEKGALPEELARNFFRQVLEAVRHCHNSGVVHRDIKDENILIDLRTGDLKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIKFHRYHGRSATVWSLGILLYDMVCGDIPFEQDEEIVRGQVLFRRRISTECQQLIKWCLALRPADRPSFEDIINHDWMQSTAPPTDS 296          
BLAST of Serine/threonine-protein kinase vs. Ensembl Zebrafish
Match: pim2 (Pim-2 proto-oncogene, serine/threonine kinase [Source:NCBI gene;Acc:58054])

HSP 1 Score: 204.912 bits (520), Expect = 3.370e-61
Identity = 109/281 (38.79%), Postives = 159/281 (56.58%), Query Frame = 1
Query:  136 QQGKTKLELKYNYDKELGKGSYGNVLSGFRKKDHFSVAIKVLPTNLIDNWYFSKTLKMNIPMEILLL-SLASNID------GVISMIEYYNDLEQSEWYIVMERFAETIDLFNYICSEGFLTEHLASQIFYELTRIIIECHLRGILHRDIKEENILIDKYTKKIWLIDFGSGGLMNDDNHYSYNGTEEYAPPEWIKYGHYRGCQLESWSLGIVLYSMVCGRIPFEDNNEILSNTIKFPRKISNNCKELILKCIERDPKNRIQPSEILKHPWII-AALDNCD 954
            + GK   E +Y     LG G +G+V SG R  D   VAIK +  + I  W         +P EI LL SL           G+I M++++ ++   E+ IV E+     DLF++I   G L E LA +   ++   +  CH +GI+HRDIK+ENIL+D  T  I +IDFGSG  + D  +  + GT  Y+PPEWI Y  Y    L  WSLG++LY MVCG IPFE + +I+     F ++ISN+C+ LI  C+  +P +R    +IL+HPW++ +++DN D
Sbjct:   20 KNGKEHFEKQYTMGNLLGSGGFGSVYSGHRISDGQKVAIKQISRDRIQQWSKMPGEVNPVPNEIALLQSLGGGSGSVPGHRGIIRMLDWF-EIPGQEYLIVFEKPQHCQDLFDFITERGALDESLARRFLKQVIEAVQFCHSKGIVHRDIKDENILVDTRTGDIKVIDFGSGATLKDSMYTDFEGTRVYSPPEWILYHKYHALPLTVWSLGVLLYDMVCGDIPFEQDTDIVKAKPSFNKRISNDCRSLICSCLSFNPGDRPSLEQILQHPWMMESSVDNGD 299          
BLAST of Serine/threonine-protein kinase vs. Ensembl Zebrafish
Match: pim3 (Pim-3 proto-oncogene, serine/threonine kinase [Source:ZFIN;Acc:ZDB-GENE-050809-111])

HSP 1 Score: 188.734 bits (478), Expect = 6.499e-55
Identity = 107/274 (39.05%), Postives = 154/274 (56.20%), Query Frame = 1
Query:  124 KFPFQQGKTK---LELKYNYDKELGKGSYGNVLSGFRKKDHFSVAIKVLPTNLIDNWYFSKTLKMN-IPMEILLLS-LASNIDGVISMIEYYNDLEQSEWYIVMERFAETIDLFNYICSEGFLTEHLASQIFYELTRIIIECHLRGILHRDIKEENILIDKYTKKIWLIDFGSGGLMNDDNHYSYNGTEEYAPPEWIKYGHYRGCQLESWSLGIVLYSMVCGRIPFEDNNEILSNTIKFPRKISNNCKELILKCIERDPKNRIQPSEILKHPWI 930
            K   Q  KT+    E  Y+    LG G +G V +G R  D   VAIK +    +  W    T+  + IP+EI+LL  + S   GVI +I++Y       W I+MER     DLF+YI  +G L E  A   F ++   +  C+  G++HRDIK+EN+L+D  T  + LIDFGSG ++ D  +  ++GT  Y+PPEWI+Y  Y G     WSLG++LY MVCG IPFE + EIL   + F R++S  C++LI  C+   P +R    +I +H W+
Sbjct:   24 KIQLQAAKTEREPFEKVYHVGSVLGSGGFGTVYAGTRISDALPVAIKHVAKERVTEW---GTINGSLIPLEIVLLKKVGSTFQGVIKLIDWYE--RPDGWLIIMERPEMVKDLFDYITEKGALDEDTARGFFRQVLEAVRHCYSCGVVHRDIKDENLLVDLRTGDLKLIDFGSGAILKDTVYTDFDGTRVYSPPEWIRYHRYHGRSATVWSLGVLLYDMVCGDIPFEHDEEILRGRLFFRRRVSPVCQQLIKWCLCLRPSDRPTLEQIFEHQWM 292          
BLAST of Serine/threonine-protein kinase vs. Ensembl Zebrafish
Match: pimr54 (Pim proto-oncogene, serine/threonine kinase, related 54 [Source:ZFIN;Acc:ZDB-GENE-070912-425])

HSP 1 Score: 172.94 bits (437), Expect = 7.202e-49
Identity = 85/258 (32.95%), Postives = 138/258 (53.49%), Query Frame = 1
Query:  163 KYNYDKELGKGSYGNVLSGFRKKDHFSVAIKVLPTNLIDNWYFSKTLKMNIPMEILLLSLASNIDGVISMIEYYNDLEQSEWYI-VMERFAETIDLFNYICSEGFLTEHLASQIFYELTRIIIECHLRGILHRDIKEENILIDKYTKKIWLIDFGSGGLMNDDNHYSYNGTEEYAPPEWIKYGHYRGCQLESWSLGIVLYSMVCGRIPFEDNNEILSNT-IKFPRKISNNCKELILKCIERDPKNRIQPSEILKHPWI 930
            +Y     LG+G +G+V +G R+ D   VAIK +     D        +  +P+E+ L++  S+     S+++  +  +    Y+ ++ER A   DL ++    G L E LA ++  +L   +  C  R +LHRD+K EN+LI   +  I L+DFG G LM D  +  + GT  +APPEW ++  Y    L  WS+G+ LY+++C   PF     + S + + FPRK+S  C++LI  C+   P +R    EI +HPW+
Sbjct:   77 QYAKGPLLGRGGFGSVFAGIRRSDGLPVAIKYVSKEPTDT-RLKVDGQGRLPLEVALMTRVSSAPVCPSVLQLLDWFDHRRRYVLILERPAPCQDLQSFCEENGCLDEPLAKKVLVQLIAALKHCESRRVLHRDVKPENLLISTDSHDIKLLDFGCGDLMKDSAYRYFAGTPAFAPPEWFRHHRYHASPLTVWSIGVTLYNILCDCFPFRGAQRVTSKSRLHFPRKLSTECRQLIRWCLSAAPADRPSLDEIERHPWL 333          
BLAST of Serine/threonine-protein kinase vs. Ensembl Zebrafish
Match: pimr49 (Pim proto-oncogene, serine/threonine kinase, related 49 [Source:ZFIN;Acc:ZDB-GENE-070912-459])

HSP 1 Score: 171.4 bits (433), Expect = 2.468e-48
Identity = 84/258 (32.56%), Postives = 138/258 (53.49%), Query Frame = 1
Query:  163 KYNYDKELGKGSYGNVLSGFRKKDHFSVAIKVLPTNLIDNWYFSKTLKMNIPMEILLLSLASNIDGVISMIEYYNDLEQSEWYI-VMERFAETIDLFNYICSEGFLTEHLASQIFYELTRIIIECHLRGILHRDIKEENILIDKYTKKIWLIDFGSGGLMNDDNHYSYNGTEEYAPPEWIKYGHYRGCQLESWSLGIVLYSMVCGRIPFEDNNEILSNT-IKFPRKISNNCKELILKCIERDPKNRIQPSEILKHPWI 930
            +Y     LG+G +G+V +G R+ D   VAIK +     D        +  +P+E+ L++  S+     S+++  +  +    Y+ ++ER A   DL ++    G L E LA ++  +L   +  C  R +LHRD+K EN+LI   +  I L+DFG G LM D  +  + GT  +APPEW ++  Y    L  WS+G+ LY+++C   PF     + S + + FPRK+S  C++LI  C+   P +R    +I +HPW+
Sbjct:   77 QYAKGPLLGRGGFGSVFAGIRRSDGLPVAIKYVSKEPTDT-RLKVDGQGRLPLEVALMTRVSSAPVCPSVLQLLDWFDHRRRYVLILERPAPCQDLQSFCEENGCLDEPLAKKVLVQLIAALKHCESRRVLHRDVKPENLLISTDSHDIKLLDFGCGDLMKDSAYRYFAGTPAFAPPEWFRHHRYHASPLTVWSIGVTLYNILCDCFPFRGAQRVTSKSRLHFPRKLSTECRQLIRWCLSAAPADRPSLDDIERHPWL 333          
BLAST of Serine/threonine-protein kinase vs. Ensembl Xenopus
Match: ncbp1 (nuclear cap binding protein subunit 1 [Source:Xenbase;Acc:XB-GENE-5841194])

HSP 1 Score: 202.216 bits (513), Expect = 5.137e-60
Identity = 114/292 (39.04%), Postives = 164/292 (56.16%), Query Frame = 1
Query:  145 KTKLELKYNYDKELGKGSYGNVLSGFRKKDHFSVAIKVLPTNLIDNW-YFSKTLKMNIPMEILLLSLASN-IDGVISMIEYYNDLEQSEWYIVMERFAETIDLFNYICSEGFLTEHLASQIFYELTRIIIECHLRGILHRDIKEENILIDKYTKKIWLIDFGSGGLMNDDNHYSYNGTEEYAPPEWIKYGHYRGCQLESWSLGIVLYSMVCGRIPFEDNNEILSNTIKFPRKISNNCKELILKCIERDPKNRIQPSEILKHPWIIAA--LDNCDSGRAS--FDEAFQEASKE 1002
            K   E  Y     +G G +G V SG R  D   VAIK +  + I    + + TL   +P+EI LL   SN   GVI ++++Y       + I+MER     DLF++I   G L E LA+  F ++   +  CH   ++HRDIK+ENIL+D  T ++ LIDFGSG L+ D  +  ++GT  Y+PPEWI++  Y G     WSLGI+LY MVCG IPFE ++EIL   I++  ++S  C+ LI  C+ + P +R    +IL HPW+     LD  D+G+ S   D+     SK+
Sbjct:   30 KEPFENCYQVGPVIGTGGFGTVYSGVRISDKLPVAIKHVSRDRIGEMKHMNGTL---VPLEIYLLKKVSNGCRGVIRLLDWYE--RPDGFIIIMERPEPVQDLFDFITERGALGEELATNFFRQVVEAVRHCHSCDVVHRDIKDENILVDLRTAELKLIDFGSGALLRDAVYTDFDGTRVYSPPEWIRFHKYHGRSATVWSLGILLYDMVCGDIPFEHDDEILKGKIQYRCRVSRECQHLIEWCLSKRPSDRPSLEQILAHPWMSQDNFLDKKDNGKVSRKLDQEATTTSKD 316          
BLAST of Serine/threonine-protein kinase vs. Ensembl Xenopus
Match: ncbp1 (nuclear cap binding protein subunit 1 [Source:Xenbase;Acc:XB-GENE-5841194])

HSP 1 Score: 202.601 bits (514), Expect = 7.253e-60
Identity = 114/292 (39.04%), Postives = 164/292 (56.16%), Query Frame = 1
Query:  145 KTKLELKYNYDKELGKGSYGNVLSGFRKKDHFSVAIKVLPTNLIDNW-YFSKTLKMNIPMEILLLSLASN-IDGVISMIEYYNDLEQSEWYIVMERFAETIDLFNYICSEGFLTEHLASQIFYELTRIIIECHLRGILHRDIKEENILIDKYTKKIWLIDFGSGGLMNDDNHYSYNGTEEYAPPEWIKYGHYRGCQLESWSLGIVLYSMVCGRIPFEDNNEILSNTIKFPRKISNNCKELILKCIERDPKNRIQPSEILKHPWIIAA--LDNCDSGRAS--FDEAFQEASKE 1002
            K   E  Y     +G G +G V SG R  D   VAIK +  + I    + + TL   +P+EI LL   SN   GVI ++++Y       + I+MER     DLF++I   G L E LA+  F ++   +  CH   ++HRDIK+ENIL+D  T ++ LIDFGSG L+ D  +  ++GT  Y+PPEWI++  Y G     WSLGI+LY MVCG IPFE ++EIL   I++  ++S  C+ LI  C+ + P +R    +IL HPW+     LD  D+G+ S   D+     SK+
Sbjct:   49 KEPFENCYQVGPVIGTGGFGTVYSGVRISDKLPVAIKHVSRDRIGEMKHMNGTL---VPLEIYLLKKVSNGCRGVIRLLDWYE--RPDGFIIIMERPEPVQDLFDFITERGALGEELATNFFRQVVEAVRHCHSCDVVHRDIKDENILVDLRTAELKLIDFGSGALLRDAVYTDFDGTRVYSPPEWIRFHKYHGRSATVWSLGILLYDMVCGDIPFEHDDEILKGKIQYRCRVSRECQHLIEWCLSKRPSDRPSLEQILAHPWMSQDNFLDKKDNGKVSRKLDQEATTTSKD 335          
BLAST of Serine/threonine-protein kinase vs. Ensembl Xenopus
Match: PIM3 (Pim-3 proto-oncogene, serine/threonine kinase [Source:NCBI gene;Acc:100497723])

HSP 1 Score: 198.749 bits (504), Expect = 1.253e-58
Identity = 105/281 (37.37%), Postives = 157/281 (55.87%), Query Frame = 1
Query:  130 PFQQGKTKLELKYNYDKELGKGSYGNVLSGFRKKDHFSVAIKVLPTNLIDNWYFSKTLK-MNIPMEILLLS-LASNIDGVISMIEYYNDLEQSEWYIVMERFAETIDLFNYICSEGFLTEHLASQIFYELTRIIIECHLRGILHRDIKEENILIDKYTKKIWLIDFGSGGLMNDDNHYSYNGTEEYAPPEWIKYGHYRGCQLESWSLGIVLYSMVCGRIPFEDNNEILSNTIKFPRKISNNCKELILKCIERDPKNRIQPSEILKHPWI----IAALDNCD 954
            P +  K   E  Y     LG G +G V SG R  D   VA+K +    + +W    TL  + +P+EI+LL  + +   GVI ++++Y       + IVMER     DLF+YI  +G L E  A   F ++   +  C+  G++HRDIK+EN+L+D    ++ LIDFGSG L+ D  +  ++GT  Y+PPEW++Y  Y G     WSLG++LY MVCG IPFE + EI+   + F R+IS  C++LI  C+   P +R    +I  HPW+    +   ++CD
Sbjct:   28 PVKVEKEPFEKVYQVGSVLGSGGFGTVYSGSRIADGLPVAVKHVAKERVTDW---GTLNGVMVPLEIVLLKKVGTGFRGVIKLLDWYE--RADGFLIVMERPEPVKDLFDYITEKGALDEDTARGFFRQVLEAVRHCYSCGVVHRDIKDENLLVDLRNGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWVRYHRYHGRSATVWSLGVLLYDMVCGDIPFEQDEEIVRVRLYFRRRISTECQQLIKWCLSLRPSDRPTLEQIFDHPWMCKCDLVKSEDCD 303          
BLAST of Serine/threonine-protein kinase vs. Ensembl Xenopus
Match: PASK (PAS domain containing serine/threonine kinase [Source:NCBI gene;Acc:100488299])

HSP 1 Score: 134.806 bits (338), Expect = 2.436e-33
Identity = 96/284 (33.80%), Postives = 152/284 (53.52%), Query Frame = 1
Query:  160 LKYNYDKELGKGSYGNVLSGF-RKKDHFSVAIKVLPTN-LIDNWYFSKTLKMNIPMEILLLSLA--SNIDGVISMIEYYNDLEQSEWYIVMERFAETIDLFNYICSEGFLTEHLASQIFYELTRIIIECHLRGILHRDIKEENILIDKYTKKIWLIDFGSGGLMNDDNHYS-YNGTEEYAPPEWIKYGHYRGCQLESWSLGIVLYSMVCGRIPFEDNNEILSNTIKFPRKISNNCKELILKCIERDPKNRIQPSEILKHPWIIAALDNCDSGRASFDEAFQEAS 996
            LKY     LGKG++G V S   R      V +K +  + ++D+ +        +  EI +LS     NI  V+ + E  ND   + + +VME   + +DLF++I S+  L E LAS IF +L   +   H + ILHRDIK+ENI+I      I L+DFGS   ++    +S + GT EY  PE +    Y G +LE WSLG+ LY+++ G  PF + +EIL   +  P  +S   + LI   ++RDP+ R+   E+L+ PW+   ++  +    +++E +  AS
Sbjct:  236 LKYQTVSPLGKGAFGFVWSACGRDSAKEEVVVKFIRKDRVLDDCWVQDPELGKVTQEIAILSRVQHPNIIRVVDVFE--ND---TFFQLVMELHGDGLDLFDFIDSQPSLDEPLASYIFRQLVSAVGYLHNQHILHRDIKDENIIIAP-DFSIKLVDFGSAAHLHQGTLFSTFCGTTEYCAPEVLLGNPYPGPELEMWSLGVTLYTLIFGENPFCEVDEILEAELNPPFNVSQKLQVLISGLLQRDPEIRMTLDELLRDPWVTQPINLAE---YTWEEVYPPAS 510          
BLAST of Serine/threonine-protein kinase vs. Ensembl Xenopus
Match: PASK (PAS domain containing serine/threonine kinase [Source:NCBI gene;Acc:100488299])

HSP 1 Score: 135.576 bits (340), Expect = 6.522e-33
Identity = 97/310 (31.29%), Postives = 166/310 (53.55%), Query Frame = 1
Query:  160 LKYNYDKELGKGSYGNVLSGF-RKKDHFSVAIKVLPTN-LIDNWYFSKTLKMNIPMEILLLSLASNIDGVISMIEYYNDLEQSEWYIVMERFAETIDLFNYICSEGFLTEHLASQIFYELTRIIIECHLRGILHRDIKEENILIDKYTKKIWLIDFGSGGLMNDDNHYS-YNGTEEYAPPEWIKYGHYRGCQLESWSLGIVLYSMVCGRIPFEDNNEILSNTIKFPRKISNNCKELILKCIERDPKNRIQPSEILKHPWIIAALDNCDSGRASFDEAFQEASKEI-RRCSCTCADNFQSFFKDD-TNQPE 1074
            LKY     LGKG++G V S   R      V +K +  + ++D+ +        +  EI +LS   + + +I +++ + +   + + +VME   + +DLF++I S+  L E LAS IF +L   +   H + ILHRDIK+ENI+I      I L+DFGS   ++    +S + GT EY  PE +    Y G +LE WSLG+ LY+++ G  PF + +EIL   +  P  +S   + LI   ++RDP+ R+   E+L+ PW+   ++  +    +++E +  AS          C D+++S + ++  NQP+
Sbjct:  887 LKYQTVSPLGKGAFGFVWSACGRDSAKEEVVVKFIRKDRVLDDCWVQDPELGKVTQEIAILSRVQHPN-IIRVVDVFEN--DTFFQLVMELHGDGLDLFDFIDSQPSLDEPLASYIFRQLVSAVGYLHNQHILHRDIKDENIIIAP-DFSIKLVDFGSAAHLHQGTLFSTFCGTTEYCAPEVLLGNPYPGPELEMWSLGVTLYTLIFGENPFCEVDEILEAELNPPFNVSQKLQVLISGLLQRDPEIRMTLDELLRDPWVTQPINLAE---YTWEEVYPPASSHKDDDGPGLCPDSYKSEWNEEFQNQPQ 1189          
BLAST of Serine/threonine-protein kinase vs. Ensembl Mouse
Match: Pim1 (proviral integration site 1 [Source:MGI Symbol;Acc:MGI:97584])

HSP 1 Score: 206.838 bits (525), Expect = 5.931e-62
Identity = 109/284 (38.38%), Postives = 162/284 (57.04%), Query Frame = 1
Query:   82 HFFVMDCDYENYLRKFPFQQGKTKLELKYNYDKELGKGSYGNVLSGFRKKDHFSVAIKVLPTNLIDNWYFSKTLKMNIPMEILLLS-LASNIDGVISMIEYYNDLEQSEWYIVMERFAETIDLFNYICSEGFLTEHLASQIFYELTRIIIECHLRGILHRDIKEENILIDKYTKKIWLIDFGSGGLMNDDNHYSYNGTEEYAPPEWIKYGHYRGCQLESWSLGIVLYSMVCGRIPFEDNNEILSNTIKFPRKISNNCKELILKCIERDPKNRIQPSEILKHPWI 930
            H     C+  +  +  P ++ K  LE +Y     LG G +G+V SG R  D+  VAIK +  + I +W         +PME++LL  ++S+  GVI +++++       + +++ER     DLF++I   G L E LA   F+++   +  CH  G+LHRDIK+ENILID    +I LIDFGSG L+ D  +  ++GT  Y+PPEWI+Y  Y G     WSLGI+LY MVCG IPFE + EI+   + F + +S+ C+ LI  C+   P +R    EI  HPW+
Sbjct:   11 HLRAAPCNDLHATKLAPGKE-KEPLESQYQVGPLLGSGGFGSVYSGIRVADNLPVAIKHVEKDRISDWGELPN-GTRVPMEVVLLKKVSSDFSGVIRLLDWFE--RPDSFVLILERPEPVQDLFDFITERGALQEDLARGFFWQVLEAVRHCHNCGVLHRDIKDENILIDLSRGEIKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDIPFEHDEEIIKGQVFFRQTVSSECQHLIKWCLSLRPSDRPSFEEIRNHPWM 290          
BLAST of Serine/threonine-protein kinase vs. Ensembl Mouse
Match: Pim2 (proviral integration site 2 [Source:MGI Symbol;Acc:MGI:97587])

HSP 1 Score: 203.371 bits (516), Expect = 7.328e-60
Identity = 104/270 (38.52%), Postives = 151/270 (55.93%), Query Frame = 1
Query:  130 PFQQGKTKLELKYNYDKELGKGSYGNVLSGFRKKDHFSVAIKVLPTNLIDNWYFSKTLKMNIPMEILLL---SLASNIDGVISMIEYYNDLEQSEWYIVMERFAETIDLFNYICSEGFLTEHLASQIFYELTRIIIECHLRGILHRDIKEENILIDKYTKKIWLIDFGSGGLMNDDNHYSYNGTEEYAPPEWIKYGHYRGCQLESWSLGIVLYSMVCGRIPFEDNNEILSNTIKFPRKISNNCKELILKCIERDPKNRIQPSEILKHPWI 930
            P  + +   E +Y     LGKG +G V +G R  D   VAIKV+  N +  W  + +  +  P+E+ LL      +   GVI +++++   E   + +V+ER     DLF+YI  +G L E  +   F ++   +  CH RG++HRDIK+ENILID     I LIDFGSG L++D+ +  ++GT  Y+PPEWI    Y       WSLG++LY MVCG IPFE + EIL   + FP  +S +C  LI +C+   P +R    EIL  PW+
Sbjct:   79 PGGKDRAAFEAEYRLGPLLGKGGFGTVFAGHRVTDRRQVAIKVISRNRVLGWS-TVSDSVTCPLEVALLWKVGEGNGHPGVIRLLDWFETPEG--FMLVLERPMPAQDLFDYITEKGPLGESCSRSFFTQVVAAVQHCHARGVVHRDIKDENILIDLCRGSIKLIDFGSGALLHDEPYTDFDGTRVYSPPEWISRHQYHALPATVWSLGVLLYDMVCGDIPFERDQEILEAELHFPAHVSPDCCALIRRCLAPKPCSRPSLEEILLDPWM 345          
BLAST of Serine/threonine-protein kinase vs. Ensembl Mouse
Match: Pim2 (proviral integration site 2 [Source:MGI Symbol;Acc:MGI:97587])

HSP 1 Score: 203.371 bits (516), Expect = 8.325e-60
Identity = 104/270 (38.52%), Postives = 151/270 (55.93%), Query Frame = 1
Query:  130 PFQQGKTKLELKYNYDKELGKGSYGNVLSGFRKKDHFSVAIKVLPTNLIDNWYFSKTLKMNIPMEILLL---SLASNIDGVISMIEYYNDLEQSEWYIVMERFAETIDLFNYICSEGFLTEHLASQIFYELTRIIIECHLRGILHRDIKEENILIDKYTKKIWLIDFGSGGLMNDDNHYSYNGTEEYAPPEWIKYGHYRGCQLESWSLGIVLYSMVCGRIPFEDNNEILSNTIKFPRKISNNCKELILKCIERDPKNRIQPSEILKHPWI 930
            P  + +   E +Y     LGKG +G V +G R  D   VAIKV+  N +  W  + +  +  P+E+ LL      +   GVI +++++   E   + +V+ER     DLF+YI  +G L E  +   F ++   +  CH RG++HRDIK+ENILID     I LIDFGSG L++D+ +  ++GT  Y+PPEWI    Y       WSLG++LY MVCG IPFE + EIL   + FP  +S +C  LI +C+   P +R    EIL  PW+
Sbjct:   85 PGGKDRAAFEAEYRLGPLLGKGGFGTVFAGHRVTDRRQVAIKVISRNRVLGWS-TVSDSVTCPLEVALLWKVGEGNGHPGVIRLLDWFETPEG--FMLVLERPMPAQDLFDYITEKGPLGESCSRSFFTQVVAAVQHCHARGVVHRDIKDENILIDLCRGSIKLIDFGSGALLHDEPYTDFDGTRVYSPPEWISRHQYHALPATVWSLGVLLYDMVCGDIPFERDQEILEAELHFPAHVSPDCCALIRRCLAPKPCSRPSLEEILLDPWM 351          
BLAST of Serine/threonine-protein kinase vs. Ensembl Mouse
Match: Pim3 (proviral integration site 3 [Source:MGI Symbol;Acc:MGI:1355297])

HSP 1 Score: 190.66 bits (483), Expect = 1.269e-55
Identity = 101/282 (35.82%), Postives = 154/282 (54.61%), Query Frame = 1
Query:  130 PFQQGKTKLELKYNYDKELGKGSYGNVLSGFRKKDHFSVAIKVLPTNLIDNWYFSKTLKMNIPMEILLL---SLASNIDGVISMIEYYNDLEQSEWYIVMERFAETIDLFNYICSEGFLTEHLASQIFYELTRIIIECHLRGILHRDIKEENILIDKYTKKIWLIDFGSGGLMNDDNHYSYNGTEEYAPPEWIKYGHYRGCQLESWSLGIVLYSMVCGRIPFEDNNEILSNTIKFPRKISNNCKELILKCIERDPKNRIQPSEILKHPWIIA----ALDNCD 954
            P +  K   E  Y     LG G +G V +G R  D   VA+K +    +  W       + +P+E++LL     A    GVI +++++       + +V+ER     DLF++I   G L E LA + F ++   +  CH  G++HRDIK+EN+L+D  + ++ LIDFGSG ++ D  +  ++GT  Y+PPEWI+Y  Y G     WSLG++LY MVCG IPFE + EIL   + F R++S  C++LI  C+   P  R    +I  HPW++       +NCD
Sbjct:   28 PAKADKESFEKVYQVGAVLGSGGFGTVYAGSRIADGLPVAVKHVVKERVTEW--GSLGGVAVPLEVVLLRKVGAAGGARGVIRLLDWFE--RPDGFLLVLERPEPAQDLFDFITERGALDEPLARRFFAQVLAAVRHCHNCGVVHRDIKDENLLVDLRSGELKLIDFGSGAVLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSATVWSLGVLLYDMVCGDIPFEQDEEILRGRLFFRRRVSPECQQLIEWCLSLRPSERPSLDQIAAHPWMLGTEGSVPENCD 305          
BLAST of Serine/threonine-protein kinase vs. Ensembl Mouse
Match: Pim1 (proviral integration site 1 [Source:MGI Symbol;Acc:MGI:97584])

HSP 1 Score: 129.413 bits (324), Expect = 2.025e-34
Identity = 74/209 (35.41%), Postives = 113/209 (54.07%), Query Frame = 1
Query:   82 HFFVMDCDYENYLRKFPFQQGKTKLELKYNYDKELGKGSYGNVLSGFRKKDHFSVAIKVLPTNLIDNWYFSKTLKMNIPMEILLLS-LASNIDGVISMIEYYNDLEQSEWYIVMERFAETIDLFNYICSEGFLTEHLASQIFYELTRIIIECHLRGILHRDIKEENILIDKYTKKIWLIDFGSGGLMNDDNHYSYNGTEEYAPPEWIKY 705
            H     C+  +  +  P ++ K  LE +Y     LG G +G+V SG R  D+       LP N              +PME++LL  ++S+  GVI +++++       + +++ER     DLF++I   G L E LA   F+++   +  CH  G+LHRDIK+ENILID    +I LIDFGSG L+ D  +  ++GT  Y+PPEWI+Y
Sbjct:    7 HLRAAPCNDLHATKLAPGKE-KEPLESQYQVGPLLGSGGFGSVYSGIRVADN-------LPPN-----------GTRVPMEVVLLKKVSSDFSGVIRLLDWFE--RPDSFVLILERPEPVQDLFDFITERGALQEDLARGFFWQVLEAVRHCHNCGVLHRDIKDENILIDLSRGEIKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRY 194          
BLAST of Serine/threonine-protein kinase vs. UniProt/SwissProt
Match: sp|P06803|PIM1_MOUSE (Serine/threonine-protein kinase pim-1 OS=Mus musculus OX=10090 GN=Pim1 PE=1 SV=3)

HSP 1 Score: 206.838 bits (525), Expect = 4.149e-61
Identity = 109/284 (38.38%), Postives = 162/284 (57.04%), Query Frame = 1
Query:   82 HFFVMDCDYENYLRKFPFQQGKTKLELKYNYDKELGKGSYGNVLSGFRKKDHFSVAIKVLPTNLIDNWYFSKTLKMNIPMEILLLS-LASNIDGVISMIEYYNDLEQSEWYIVMERFAETIDLFNYICSEGFLTEHLASQIFYELTRIIIECHLRGILHRDIKEENILIDKYTKKIWLIDFGSGGLMNDDNHYSYNGTEEYAPPEWIKYGHYRGCQLESWSLGIVLYSMVCGRIPFEDNNEILSNTIKFPRKISNNCKELILKCIERDPKNRIQPSEILKHPWI 930
            H     C+  +  +  P ++ K  LE +Y     LG G +G+V SG R  D+  VAIK +  + I +W         +PME++LL  ++S+  GVI +++++       + +++ER     DLF++I   G L E LA   F+++   +  CH  G+LHRDIK+ENILID    +I LIDFGSG L+ D  +  ++GT  Y+PPEWI+Y  Y G     WSLGI+LY MVCG IPFE + EI+   + F + +S+ C+ LI  C+   P +R    EI  HPW+
Sbjct:   11 HLRAAPCNDLHATKLAPGKE-KEPLESQYQVGPLLGSGGFGSVYSGIRVADNLPVAIKHVEKDRISDWGELPN-GTRVPMEVVLLKKVSSDFSGVIRLLDWFE--RPDSFVLILERPEPVQDLFDFITERGALQEDLARGFFWQVLEAVRHCHNCGVLHRDIKDENILIDLSRGEIKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDIPFEHDEEIIKGQVFFRQTVSSECQHLIKWCLSLRPSDRPSFEEIRNHPWM 290          
BLAST of Serine/threonine-protein kinase vs. UniProt/SwissProt
Match: sp|Q95LJ0|PIM1_FELCA (Serine/threonine-protein kinase pim-1 OS=Felis catus OX=9685 GN=PIM1 PE=2 SV=1)

HSP 1 Score: 206.838 bits (525), Expect = 5.345e-61
Identity = 108/284 (38.03%), Postives = 162/284 (57.04%), Query Frame = 1
Query:   82 HFFVMDCDYENYLRKFPFQQGKTKLELKYNYDKELGKGSYGNVLSGFRKKDHFSVAIKVLPTNLIDNWYFSKTLKMNIPMEILLLS-LASNIDGVISMIEYYNDLEQSEWYIVMERFAETIDLFNYICSEGFLTEHLASQIFYELTRIIIECHLRGILHRDIKEENILIDKYTKKIWLIDFGSGGLMNDDNHYSYNGTEEYAPPEWIKYGHYRGCQLESWSLGIVLYSMVCGRIPFEDNNEILSNTIKFPRKISNNCKELILKCIERDPKNRIQPSEILKHPWI 930
            H     C+  +  +  P ++ K  LE +Y     LG G +G+V SG R  D+  VAIK +  + I +W         +PME++LL  ++S   GVI +++++       + +++ER     DLF++I   G L E LA   F+++   +  CH  G+LHRDIK+ENILID    ++ LIDFGSG L+ D  +  ++GT  Y+PPEWI+Y  Y G     WSLGI+LY MVCG IPFE + EI+   + F +++S+ C+ LI  C+   P +R    EI  HPW+
Sbjct:   11 HLRTAPCNDLHATKLAPGKE-KEPLESQYQVGPLLGSGGFGSVYSGIRVADNLPVAIKHVEKDRISDWGELPN-GTRVPMEVVLLKKVSSGFSGVIRLLDWFE--RPDSFVLILERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDIPFEHDEEIIRGQVFFRQRVSSECQHLIRWCLALRPSDRPSFEEIQNHPWM 290          
BLAST of Serine/threonine-protein kinase vs. UniProt/SwissProt
Match: sp|P26794|PIM1_RAT (Serine/threonine-protein kinase pim-1 OS=Rattus norvegicus OX=10116 GN=Pim1 PE=1 SV=1)

HSP 1 Score: 206.453 bits (524), Expect = 5.517e-61
Identity = 105/263 (39.92%), Postives = 154/263 (58.56%), Query Frame = 1
Query:  145 KTKLELKYNYDKELGKGSYGNVLSGFRKKDHFSVAIKVLPTNLIDNWYFSKTLKMNIPMEILLLS-LASNIDGVISMIEYYNDLEQSEWYIVMERFAETIDLFNYICSEGFLTEHLASQIFYELTRIIIECHLRGILHRDIKEENILIDKYTKKIWLIDFGSGGLMNDDNHYSYNGTEEYAPPEWIKYGHYRGCQLESWSLGIVLYSMVCGRIPFEDNNEILSNTIKFPRKISNNCKELILKCIERDPKNRIQPSEILKHPWI 930
            K  LE +Y     LG G +G+V SG R  D+  VAIK +  + I +W         +PME++LL  ++S   GVI +++++       + +++ER     DLF++I   G L E LA   F+++   +  CH  G+LHRDIK+ENILID    ++ LIDFGSG L+ D  +  ++GT  Y+PPEWI+Y  Y G     WSLGI+LY MVCG IPFE + EI+   + F +++S+ C+ LI  C+   P +R    EI  HPW+
Sbjct:   31 KEPLESQYQVGPLLGSGGFGSVYSGIRVADNLPVAIKHVEKDRISDWGELPN-GTRVPMEVVLLKKVSSGFSGVIRLLDWFE--RPDSFVLILERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDIPFEHDEEIVKGQVYFRQRVSSECQHLIRWCLSLRPSDRPSFEEIQNHPWM 290          
BLAST of Serine/threonine-protein kinase vs. UniProt/SwissProt
Match: sp|P11309|PIM1_HUMAN (Serine/threonine-protein kinase pim-1 OS=Homo sapiens OX=9606 GN=PIM1 PE=1 SV=4)

HSP 1 Score: 206.453 bits (524), Expect = 5.816e-61
Identity = 108/284 (38.03%), Postives = 162/284 (57.04%), Query Frame = 1
Query:   82 HFFVMDCDYENYLRKFPFQQGKTKLELKYNYDKELGKGSYGNVLSGFRKKDHFSVAIKVLPTNLIDNWYFSKTLKMNIPMEILLLS-LASNIDGVISMIEYYNDLEQSEWYIVMERFAETIDLFNYICSEGFLTEHLASQIFYELTRIIIECHLRGILHRDIKEENILIDKYTKKIWLIDFGSGGLMNDDNHYSYNGTEEYAPPEWIKYGHYRGCQLESWSLGIVLYSMVCGRIPFEDNNEILSNTIKFPRKISNNCKELILKCIERDPKNRIQPSEILKHPWI 930
            H     C+  +  +  P ++ K  LE +Y     LG G +G+V SG R  D+  VAIK +  + I +W         +PME++LL  ++S   GVI +++++       + +++ER     DLF++I   G L E LA   F+++   +  CH  G+LHRDIK+ENILID    ++ LIDFGSG L+ D  +  ++GT  Y+PPEWI+Y  Y G     WSLGI+LY MVCG IPFE + EI+   + F +++S+ C+ LI  C+   P +R    EI  HPW+
Sbjct:   11 HLRAAPCNDLHATKLAPGKE-KEPLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRISDWGELPN-GTRVPMEVVLLKKVSSGFSGVIRLLDWFE--RPDSFVLILERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDIPFEHDEEIIRGQVFFRQRVSSECQHLIRWCLALRPSDRPTFEEIQNHPWM 290          
BLAST of Serine/threonine-protein kinase vs. UniProt/SwissProt
Match: sp|Q9N0P9|PIM1_BOVIN (Serine/threonine-protein kinase pim-1 OS=Bos taurus OX=9913 GN=PIM1 PE=2 SV=1)

HSP 1 Score: 206.068 bits (523), Expect = 8.967e-61
Identity = 105/263 (39.92%), Postives = 154/263 (58.56%), Query Frame = 1
Query:  145 KTKLELKYNYDKELGKGSYGNVLSGFRKKDHFSVAIKVLPTNLIDNWYFSKTLKMNIPMEILLLS-LASNIDGVISMIEYYNDLEQSEWYIVMERFAETIDLFNYICSEGFLTEHLASQIFYELTRIIIECHLRGILHRDIKEENILIDKYTKKIWLIDFGSGGLMNDDNHYSYNGTEEYAPPEWIKYGHYRGCQLESWSLGIVLYSMVCGRIPFEDNNEILSNTIKFPRKISNNCKELILKCIERDPKNRIQPSEILKHPWI 930
            K  LE +Y     LG G +G+V SG R  D+  VAIK +  + I +W         +PME++LL  ++S   GVI +++++       + +++ER     DLF++I   G L E LA   F+++   +  CH  G+LHRDIK+ENILID    ++ LIDFGSG L+ D  +  ++GT  Y+PPEWI+Y  Y G     WSLGI+LY MVCG IPFE + EI+   + F +++S+ C+ LI  C+   P +R    EI  HPW+
Sbjct:   31 KEPLESQYQVGPLLGSGGFGSVYSGIRVADNLPVAIKHVEKDRISDWGELPN-GTRVPMEVVLLKKVSSGFSGVIRLLDWFE--RPDSFVLILERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHDCGVLHRDIKDENILIDLNRGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDIPFEHDEEIVRGQVFFRQRVSSECQHLIRWCLALRPSDRPTFEEIQNHPWM 290          
BLAST of Serine/threonine-protein kinase vs. TrEMBL
Match: T1DBL3 (Pim-1 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 245.743 bits (626), Expect = 1.935e-72
Identity = 127/375 (33.87%), Postives = 202/375 (53.87%), Query Frame = 1
Query:  109 ENYLRKFPFQQGKTKLELKYNYDKELGKGSYGNVLSGFRKKDHFSVAIKVLPTNLIDNWYFSKTLKMNIPMEILLLSLASNIDGVISMIEYYNDLEQSEWYIVMERFAETIDLFNYICSEGFLTEHLASQIFYELTRIIIECHLRGILHRDIKEENILIDKYTKKIWLIDFGSGGLMNDDNHYSYNGTEEYAPPEWIKYGHYRGCQLESWSLGIVLYSMVCGRIPFEDNNEILSNTIKFPRKISNNCKELILKCIERDPKNRIQPSEILKHPWIIA----------------------ALDNCD-------SGRASFDEAFQEASKEIRRCSCTCADNFQSFFKDDTNQPEAAIESINYNLDFINKWQLKVFSKS 1146
            E  L    F  G+      Y   +E+G+G +G+V    R++D   V +K +        Y+ K+  + +P+E++LL+   ++ GVI+++ +Y   +   WY+VM R    +DLF+YI  + +L+E +A+    +L  I+I CH  G+LHRDIK+ENIL+D  T  I+LIDFGSG    DD++  Y+GT  Y+PPEWI+   Y G +LESWSLGI+L+ MVCG IPF ++ +ILS  ++F   +S  CK+LI  C+  DP +R+   EI +HPWI+                       + D+C+       S  +  D A  + S+ I  C  + A     F+  DT + + A  S +  +   +  Q+  F+ +
Sbjct:   17 EQRLSDIDFFCGEDTFRNDYQCYEEVGQGGFGSVYKAVRREDQKKVVVKFISNKKNTEKYYWKSHDLEVPLEVVLLAQCKHVKGVITLLAFYQTTQADGWYLVMNRVERFMDLFDYISCKKYLSEEIAAFFLQQLVTILIGCHQSGVLHRDIKDENILVDLDTHDIYLIDFGSGAFFKDDDYTQYDGTRVYSPPEWIRDHRYNGSKLESWSLGILLFDMVCGDIPFSNDQQILSGHLRFRHVVSGQCKDLIHSCLTHDPCDRVTLFEIARHPWILKQGQPLNKQSLVCTEYTHLVRSHSQDSCEYSPAETVSSSSGDDSAEYQYSQVIPPCFSSKAKGTPKFYISDTEEDDVAAHSQSLEISLHDFQQIPPFADA 391          
BLAST of Serine/threonine-protein kinase vs. TrEMBL
Match: I1ZIJ1 (Pim-3 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 238.424 bits (607), Expect = 1.208e-69
Identity = 116/266 (43.61%), Postives = 171/266 (64.29%), Query Frame = 1
Query:  139 QGKTKLE-LKYNYD--KELGKGSYGNVLSGFRKKDHFSVAIKVLPTNLIDNWYFSKTLKMNIPMEILLLSLASNIDGVISMIEYYNDLEQSEWYIVMERFAETIDLFNYICSEGFLTEHLASQIFYELTRIIIECHLRGILHRDIKEENILIDKYTKKIWLIDFGSGGLMNDDNHYSYNGTEEYAPPEWIKYGHYRGCQLESWSLGIVLYSMVCGRIPFEDNNEILSNTIKFPRKISNNCKELILKCIERDPKNRIQPSEILKHPW 927
            Q   KLE  +Y Y   + +G+G +G V    R+ D   VAIK +  + I +W+F   +   +P+EI L+     +DGVI + +Y+   E   WYIVM+RF   IDLF++I + G ++E  AS    +L  I+I CH  G+ HRDIK+ENI+ID  T KI+LIDFG+GG+++D  +  ++GT  Y+PPEWI+Y  Y    LE WSLGI+LY MVCG +P+++++ I++  + F R IS+ C++LI  C+ER+P+NR   S ILKH W
Sbjct:   12 QMSEKLEDFQYEYQSLEIIGEGGFGKVRKAIRRSDKKQVAIKFISNSKITSWHFYSKINKQVPLEIALMCRCRKVDGVIKIFKYFYIKEHKGWYIVMDRFENHIDLFDHITNMGQISEKDASNFMNQLITILINCHNLGVCHRDIKDENIIIDLSTNKIYLIDFGAGGILHDGLYSEFDGTRVYSPPEWIQYKRYHAVPLEIWSLGILLYDMVCGNLPYDNDDGIVNCCLAFRRPISHFCQDLIKNCLERNPENRPSLSNILKHRW 277          
BLAST of Serine/threonine-protein kinase vs. TrEMBL
Match: A0A0K2TXV8 (Protein kinase domain-containing protein OS=Lepeophtheirus salmonis OX=72036 PE=3 SV=1)

HSP 1 Score: 224.172 bits (570), Expect = 1.245e-64
Identity = 112/281 (39.86%), Postives = 168/281 (59.79%), Query Frame = 1
Query:   94 MDCDYENYLRKFPFQQGKTKLELKYNYDKELGKGSYGNVLSGFRKKDHFSVAIKVLPTNLIDNWYFSKTLKMNIPMEILLLSLASNIDGVISMIEYYNDLEQSEWYIVMERFAETIDLFNYICSEGFLTEHLASQIFYELTRIIIECHLRGILHRDIKEENILIDKYTKKIWLIDFGSGGLMNDDNHYSYNGTEEYAPPEWIKYGHYRGCQLESWSLGIVLYSMVCGRIPFEDNNEILSNTIKFPRKISNNCKELILKCIERDPKNRIQPSEILKHPWIIA 936
            M C     + + PF++        Y   + LGKG +G V +G R +D   VAIK +    + +W      +  IP+E+ LL    ++ GVI ++++Y  ++   +  +ME+     DLF +I  +G L E LA   F ++ R I+ CH +G++HRDIK+EN+L+D  T ++ LIDFGSG  +    +  ++GT  YAPPEWI+   Y G     WSLGI+LY MVCG IPFE++ +I S  IKF R +S+ C++LIL+C+ R P +RIQ  EIL+HPW+ A
Sbjct:   18 MVCGRSRGVIRDPFEKA-------YKVGEVLGKGGFGVVYAGIRVRDGKQVAIKHVSRAKVTDWDIINGRR--IPLELRLLKTVQSVSGVIRLLDFYERIDS--FVYIMEKPTPCKDLFEFITDKGVLEESLARNFFRQVVRTIVACHRKGVIHRDIKDENLLVDLKTLELKLIDFGSGAHIKSGAYTDFDGTRMYAPPEWIRSSCYHGNTATVWSLGILLYDMVCGDIPFENDEQICSAEIKFRRPLSSACQDLILRCLRRRPYDRIQLLEILRHPWLEA 287          
BLAST of Serine/threonine-protein kinase vs. TrEMBL
Match: A0A067RFR1 (Serine/threonine-protein kinase Pim-3 OS=Zootermopsis nevadensis OX=136037 GN=L798_08061 PE=3 SV=1)

HSP 1 Score: 221.09 bits (562), Expect = 9.240e-64
Identity = 111/274 (40.51%), Postives = 162/274 (59.12%), Query Frame = 1
Query:  154 LELKYNYDKELGKGSYGNVLSGFRKKDHFSVAIKVLPTNLIDNWYFSKTLKMNIPMEILLLSLASNIDGVISMIEYYNDLEQSEW-YIVMERFAETIDLFNYICSEGFLTEHLASQIFYELTRIIIECHLRGILHRDIKEENILIDKYTKKIWLIDFGSGGLMNDDNHYSYNGTEEYAPPEWIKYGHYRGCQLESWSLGIVLYSMVCGRIPFEDNNEILSNTIKFPRKISNNCKELILKCIERDPKNRIQPSEILKHPWIIAALDNCDSGRASF 972
             E  Y     LGKG +G V SG R  D   VAIK +    + +W   +     +P+E+ LL   ++I GVI +++YY   E S+   I+MER  +  DLF+YI  +  L E +A   F ++   II+CH  G++HRDIK+ENIL+D  +  + LIDFGSG  + D  +  ++GT  YAPPEWI+Y  Y G     WSLGI+LY MVCG +PFE + EI+   + F  ++SN+C++LI KC++  P +R+   +IL+H W+   LD+C     S 
Sbjct:   34 FERSYRVGNILGKGGFGTVYSGVRVHDGVLVAIKQIAKLKVTDWI--EVGSQRVPLEVCLLKQLTHIPGVIKLLDYY---EHSDCCIIIMERPDQAKDLFDYITEKICLKESVARGFFKQVVETIIQCHNAGVIHRDIKDENILVDLKSHSLKLIDFGSGTYLKDSIYTDFDGTRVYAPPEWIQYNRYHGRSATVWSLGILLYGMVCGDVPFEQDEEIMQAAVHFRTQLSNDCQDLIQKCLQIRPSDRLHLEDILQHTWMNCNLDSCADNTGSL 302          
BLAST of Serine/threonine-protein kinase vs. TrEMBL
Match: A0A087UNB8 (Serine/threonine-protein kinase pim-3 (Fragment) OS=Stegodyphus mimosarum OX=407821 GN=X975_04788 PE=3 SV=1)

HSP 1 Score: 219.935 bits (559), Expect = 1.752e-63
Identity = 110/264 (41.67%), Postives = 155/264 (58.71%), Query Frame = 1
Query:  166 YNYDKELGKGSYGNVLSGFRKKDHFSVAIKVLPTNLIDNWYFSKTLKMNIPMEILLLSLASNIDGVISMIEYYNDLEQSEWYIVMERFAETIDLFNYICSEGFLTEHLASQIFYELTRIIIECHLRGILHRDIKEENILIDKYTKKIWLIDFGSGGLMNDDNHYSYNGTEEYAPPEWIKYGHYRGCQLESWSLGIVLYSMVCGRIPFEDNNEILSNTIKFPRKISNNCKELILKCIERDPKNRIQPSEILKHPWIIAALDNCDS 957
            Y     LGKG +G V +G R +D+  VAIK +    +  W   +     IP+EI LL   S++ GV+ + +YY       + IVMER     DLF+YI  +GFL E L+   F+++   +I+CH  G++HRDIK+ENIL+D     + LIDFGSG  + D  +  ++GT  Y+PPEWI    Y G     WSLGI+LY MVCG IPFE + +IL   ++F + +SN CK+LI KC+     +R    EIL+HPW+   L+N  S
Sbjct:   32 YRVGAVLGKGGFGTVYAGTRIRDNVPVAIKHVAKEKVTEW--GQLNGCRIPLEICLLKQVSHVKGVVKLWDYYE--RPDSFIIVMERPESVKDLFDYITEKGFLEEKLSRVFFHQVVESVIDCHKSGVIHRDIKDENILVDLKNLTLRLIDFGSGAFLKDTMYTDFDGTRVYSPPEWIHSHRYNGRAATVWSLGILLYDMVCGDIPFEQDEQILRADVRFKKFLSNECKDLIRKCLSVRAADRPTLEEILRHPWMTMPLENLPS 291          
BLAST of Serine/threonine-protein kinase vs. Ensembl Cavefish
Match: pim1 (serine/threonine-protein kinase pim-1-like [Source:NCBI gene;Acc:103031835])

HSP 1 Score: 214.157 bits (544), Expect = 1.095e-64
Identity = 108/270 (40.00%), Postives = 154/270 (57.04%), Query Frame = 1
Query:  145 KTKLELKYNYDKELGKGSYGNVLSGFRKKDHFSVAIKVLPTNLIDNWYFSKTLKMNIPMEILLLS-LASNIDGVISMIEYYNDLEQSEWYIVMERFAETIDLFNYICSEGFLTEHLASQIFYELTRIIIECHLRGILHRDIKEENILIDKYTKKIWLIDFGSGGLMNDDNHYSYNGTEEYAPPEWIKYGHYRGCQLESWSLGIVLYSMVCGRIPFEDNNEILSNTIKFPRKISNNCKELILKCIERDPKNRIQPSEILKHPWIIAALDNC 951
            K   E  Y     LG G +G V +G R  D   VAIK +  + +  W         +PMEI+LL  +++   GVI M+++Y       + IVMER     DLF++I  +G L E LA   F ++   +  CH  G++HRDIK+ENILID  + ++ LIDFGSG L+ D  +  ++GT  Y+PPEWIKY  Y G     WSLGI+LY MVCG IPFE + EI+   + F R+IS  C++LI  C+   P +R    +++ HPW+ ++  N 
Sbjct:   29 KEPFEKVYQVGSVLGSGGFGTVYAGLRIADGAPVAIKHVAKDRVTEWGELPITGARVPMEIVLLKKVSTGFRGVIKMLDWYE--RPDSFIIVMERPENAKDLFDFITEKGALPEELARSFFRQVLEAVRHCHNSGVVHRDIKDENILIDLRSGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIKYHRYHGRSATVWSLGILLYDMVCGDIPFEQDEEIVRGQVLFRRRISTECQQLIKWCLALRPADRPSFEDLVNHPWMQSSSTNA 296          
BLAST of Serine/threonine-protein kinase vs. Ensembl Cavefish
Match: PIM3 (Pim-3 proto-oncogene, serine/threonine kinase [Source:NCBI gene;Acc:103043334])

HSP 1 Score: 199.519 bits (506), Expect = 2.512e-59
Identity = 102/274 (37.23%), Postives = 155/274 (56.57%), Query Frame = 1
Query:  130 PFQQGKTK---LELKYNYDKELGKGSYGNVLSGFRKKDHFSVAIKVLPTNLIDNWYFSKTLKMNIPMEILLLS-LASNIDGVISMIEYYNDLEQSEWYIVMERFAETIDLFNYICSEGFLTEHLASQIFYELTRIIIECHLRGILHRDIKEENILIDKYTKKIWLIDFGSGGLMNDDNHYSYNGTEEYAPPEWIKYGHYRGCQLESWSLGIVLYSMVCGRIPFEDNNEILSNTIKFPRKISNNCKELILKCIERDPKNRIQPSEILKHPWIIAA 939
            P+++ K +    E  Y     LG G +G V +G R  D   VA+K +  + +  W       + +P+EI+LL  + S+  GVI ++++Y       W IVMER     DLF++I  +G L E  A   F ++   +  C+  G++HRDIK+EN+L+D  T  + LIDFGSG  + D  +  ++GT  Y+PPEWI++  Y G     WSLG++LY MVCG IPFE + EI+   + F R+IS  C++LI  C+   P +R    +I +HPW+  A
Sbjct:    6 PYREVKVEPEPFEKVYQVGSVLGSGGFGTVYAGSRISDGLPVAVKHVAKDRVTEW--GSINGVMVPLEIVLLKKVGSSFRGVIKLLDWYE--RPDGWLIVMERPELVKDLFDFITEKGALDEATARGFFRQVLEAVRHCYSCGVVHRDIKDENLLVDLRTGDLKLIDFGSGAFLKDTVYTDFDGTRVYSPPEWIRFHRYHGRSATIWSLGVLLYDMVCGDIPFEQDEEIIRGRLYFRRRISAECQQLIKWCLSLRPSDRPTLEQIFEHPWMRPA 275          
BLAST of Serine/threonine-protein kinase vs. Ensembl Cavefish
Match: PIM3 (Pim-3 proto-oncogene, serine/threonine kinase [Source:NCBI gene;Acc:103043334])

HSP 1 Score: 199.134 bits (505), Expect = 6.079e-59
Identity = 101/271 (37.27%), Postives = 151/271 (55.72%), Query Frame = 1
Query:  130 PFQQGKTKLELKYNYDKELGKGSYGNVLSGFRKKDHFSVAIKVLPTNLIDNWYFSKTLKMNIPMEILLLS-LASNIDGVISMIEYYNDLEQSEWYIVMERFAETIDLFNYICSEGFLTEHLASQIFYELTRIIIECHLRGILHRDIKEENILIDKYTKKIWLIDFGSGGLMNDDNHYSYNGTEEYAPPEWIKYGHYRGCQLESWSLGIVLYSMVCGRIPFEDNNEILSNTIKFPRKISNNCKELILKCIERDPKNRIQPSEILKHPWIIAA 939
            P +      E  Y     LG G +G V +G R  D   VA+K +  + +  W       + +P+EI+LL  + S+  GVI ++++Y       W IVMER     DLF++I  +G L E  A   F ++   +  C+  G++HRDIK+EN+L+D  T  + LIDFGSG  + D  +  ++GT  Y+PPEWI++  Y G     WSLG++LY MVCG IPFE + EI+   + F R+IS  C++LI  C+   P +R    +I +HPW+  A
Sbjct:   29 PVKVEPEPFEKVYQVGSVLGSGGFGTVYAGSRISDGLPVAVKHVAKDRVTEW--GSINGVMVPLEIVLLKKVGSSFRGVIKLLDWYE--RPDGWLIVMERPELVKDLFDFITEKGALDEATARGFFRQVLEAVRHCYSCGVVHRDIKDENLLVDLRTGDLKLIDFGSGAFLKDTVYTDFDGTRVYSPPEWIRFHRYHGRSATIWSLGVLLYDMVCGDIPFEQDEEIIRGRLYFRRRISAECQQLIKWCLSLRPSDRPTLEQIFEHPWMRPA 295          
BLAST of Serine/threonine-protein kinase vs. Ensembl Cavefish
Match: pim3 (serine/threonine-protein kinase pim-3-like [Source:NCBI gene;Acc:103024220])

HSP 1 Score: 197.208 bits (500), Expect = 2.994e-58
Identity = 105/273 (38.46%), Postives = 151/273 (55.31%), Query Frame = 1
Query:  124 KFPFQQGKTK---LELKYNYDKELGKGSYGNVLSGFRKKDHFSVAIKVLPTNLIDNWYFSKTLKMNIPMEILLLSLASN-IDGVISMIEYYNDLEQSEWYIVMERFAETIDLFNYICSEGFLTEHLASQIFYELTRIIIECHLRGILHRDIKEENILIDKYTKKIWLIDFGSGGLMNDDNHYSYNGTEEYAPPEWIKYGHYRGCQLESWSLGIVLYSMVCGRIPFEDNNEILSNTIKFPRKISNNCKELILKCIERDPKNRIQPSEILKHPWI 930
            K   Q  K++    E  Y     LG G +G V +G R  D   VAIK +    +  W         +P+E+LLL    N   GVI +I++Y       W IVMER     DLF+YI  +G L E  A   F ++   +  C+  G++HRDIK+EN+L+D  T  + LIDFGSG ++ D  +  ++GT  Y+PPEWI+Y  Y G     WSLG++LY MVCG IPFE + EI+  ++ F R+IS +C++LI  C+   P +R    +I +H W+
Sbjct:   24 KIQLQAAKSEREPFEKIYQVGSVLGSGGFGTVYAGSRLADGLPVAIKHVAKERVTEW--GSVNGSLVPLEVLLLKKVGNSFRGVIKLIDWYE--RPDGWLIVMERPEMVKDLFDYITEKGALDEDTARGFFRQVLEAVRHCYSCGVVHRDIKDENLLVDLRTGDLKLIDFGSGAVLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSATVWSLGVLLYDMVCGDIPFEHDEEIMKGSLFFRRRISPDCQQLIKWCLCLRPSDRPTLEQIFEHQWM 292          
BLAST of Serine/threonine-protein kinase vs. Ensembl Cavefish
Match: pim2 (Pim-2 proto-oncogene, serine/threonine kinase [Source:NCBI gene;Acc:58054])

HSP 1 Score: 185.267 bits (469), Expect = 8.750e-54
Identity = 100/279 (35.84%), Postives = 153/279 (54.84%), Query Frame = 1
Query:  136 QQGKTKLELKYNYDKELGKGSYGNVLSGFRKKDHFSVAIKVLPTNLIDNWYFSKTLKMN-IPMEILLL-------SLASNIDGVISMIEYYNDLEQSEWYIVMERFAETIDLFNYICSEGFLTEHLASQIFYELTRIIIECHLRGILHRDIKEENILIDKYTKKIWLIDFGSGGLMNDDNHYSYNGTEEYAPPEWIKYGHYRGCQLESWSLGIVLYSMVCGRIPFEDNNEILSNTIKFPRKISNNCKELILKCIERDPKNRIQPSEILKHPWIIAALDN 948
            +  K   E +Y     LG G +G+V +G R  D   V  K   ++   +   S+  K + +PMEI LL           +  G+I M++++    Q  + IV ER     DLF++I   G + E LA +   ++   I  CH +G++HRDIK+ENIL+D  T  + +IDFGSG L+ D  +  + GT  Y+PPEWI +  Y    L  WSLG++LY MVCG IPFE + +I+S    F ++IS  C+ LI  C+    K+R    +IL+HPW++ + ++
Sbjct:   20 KTAKEPFEKQYKCGALLGSGGFGSVFAGQRISDGLQVNSKTSFSHHFLSLCPSQPDKPSLVPMEIALLLQLGRESPAGPSHRGIIRMLDWFEVPGQG-YLIVFERPQPCKDLFDFITERGVVEEPLAQRFLKQVVEAIQFCHSKGVVHRDIKDENILVDTRTGDLKIIDFGSGALLKDSIYTDFEGTRVYSPPEWIVHQQYEAVPLTVWSLGVLLYDMVCGDIPFEMDRDIVSANPSFTKRISKECQSLIRWCLSFHSKDRPTLEQILQHPWMLESAED 297          
BLAST of Serine/threonine-protein kinase vs. Ensembl Sea Lamprey
Match: snrka (SNF related kinase a [Source:ZFIN;Acc:ZDB-GENE-040718-84])

HSP 1 Score: 122.479 bits (306), Expect = 7.233e-30
Identity = 78/263 (29.66%), Postives = 132/263 (50.19%), Query Frame = 1
Query:  166 YNYDKELGKGSYGNVLSGFRKKDHFSVAIKVLPTNLIDNWYFSKTLKMNIPMEILLLSLASNIDGVISMIEYYNDLEQSEWYIVMERFAETIDLFNYICS-EGFLTEHLASQIFYELTRIIIECHLRGILHRDIKEENILIDKYTKKIWLIDFGSGGLMNDDNHYSYN-GTEEYAPPEWIKYGHYRGCQLESWSLGIVLYSMVCGRIPFEDNNE------ILSNTIKFPRKISNNCKELILKCIERDPKNRIQPSEILKHPWI 930
            Y+ +K LG+G +  V           VA+KV+  + +D    S   +     E+  + L  + + V+ + E  +   Q++ Y+++E  A+  DL++YI   EG L E LA   F ++   I  CH   ++HRD+K EN++  +    + L DFG   L       + + G+  Y+ PE +    Y    ++ WSLG++LY +VCG  PF++ N+      I+      P  IS  CK+LI + ++RDP+ R    E+  HPW+
Sbjct:   16 YDLEKTLGRGHFAVVKLARHVFTGEKVAVKVIDKSKLDPMATSHLFQQ----EVRCMKLVQHPN-VVRLYEVIDT--QTKLYLILE-LADGGDLYDYIMRHEGGLQEELAKTYFAQVVHAISYCHRLHVVHRDLKPENVVFFEKQGLVKLTDFGFSNLFQPGTKLATSCGSLAYSAPEILLGDEYDAPAVDIWSLGVILYMLVCGHPPFQEANDSETLTMIMDCKYTVPAHISRECKDLIARMLQRDPRRRASLQEMEGHPWL 270          
BLAST of Serine/threonine-protein kinase vs. Ensembl Sea Lamprey
Match: aurka (aurora kinase A [Source:ZFIN;Acc:ZDB-GENE-040801-161])

HSP 1 Score: 108.997 bits (271), Expect = 9.386e-27
Identity = 73/263 (27.76%), Postives = 134/263 (50.95%), Query Frame = 1
Query:  166 YNYDKELGKGSYGNVLSGFRKKDHFSVAIKVLPTNLIDNWYFSKTLKMNIPMEILLLSLASNIDGVISMIEYYNDLEQSEWYIVMERFAETIDLFNYICSEGFLTEHLASQIFYELTRIIIECHLRGILHRDIKEENILIDKYTKKIWLIDFGSGGLMNDDNHYSYNGTEEYAPPEWIKYGHYRGCQLESWSLGIVLYSMVCGRIPFED--NNE----ILSNTIKFPRKISNNCKELILKCIERDPKNRIQPSEILKHPWIIA 936
            ++  + LGKG +GNV     K   F +A+KVL  + ++       L+  I ++  L         ++ +  Y++D  ++  Y+++E +A   +L+  +   G   E  ++    ++   +I CH + ++HRDIK EN+L+    +   + DFG           +  GT +Y PPE I+ G     +++ WSLG++ Y  + GR PFE   +NE    I    ++FP  +S+  K+LI   ++ +P  R+Q + +L+HPW+ A
Sbjct:   15 FDIGRPLGKGKFGNVYLAREKSTKFILALKVLFKSQLEKSGVEHQLRREIEIQSHLRH-----PNILRLYGYFHD--RTRVYLILE-YAPRGELYKLLQKLGKFDEERSASYVADMADALIYCHSKKVIHRDIKPENLLLGLKGELK-IADFGWSVHAPSSRRATLCGTLDYLPPEMIE-GRTHDEKVDLWSLGVLCYEFLVGRPPFESETHNETYRRISKVDLRFPSHLSDGAKDLIANLLKHNPHTRLQLASVLQHPWVKA 267          
BLAST of Serine/threonine-protein kinase vs. Ensembl Sea Lamprey
Match: MARK3 (microtubule affinity regulating kinase 3 [Source:HGNC Symbol;Acc:HGNC:6897])

HSP 1 Score: 105.531 bits (262), Expect = 9.273e-25
Identity = 71/270 (26.30%), Postives = 133/270 (49.26%), Query Frame = 1
Query:  142 GKTKLELKYNYDKELGKGSYGNVLSGFRKKDHFSVAIKVLPTNLIDNWYFSKTLKMNIPMEILLLSLASNIDGVISMIEYYNDLEQSEWYIVMERFAETIDLFNYICSEGFLTEHLASQIFYELTRIIIECHLRGILHRDIKEENILIDKYTKKIWLIDFG-SGGLMNDDNHYSYNGTEEYAPPEWIKYGHYRGCQLESWSLGIVLYSMVCGRIPFEDNN------EILSNTIKFPRKISNNCKELILKCIERDPKNRIQPSEILKHPWI 930
            G+T+    Y   K +GKG++  V           VA+K++    ++     K  +    M++L      N   ++ + E   ++E++  Y+VME ++   ++F+Y+ + G + E  A   F ++   +  CH + I+HRD+K EN+L+D     I + DFG S          ++ G+  YA PE  +   Y G +++ WSLG++LY++V G +PF+  N       +L    + P  +S +C+ L+ + +   P  R    +I+K  W+
Sbjct:   60 GQTQRVGNYRLLKTIGKGNFAKVKLAKHTLTGQEVAVKIIDKTQLNTSSLQKLFREVRIMKVL------NHPNIVKLFEVI-EMEKT-LYLVME-YSSGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKHIVHRDLKAENLLLDA-DMNIKIADFGFSNEFTLGSKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKRFLVLHPLKRGSLEQIMKDRWM 319          
BLAST of Serine/threonine-protein kinase vs. Ensembl Sea Lamprey
Match: MARK3 (microtubule affinity regulating kinase 3 [Source:HGNC Symbol;Acc:HGNC:6897])

HSP 1 Score: 104.375 bits (259), Expect = 9.179e-24
Identity = 73/262 (27.86%), Postives = 127/262 (48.47%), Query Frame = 1
Query:  166 YNYDKELGKGSYGNVLSGFRKKDHFSVAIKVLPTNLIDNWYFSKTLKMNIPMEILLLSLASNIDGVISMIEYYNDLEQSEWYIVMERFAETIDLFNYICSEGFLTEHLASQIFYELTRIIIECHLRGILHRDIKEENILIDKYTKKIWLIDFG-SGGLMNDDNHYSYNGTEEYAPPEWIKYGHYRGCQLESWSLGIVLYSMVCGRIPFEDNN------EILSNTIKFPRKISNNCKELILKCIERDPKNRIQPSEILKHPWI 930
            Y   K +GKG++  V           VA+K++    ++     K  +    M+IL      NI  +  +IE    L     Y+VME +A   ++F+Y+ + G + E  A   F ++   +  CH + I+HRD+K EN+L+D     I + DFG S          ++ G+  YA PE  +   Y G +++ WSLG++LY++V G +PF+  N       +L    + P  +S +C+ L+ + +  +P  R    +I+K  W+
Sbjct:   54 YRLLKTIGKGNFAKVKLARHTLTGREVAVKIIDKTQLNPSSLQKLFREVRIMKILN---HPNIVKLFEVIETEKTL-----YLVME-YASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKHIVHRDLKAENLLLDA-DMNIKIADFGFSNEFTLGSKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKRFLVLNPAKRGSLEQIMKDRWM 305          
BLAST of Serine/threonine-protein kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006410.1 (pep scaffold:Pmarinus_7.0:GL476370:17405:31068:-1 gene:ENSPMAG00000005688.1 transcript:ENSPMAT00000006410.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 101.679 bits (252), Expect = 6.046e-23
Identity = 70/263 (26.62%), Postives = 131/263 (49.81%), Query Frame = 1
Query:  166 YNYDKELGKGSYGNVLSGFRKKDHFSVAIKVLPTNLIDNWYFSKTLKMNIPMEILLLSLASNIDGVISMIEYYNDLE-QSEWYIVMERFAETIDLFNYICSEGFLTEHLASQIFYELTRIIIECHLRGILHRDIKEENILIDKYTKKIWLIDFGSGGLMNDDNHY-SYNGTEEYAPPEWIKYGHYRGCQLESWSLGIVLYSMVCGRIPFEDNN------EILSNTIKFPRKISNNCKELILKCIERDPKNRIQPSEILKHPWI 930
            Y   K +GKG++  V           VAIK+     ID    + T    +  E+ ++   ++ +    +++ Y  +E +   Y+VME +A   ++F+Y+ + G + E  A   F ++   +  CH + I+HRD+K EN+L+D     I + DFG        N   ++ G+  YA PE  +   Y G +++ WSLG++LY++V G +PF+  N      ++L    + P  +S +C+ L+ + +  +P  R    +I++  W+
Sbjct:   39 YRLLKTIGKGNFAKVKLARHILTGREVAIKI-----IDKTQLNPTSLQKLFREVRIMKCLNHPN----IVKLYEVIETEKTLYLVME-YASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKNIVHRDLKAENLLLD-VDMHIKIADFGFSNEFTLVNKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELREKVLRGKYRIPFYMSTDCENLLKRFLVLNPIKRGSLEQIMRDRWM 290          
BLAST of Serine/threonine-protein kinase vs. Ensembl Yeast
Match: HSL1 (Nim1p-related protein kinase; septin-binding kinase that localizes to the bud neck septin ring and regulates the morphogenesis checkpoint; phosphorylates Hsl7p and cooperates with Elm1p to recruit Hsl7p to the mother-bud neck, as a prerequisite for the subsequent recruitment, phosphorylation, and degradation of Swe1p; autophosphorylation enhances interactions with Hsl7p [Source:SGD;Acc:S000001584])

HSP 1 Score: 129.798 bits (325), Expect = 4.537e-32
Identity = 89/289 (30.80%), Postives = 142/289 (49.13%), Query Frame = 1
Query:  178 KELGKGSYGNVLSGFRKKDHFSVAIKVLP----------TNLIDNWYFSKTLKMN---------------------IPMEILLLSLASNIDGVISMIEYYNDLEQSEWYIVMERFAETIDLFNYICSEGFLTEHLASQIFYELTRIIIECHLRGILHRDIKEENILIDKYTKKIWLIDFGSGGLMNDDNHYSYN-GTEEYAPPEWIKYGHYRGCQLESWSLGIVLYSMVCGRIPFEDNN------EILSNTIKFPRKISNNCKELILKCIERDPKNRIQPSEILKHPWI 930
            K LGKGS G V      +     AIK++P             + N Y S  +  N                     I  EI+++ L S+ + V+++ E + +  +SE Y+V+E + +  +LF+Y+ S+G L E  A   F ++   +  CH   I HRD+K EN+L+DK  ++I + DFG   L   +     + G+  YA PE +    Y G   + WS GIVL++++ G +PF D+N      ++ S   + P  +S+  ++LI K +  DP+ RI   EILKHP I
Sbjct:   85 KTLGKGSSGRVRLAKNMETGQLAAIKIVPKKKAFVHCSNNGTVPNSYSSSMVTSNVSSPSIASREHSNHSQTNPYGIEREIVIMKLISHTN-VMALFEVWEN--KSELYLVLE-YVDGGELFDYLVSKGKLPEREAIHYFKQIVEGVSYCHSFNICHRDLKPENLLLDKKNRRIKIADFGMAALELPNKLLKTSCGSPHYASPEIVMGRPYHGGPSDVWSCGIVLFALLTGHLPFNDDNIKKLLLKVQSGKYQMPSNLSSEARDLISKILVIDPEKRITTQEILKHPLI 369          
BLAST of Serine/threonine-protein kinase vs. Ensembl Yeast
Match: PSK2 (PAS-domain containing serine/threonine protein kinase; regulates sugar flux and translation in response to an unknown metabolite by phosphorylating Ugp1p and Gsy2p (sugar flux) and Caf20p, Tif11p and Sro9p (translation); PSK2 has a paralog, PSK1, that arose from the whole genome duplication [Source:SGD;Acc:S000005405])

HSP 1 Score: 120.168 bits (300), Expect = 6.171e-29
Identity = 76/257 (29.57%), Postives = 138/257 (53.70%), Query Frame = 1
Query:  184 LGKGSYGNVLSGFRKKDHFSVAIKVLPTN--LIDNWYFSKTLKMNIPMEILLLSL--ASNIDGVISMIEYYNDLEQSEWYIVMERFAET--IDLFNYICSEGFLTEHLASQIFYELTRIIIECHLRGILHRDIKEENILIDKYTKKIWLIDFGSGGLMNDDNHYSYNGTEEYAPPEWIKYGHYRGCQLESWSLGIVLYSMVCGRIPFEDNNEILSNTIKFPRK--ISNNCKELILKCIERDPKNRIQPSEILKHPWI 930
            +G+G+YG V      ++H+ V IK++     L+D W   + L   IP EI +++    ++ + ++ +++++ D     +YI      ET  IDLF+ I  +  + EH A  +F ++   I   H +GI+HRDIK+EN+++D +   + LIDFGS   +       + GT +YA PE +    Y+G   + W+LG++LY+++    P+ + +EIL   ++F +   +S  C  LI + + R+   R    EI +  W+
Sbjct:  847 MGEGAYGKVNLCIHNREHYIVVIKMIFKERILVDTWVRDRKLG-TIPSEIQIMATLNKNSQENILKLLDFFED--DDYYYIETPVHGETGSIDLFDVIEFKKDMVEHEAKLVFKQVVASIKHLHDQGIVHRDIKDENVIVDSH-GFVKLIDFGSAAYIKSGPFDVFVGTMDYAAPEVLGGSSYKGKPQDIWALGVLLYTIIYKENPYYNIDEILEGELRFDKSEHVSEECISLIKRILTREVDKRPTIDEIYEDKWL 1099          
BLAST of Serine/threonine-protein kinase vs. Ensembl Yeast
Match: KCC4 (Protein kinase of the bud neck involved in the septin checkpoint; associates with septin proteins, negatively regulates Swe1p by phosphorylation, shows structural homology to bud neck kinases Gin4p and Hsl1p; KCC4 has a paralog, GIN4, that arose from the whole genome duplication [Source:SGD;Acc:S000000529])

HSP 1 Score: 118.242 bits (295), Expect = 1.939e-28
Identity = 80/264 (30.30%), Postives = 137/264 (51.89%), Query Frame = 1
Query:  184 LGKGSYGNVLSGFRKKDHFSVAIKVLPTNLIDN----WYFSKTLKMNIPMEILLLSLASNIDGVISMIEYYNDLEQSEWYIVMERFAETIDLFNYICSEGFLTEHLASQIFYELTRIIIECHLRGILHRDIKEENILIDKYTKKIWLIDFGSGGLMNDDNHYSYN-GTEEYAPPEWIKYGHYRGCQLESWSLGIVLYSMVCGRIPFEDNN--------EILSNTIKFPR--KISNNCKELILKCIERDPKNRIQPSEILKHPWI 930
            LG GS G V     ++     A+KV+  ++ +N          L  NI  EI+++ L S+ + V+S+ + +     +  Y+++E +AE  +LFN +   G L E  A   F ++   I  CH  GI+HRD+K EN+L+D +   I + DFG   L  D +    + G+  YA PE +    Y G   + WS G++L++++ GR+PF++ N        ++     + P   +IS + ++LI K +  DP+ RI+  +IL HP +
Sbjct:   27 LGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIEREIVIMKLLSHPN-VLSLYDVWE--TNNNLYLILE-YAEKGELFNLLVDHGPLPEREAINCFRQIIIGISYCHALGIVHRDLKPENLLLDSFY-NIKIADFGMAALQTDADLLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLL 285          
BLAST of Serine/threonine-protein kinase vs. Ensembl Yeast
Match: GIN4 (Protein kinase involved in bud growth and assembly of the septin ring; proposed to have kinase-dependent and kinase-independent activities; undergoes autophosphorylation; similar to Hsl1p; GIN4 has a paralog, KCC4, that arose from the whole genome duplication [Source:SGD;Acc:S000002915])

HSP 1 Score: 117.087 bits (292), Expect = 4.946e-28
Identity = 85/271 (31.37%), Postives = 135/271 (49.82%), Query Frame = 1
Query:  184 LGKGSYGNVLSGFRKKDHFSVAIKVLPTNLIDNWYFSKT----------LKMNIPMEILLLSLASNIDGVISMIEYYNDLEQSEWYIVMERFAETIDLFNYICSEGFLTEHLASQIFYELTRIIIECHLRGILHRDIKEENILID-KYTKKIWLIDFGSGGLMNDDNHYSYN-GTEEYAPPEWIKYGHYRGCQLESWSLGIVLYSMVCGRIPF--EDNN------EILSNTIKFPR--KISNNCKELILKCIERDPKNRIQPSEILKHPWI 930
            LG GS G V            A+KV+   + +    S T          L   I  EI+++ L  N   V+ + + +     ++ Y+V+E +AE  +LFN +   G L EH A + F ++   +  CH  GI+HRD+K EN+L+D KY  KI   DFG   L  +      + G+  YA PE +    Y+G   + WS G++L++++ GR+PF  ED N      ++     + P   +IS   ++LI K +  DP+ RI+  +ILKHP +
Sbjct:   25 LGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALPYGIEREIIIMKLL-NHPNVLRLYDVWET--NTDLYLVLE-YAEKGELFNLLVERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIA--DFGMAALETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLL 289          
BLAST of Serine/threonine-protein kinase vs. Ensembl Yeast
Match: SNF1 (AMP-activated S/T protein kinase; forms a complex with Snf4p and members of the Sip1p/Sip2p/Gal83p family; required for transcription of glucose-repressed genes, thermotolerance, sporulation, and peroxisome biogenesis; regulates nucleocytoplasmic shuttling of Hxk2p; regulates filamentous growth and acts as a non-canonical GEF, activating Arf3p during invasive growth; SUMOylation by Mms21p inhibits its function and targets Snf1p for destruction via the Slx5-Slx8 Ub ligase [Source:SGD;Acc:S000002885])

HSP 1 Score: 113.62 bits (283), Expect = 3.978e-27
Identity = 77/262 (29.39%), Postives = 133/262 (50.76%), Query Frame = 1
Query:  166 YNYDKELGKGSYGNVLSGFRKKDHFSVAIKVLPTNLIDNWYFSKT-LKMNIPMEILLLSLASNIDGVISMIEYYNDLEQSEWYIVMERFAETIDLFNYICSEGFLTEHLASQIFYELTRIIIECHLRGILHRDIKEENILIDKYTKKIWLIDFGSGGLMNDDNHYSYN-GTEEYAPPEWIKYGHYRGCQLESWSLGIVLYSMVCGRIPFEDNN------EILSNTIKFPRKISNNCKELILKCIERDPKNRIQPSEILKHPW 927
            Y   K LG+GS+G V   +       VA+K+     I+    +K+ ++  I  EI  L L  +      +I+ Y+ ++  +  I++  +A   +LF+YI     ++E  A + F ++   +  CH   I+HRD+K EN+L+D++   + + DFG   +M D N    + G+  YA PE I    Y G +++ WS G++LY M+C R+PF+D +       I +     P+ +S     LI + +  +P NRI   EI++  W
Sbjct:   55 YQIVKTLGEGSFGKVKLAYHTTTGQKVALKI-----INKKVLAKSDMQGRIEREISYLRLLRHP----HIIKLYDVIKSKDEIIMVIEYAGN-ELFDYIVQRDKMSEQEARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLN-VKIADFGLSNIMTDGNFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDESIPVLFKNISNGVYTLPKFLSPGAAGLIKRMLIVNPLNRISIHEIMQDDW 305          
BLAST of Serine/threonine-protein kinase vs. Ensembl Nematostella
Match: EDO46861 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNH5])

HSP 1 Score: 162.155 bits (409), Expect = 6.862e-46
Identity = 82/242 (33.88%), Postives = 136/242 (56.20%), Query Frame = 1
Query:  208 VLSGFRKKDHFSVAIKVLPTNLIDNWYFSKTLKMNIPMEILLLSLASNIDGVISMIEYYNDLEQSEWYI-VMERFAETIDLFNYICSEGFLTEHLASQIFYELTRIIIECHLRGILHRDIKEENILIDKYTKKIWLIDFGSGGLMNDDNHYSYNGTEEYAPPEWIKYGHYRGCQLESWSLGIVLYSMVCGRIPFEDNNEILSNTIKFPRKISNNCKELILKCIERDPKNRIQPSEILKHPWI 930
            V +G R +D   VAIKV+P N +  ++F +   +++PME+ L  +  + +    ++  Y+  E ++ Y+ V+ER     DLF+YI  +  L+E  A  IF ++   +  C  +G+ HRDIK+EN+L+D  T ++ L DFGSG ++ +  +  Y GT  Y PPEW ++  Y       WSLGI+L++M+ G +PF +  EI+   + F   +S   + L+   + + P  R     ILKHPW+
Sbjct:    2 VYAGTRVRDGKPVAIKVIPKNNV--YFFEEVGGISVPMEVYLHRVLDHPN----VVRLYDYFEYNQAYVLVLERPTHYRDLFDYITEKKLLSEREAKDIFKQVVHAVAYCEGKGVFHRDIKDENLLLDTKTGQVKLFDFGSGTVLENTLYTDYEGTRAYCPPEWFRFHRYHARPCTVWSLGILLFNMLSGDVPFANQIEIVRGELNFAENVSKEAQSLVRWLLAKHPSYRPTLENILKHPWL 237          
BLAST of Serine/threonine-protein kinase vs. Ensembl Nematostella
Match: EDO33625 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRN4])

HSP 1 Score: 132.88 bits (333), Expect = 1.994e-34
Identity = 89/271 (32.84%), Postives = 142/271 (52.40%), Query Frame = 1
Query:  166 YNYDKELGKGSYGNVLSGFRKKDHFSVAIKVLPTNLIDNWYFSKTLKMNIPMEILLLSLASNIDGVISMIEYYNDLEQSEWYIVMERFAETIDLFNYICSEGFLTEHLASQIFYELTRIIIECHLRGILHRDIKEENILIDKYTKKIWLIDFG---SGGLMNDDNH----YSYNGTEEYAPPEWIKYGHYRGCQLESWSLGIVLYSMVCGRIPFEDNN-----EILSNTIKFPR--KISNNCKELILKCIERDPKNRIQPSEILKHPWIIA 936
            Y     LGKGSY  V + + +K    VA+K++      + Y +K L    P EI ++    N   V+S+ E       S  YI+++  A+  DL  YI S G + E+ A   +++L   +   H +G++HRD+K ENIL+++   +I + DFG   +  +M D        ++ G+  YAPPE ++   Y G   + WSLG+VLY+MV   +PF+D N     E +S  + F R  KIS+  K+L+ + +  D K RI  + I +HPW + 
Sbjct:   61 YALGDTLGKGSYAVVKAAYSRKLKKQVAVKIVTKKKAPDDYLTKFL----PREIQVMKHL-NHSNVVSLHEAIE--TSSRIYIILD-LADNGDLLEYIRSNGAIPENEARLFYHQLVDAVEYLHNKGVVHRDLKCENILLNR-DNRILISDFGFARTQHVMADTGKRRLSQTFCGSYAYAPPEILRGIAYDGTLADIWSLGVVLYTMVSASLPFDDTNLKVLLEQVSRDVVFSRRKKISDEVKDLVRRMLVADVKTRIDLASIRRHPWFVG 322          
BLAST of Serine/threonine-protein kinase vs. Ensembl Nematostella
Match: EDO47961 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKT6])

HSP 1 Score: 121.709 bits (304), Expect = 2.287e-31
Identity = 85/268 (31.72%), Postives = 138/268 (51.49%), Query Frame = 1
Query:  148 TKLELK-YNYDKELGKGSYGNVLSGFRKKDHFSVAIKVLPTNLIDNWYFSKTLKMNIPMEILLLSLASNIDGVISMIEYYNDLE-QSEWYIVMERFAETIDLFNYICSEGFLTEHLASQIFYELTRIIIECHLRGILHRDIKEENILIDKYTKKIWLIDFGSGGLMNDDN-HYSYNGTEEYAPPEWIKYGHYRGCQLESWSLGIVLYSMVCGRIPFEDNN--EILS---NTIKFPRKISNNCKELILKCIERDPKNRIQPSEILKHPW 927
            T LEL  Y   + LG+G++  V     KK +  VAIK++        Y  K L    P EI ++   ++ +    +I+ Y  +E +++ Y+++E  AE  DL  YI     L E  A  IF +    +  CH   ++HRD+K EN+L+D    ++ + DFG     +  N   ++ G+  Y  PE ++   Y G   + WS+G+VLY++VC R+PF D++   I++     ++F +K S  C+ELI K +  D K R    E+L  PW
Sbjct:    1 TTLELHGYTVMRNLGEGAFAKVKLAKSKKHNCHVAIKIIDKRKAPKDYIYKFL----PREIRVMHKLNHPN----VIQLYEAIETETKVYLILE-LAEGGDLLEYINKNALLPEERARVIFCQFVATMAYCHKERVVHRDLKCENLLLDA-NGRLKITDFGFACNTHKTNILQTFCGSYAYCSPEILRGDLYDGQASDIWSMGVVLYALVCARLPFGDDDLRAIMNREPRKLRFSKKTSKECRELIRKMLALDEKKRPTAEELLHEPW 258          
BLAST of Serine/threonine-protein kinase vs. Ensembl Nematostella
Match: EDO46091 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR18])

HSP 1 Score: 115.546 bits (288), Expect = 3.989e-29
Identity = 87/275 (31.64%), Postives = 143/275 (52.00%), Query Frame = 1
Query:  166 YNYDKELGKGSYGNVLSGFRKKDHFSVAIKVLPTNLIDNWYFSKTLKMNIPMEILLLSLASNIDG--VISMIEYYNDLEQSE-WYIVMERFAETIDLFNYICSEGFLTEHLASQIFYELTRIIIECHLRGILHRDIKEENILIDKYTKKIWLIDFG----SGG----LMNDDNHYSYNGTEEYAPPEWIKYGHYRGCQLESWSLGIVLYSMVCGRIPFEDNNE------ILSNTIKFPR---KISNNCKELILKCIERDPKNRIQPSEILKHPWI 930
            Y     LGKG+Y  V   +  K   +VA+K++    + +  F+K ++  +  E L       +D   VIS+IE    LE S+ +Y+V+E  A+  DL   +  +  L E+ A +IF ++ + ++ CH +GI HRD+K ENIL+ +  + I + DFG     GG     M      ++ G+  YA PE ++   Y     + WSLG+VL++MV GR PF+D +        L+    +P+   ++S+  KEL+   +  D K+R+   E+  HPWI
Sbjct:    8 YELGSILGKGAYAEVKEAYSNKLGRNVAVKIIEKAKLSSKSFNKFMRREV--EAL-----RQVDHKYVISLIEV---LESSKRFYLVLE-LAQNGDLLQLLQKKKQLHENEARKIFKKIVKGVLHCHRKGIAHRDLKLENILLSRKNEPI-ISDFGFARYVGGSSDTCMTRPRSNTFCGSYAYAAPEILQGIPYDATSSDVWSLGVVLFAMVTGRFPFDDQDRRQLLRHTLAGKFSYPKGSARLSDQLKELVKNMLTADIKSRLTLEEVYDHPWI 270          
BLAST of Serine/threonine-protein kinase vs. Ensembl Nematostella
Match: EDO37951 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SE61])

HSP 1 Score: 117.087 bits (292), Expect = 4.144e-29
Identity = 83/272 (30.51%), Postives = 136/272 (50.00%), Query Frame = 1
Query:  166 YNYDKELGKGSYGNVLSGFRKKDHFSVAIKVLPTNLIDNWYFSKTLKMNIPMEILLLSLASN--IDGVISMIEYYNDLEQSEWYIVMERFAETIDLFNYICSEGFLTEHLASQIFYELTRIIIECHLRGILHRDIKEENILIDKYTKKIWLIDFG------SGGLMNDDNHYSYNGTEEYAPPEWIKYGHYRGCQLESWSLGIVLYSMVCGRIPFEDNN-----EILSNTIKFPR--KISNNCKELILKCIERDPKNRIQPSEILKHPWIIA 936
            Y     LGKGSY  V     K+    VAIK++        + +K L    P EI +L    N  +  ++ +IE       +  YI+ +  AE  DL  YI + G LTE  + ++F ++T  +   H + I+HRD+K EN+L+DK    I + DFG      +         ++Y G+  YA PE +K   Y     + WS+G++LY+M+CGR+PF+D+N     + +   + F    K+S+  K +I K +  +   RI   ++L+ PW++ 
Sbjct:   52 YQLGDVLGKGSYAVVRKANSKRYKRDVAIKIICKKKAPEDFLTKFL----PREIKVLKKIKNTYVTTLLEVIE-----TNTRMYIITD-LAENGDLLEYIRTHGALTEKASRRLFRQITAGVHYIHSQDIVHRDLKCENLLLDK-DLNIIISDFGFARDCLTTATGKKKLSHTYCGSYAYAAPEILKGIAYDATLADVWSMGVILYTMLCGRLPFDDSNLRSLLQQVHKRVTFSSRVKLSDAAKAIIHKMLTWNLPERITVEQLLQEPWLLG 312          
BLAST of Serine/threonine-protein kinase vs. Ensembl Medaka
Match: pim1 (serine/threonine-protein kinase pim-1 [Source:NCBI gene;Acc:101157054])

HSP 1 Score: 203.371 bits (516), Expect = 1.395e-60
Identity = 105/263 (39.92%), Postives = 148/263 (56.27%), Query Frame = 1
Query:  145 KTKLELKYNYDKELGKGSYGNVLSGFRKKDHFSVAIKVLPTNLIDNWYFSKTLKMNIPMEILLLS-LASNIDGVISMIEYYNDLEQSEWYIVMERFAETIDLFNYICSEGFLTEHLASQIFYELTRIIIECHLRGILHRDIKEENILIDKYTKKIWLIDFGSGGLMNDDNHYSYNGTEEYAPPEWIKYGHYRGCQLESWSLGIVLYSMVCGRIPFEDNNEILSNTIKFPRKISNNCKELILKCIERDPKNRIQPSEILKHPWI 930
            K   E  Y     LG G +G V +G R  D   VA+K +  + +  W    +    +PMEI+LL  + +   GVI M++++       + IVMER     DLF++I   G L E LA   F ++   +  CH  G++HRDIK+ENILID  T ++ LIDFGSG L+ D  +  ++GT  Y+PPEWIKY  Y+G     WSLGI+LY MVCG IPFE + EI    + F R+IS  C+ LI  C+   P +R    +++ H W+
Sbjct:   27 KEPFEKLYQVGAVLGSGGFGTVYAGTRISDGVPVAVKHVARDRVSEWGELPS-GARVPMEIVLLKKVGTGFRGVIKMLDWFE--RPDSFIIVMERPENVKDLFDFITERGALPEELARSFFRQVLEAVRHCHSCGVVHRDIKDENILIDLRTGEMKLIDFGSGALLKDTIYTDFDGTRVYSPPEWIKYHRYQGRSATVWSLGILLYDMVCGDIPFEHDEEITRGQVLFRRRISTECQHLIKWCLSLRPTDRPSFEDVINHSWM 286          
BLAST of Serine/threonine-protein kinase vs. Ensembl Medaka
Match: pim3 (Pim-3 proto-oncogene, serine/threonine kinase [Source:NCBI gene;Acc:101171374])

HSP 1 Score: 202.601 bits (514), Expect = 3.021e-60
Identity = 108/294 (36.73%), Postives = 162/294 (55.10%), Query Frame = 1
Query:  130 PFQQGKTKLELKYNYDKELGKGSYGNVLSGFRKKDHFSVAIKVLPTNLIDNWYFSKTLKMNIPMEILLLS-LASNIDGVISMIEYYNDLEQSEWYIVMERFAETIDLFNYICSEGFLTEHLASQIFYELTRIIIECHLRGILHRDIKEENILIDKYTKKIWLIDFGSGGLMNDDNHYSYNGTEEYAPPEWIKYGHYRGCQLESWSLGIVLYSMVCGRIPFEDNNEILSNTIKFPRKISNNCKELILKCIERDPKNRIQPSEILKHPWIIAALDNCDSGRASFDEAFQEASKEIR 1008
            P +  K   E  Y     LG G +G V +G R  D   VA+K +    +  W       + +P+EILLL  ++S+  GVI +++YY       W IVMER     DLF++I  +G L E  A   F ++   +  C+  G++HRDIK+EN+L+D  T ++ LIDFGSG ++ D  +  ++GT  Y+PPEWI++  Y G     WSLG++LY MVCG IPFE + EIL   + F R++S  C+++I  C+   P +R    +I  HPW+  A ++  S         + A+ EIR
Sbjct:   28 PVKVEKEPFERVYQVGSVLGSGGFGTVYAGNRISDGAPVAVKHVAKERVTEW--GSINGVMVPLEILLLKKVSSSFRGVIKLLDYYE--RPDGWLIVMERPDLVKDLFDFITEKGALDEGTARGFFRQVLEAVRHCYSCGVVHRDIKDENLLVDLRTGELKLIDFGSGAILKDTVYTDFDGTRVYSPPEWIRFHRYHGRSATVWSLGVLLYDMVCGDIPFEQDEEILRGKVYFRRRVSPECQQIIKWCLALRPSDRPTLDQICDHPWMRMASESPKSSE-------EPAAGEIR 310          
BLAST of Serine/threonine-protein kinase vs. Ensembl Medaka
Match: ENSORLT00000010626.2 (pep primary_assembly:ASM223467v1:12:12000679:12006348:1 gene:ENSORLG00000008461.2 transcript:ENSORLT00000010626.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 185.267 bits (469), Expect = 1.229e-53
Identity = 102/277 (36.82%), Postives = 154/277 (55.60%), Query Frame = 1
Query:  136 QQGKTKLELK------YNYDKE--LGKGSYGNVLSGFRKKDHFSVAIKVLPTNLIDNWYFSKTLKMNIPMEILLLSLASN---IDGVISMIEYYNDLEQSEWYIVMERFAETIDLFNYICSEGFLTEHLASQIFYELTRIIIECHLRGILHRDIKEENILIDKYTKKIWLIDFGSGGLMNDDNHY-SYNGTEEYAPPEWIKYGHYRGCQLESWSLGIVLYSMVCGRIPFEDNNEILSNTIKFPRKISNNCKELILKCIERDPKNRIQPSEILKHPWI 930
            Q+G+  L LK      + Y +   LGKG +G V  G R+ D  SVA+K +P           T K   P+E++ L + +      G+I M+++Y    +  W IV E    T DLF+YI +   L E  A     ++ + ++ CH RG++H D+K+EN+L+D  T K+ LIDFGS   +  D  Y +++GT  YAPPE +  G Y+    E WSLGI+LY MV G IPF+++ EIL   ++F + +S +C  L+  C+ R P+ R    +IL HPW+
Sbjct:   30 QRGRMALPLKVQSVTVFKYVRLHCLGKGGFGKVFLGKRRSDRISVALKFVPLLRTRCCEVDGTSK---PLEVVALEMVTKDPPFPGIIRMLDFYK--TRGAWVIVTETPENTQDLFHYITTCKRLCEDTARDFLGQVIQALLHCHSRGVVHMDVKDENLLLDPSTHKLLLIDFGSAVFLEPDKVYDTFHGTAVYAPPERLTQGCYKALPSEVWSLGILLYDMVHGDIPFQNDEEILLGELRFKKDLSEDCVALMQWCLSRAPEERPTLKDILAHPWM 301          
BLAST of Serine/threonine-protein kinase vs. Ensembl Medaka
Match: ENSORLT00000032540.1 (serine/threonine-protein kinase pim-2-like [Source:NCBI gene;Acc:101156739])

HSP 1 Score: 184.496 bits (467), Expect = 2.959e-53
Identity = 102/279 (36.56%), Postives = 151/279 (54.12%), Query Frame = 1
Query:  145 KTKLELKYNYDKELGKGSYGNVLSGFRKKDHFSVAIKVLPTNLIDNWYFSKTLKMNIPMEILLLSLASN---IDGVISMIEYYNDLEQSEWYIVMERFAETIDLFNYICSEGFLTEHLASQIFYELTRIIIECHLRGILHRDIKEENILIDKYTKKIWLIDFGSGGLMNDDNHY-SYNGTEEYAPPEWIKYGHYRGCQLESWSLGIVLYSMVCGRIPFEDNNEILSNTIKFPRKISNNCKELILKCIERDPKNRIQPSEILKHPWIIAALDNCDSGRAS 969
            KT  E  +     LGKG +G V  G R+ D  SVA+K +P           T K   P+E++ L + +      G+I M+++Y    +  W IV E    T DLF+YI +   L E  A     ++ + ++ CH RG++H D+K+EN+L+D  T K+ LIDFGS   +  D  Y +++GT  YAPPE +  G Y+    E WSLGI+LY MV G IPF+++ EIL   ++F + +S +C  L+  C+ R P+ R    +IL HPW+         G AS
Sbjct:   15 KTFREKYWMSSHRLGKGGFGKVFLGKRRSDRISVALKFVPLLRTRCCEVDGTSK---PLEVVALEMVTKDPPFPGIIRMLDFYK--TRGAWVIVTETPENTQDLFHYITTCKRLCEDTARDFLGQVIQALLHCHSRGVVHMDVKDENLLLDPSTHKLLLIDFGSAVFLEPDKVYDTFHGTAVYAPPERLTQGCYKALPSEVWSLGILLYDMVHGDIPFQNDEEILLGELRFKKDLSEDCVALMQWCLSRAPEERPTLKDILAHPWMSKQDSEMHQGNAS 288          
BLAST of Serine/threonine-protein kinase vs. Ensembl Medaka
Match: ENSORLT00000041570.1 (pep primary_assembly:ASM223467v1:10:18938984:18940525:-1 gene:ENSORLG00000023590.1 transcript:ENSORLT00000041570.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 177.563 bits (449), Expect = 8.548e-50
Identity = 96/266 (36.09%), Postives = 144/266 (54.14%), Query Frame = 1
Query:  184 LGKGSYGNVLSGFRKKDHFSVAIKVLPTNLIDNWYFSKTLKMNIPMEILLLSLASN---IDGVISMIEYYNDLEQSEWYIVMERFAETIDLFNYICSEGFLTEHLASQIFYELTRIIIECHLRGILHRDIKEENILIDKYTKKIWLIDFGSGGLMNDDNHYS-YNGTEEYAPPEWIKYGHYRGCQLESWSLGIVLYSMVCGRIPFEDNNEILSNTIKFPRKISNNCKELILKCIERDPKNRIQPSEILKHPWIIAALDNCDSGRAS 969
            LGKG +G V  G R+ D  SVA+K++P +         T K   P E + L + S      G+I M+++Y       W IV E+   T DL+ YI     L E  A +   ++ + ++ CH RG++H D+K+EN+L+D  T ++ LIDFGS   +  D  Y  ++GT  Y PPE +  G Y+    E WSLGI+LY MV G IPF ++ E+L   ++F + +S +C  LI  C+ R P+ R    +IL HPW++        G A+
Sbjct:   47 LGKGGFGKVFLGKRRSDGISVALKIIPLSRTRCCEVDGTSK---PFEAVALEMVSKDPPFPGIIRMLDFYKT--PYNWVIVTEKPENTQDLYEYITISKRLREDTAREFLGQVIQALLHCHSRGVVHMDVKDENLLVDLTTLELKLIDFGSAEFLEPDKVYDMFHGTAAYGPPERLTQGCYKALPSEVWSLGILLYDMVHGDIPFGNDRELLLGELRFEKDLSEDCVALIKWCLSRTPEERPMLKDILAHPWMLKRGSEAHEGDAT 307          
BLAST of Serine/threonine-protein kinase vs. Planmine SMEST
Match: SMESG000072329.1 (SMESG000072329.1)

HSP 1 Score: 902.123 bits (2330), Expect = 0.000e+0
Identity = 437/438 (99.77%), Postives = 437/438 (99.77%), Query Frame = 1
Query:   94 MDCDYENYLRKFPFQQGKTKLELKYNYDKELGKGSYGNVLSGFRKKDHFSVAIKVLPTNLIDNWYFSKTLKMNIPMEILLLSLASNIDGVISMIEYYNDLEQSEWYIVMERFAETIDLFNYICSEGFLTEHLASQIFYELTRIIIECHLRGILHRDIKEENILIDKYTKKIWLIDFGSGGLMNDDNHYSYNGTEEYAPPEWIKYGHYRGCQLESWSLGIVLYSMVCGRIPFEDNNEILSNTIKFPRKISNNCKELILKCIERDPKNRIQPSEILKHPWIIAALDNCDSGRASFDEAFQEASKEIRRCSCTCADNFQSFFKDDTNQPEAAIESINYNLDFINKWQLKVFSKSLSPDIKHRRFSLVSSEHLSNKQKTSFFKSISLMDLRSKQSDFDVLSDIQRDEDFGYEADIDDNFQNEYESMIYSTGGLCGILPLSME 1407
            MDCDYENYLRKFPFQQGKTKLELKYNYDKELGKGSYGNVLSGFRKKDHFSVAIKVLPTNLIDNWYFSKTLKMNIPMEILLLSLASNIDGVISMIEYYNDLEQSEWYIVMERFAETIDLFNYICSEGFLTEHLASQIFYELTRIIIECHLRGILHRDIKEENILIDKYTKKIWLIDFGSGGLMNDDNHYSYNGTEEYAPPEWIKYGHYRGCQLESWSLGIVLYSMVCGRIPFEDNNEILSNTIKFPRKISNNCKELILKCIERDPKNRIQPSEILKHPWIIAALDNCDSGRASFDEAFQEASKEIRRCSCTCADNFQSFFKD TNQPEAAIESINYNLDFINKWQLKVFSKSLSPDIKHRRFSLVSSEHLSNKQKTSFFKSISLMDLRSKQSDFDVLSDIQRDEDFGYEADIDDNFQNEYESMIYSTGGLCGILPLSME
Sbjct:    1 MDCDYENYLRKFPFQQGKTKLELKYNYDKELGKGSYGNVLSGFRKKDHFSVAIKVLPTNLIDNWYFSKTLKMNIPMEILLLSLASNIDGVISMIEYYNDLEQSEWYIVMERFAETIDLFNYICSEGFLTEHLASQIFYELTRIIIECHLRGILHRDIKEENILIDKYTKKIWLIDFGSGGLMNDDNHYSYNGTEEYAPPEWIKYGHYRGCQLESWSLGIVLYSMVCGRIPFEDNNEILSNTIKFPRKISNNCKELILKCIERDPKNRIQPSEILKHPWIIAALDNCDSGRASFDEAFQEASKEIRRCSCTCADNFQSFFKDGTNQPEAAIESINYNLDFINKWQLKVFSKSLSPDIKHRRFSLVSSEHLSNKQKTSFFKSISLMDLRSKQSDFDVLSDIQRDEDFGYEADIDDNFQNEYESMIYSTGGLCGILPLSME 438          
BLAST of Serine/threonine-protein kinase vs. Planmine SMEST
Match: SMESG000014593.1 (SMESG000014593.1)

HSP 1 Score: 237.654 bits (605), Expect = 8.761e-73
Identity = 116/266 (43.61%), Postives = 171/266 (64.29%), Query Frame = 1
Query:  139 QGKTKLE-LKYNYD--KELGKGSYGNVLSGFRKKDHFSVAIKVLPTNLIDNWYFSKTLKMNIPMEILLLSLASNIDGVISMIEYYNDLEQSEWYIVMERFAETIDLFNYICSEGFLTEHLASQIFYELTRIIIECHLRGILHRDIKEENILIDKYTKKIWLIDFGSGGLMNDDNHYSYNGTEEYAPPEWIKYGHYRGCQLESWSLGIVLYSMVCGRIPFEDNNEILSNTIKFPRKISNNCKELILKCIERDPKNRIQPSEILKHPW 927
            Q   KLE  +Y Y   + +G+G +G V    R+ D   VAIK +  + I +W+F   +   +P+EI L+     +DGVI + +Y+   E   WYIVM+RF   IDLF++I + G ++E  AS    +L  I+I CH  G+ HRDIK+ENI+ID  T KI+LIDFG+GG+++D  +  ++GT  Y+PPEWI+Y  Y    LE WSLGI+LY MVCG +P+++++ I++  + F R IS+ C++LI  C+ER+P+NR   S ILKH W
Sbjct:   12 QMSEKLEDFQYEYQSLEIIGEGGFGKVRKAIRRSDKKQVAIKFISNSKITSWHFYSKINKQVPLEIALMCRCRKVDGVIKIFKYFYIKEHKGWYIVMDRFENHIDLFDHITNMGQISEKDASNFMNQLITILINCHNLGVCHRDIKDENIIIDLSTNKIYLIDFGAGGILHDGLYSEFDGTRVYSPPEWIQYKRYHAVPLEIWSLGILLYDMVCGNLPYDNDDGIVNCCLAFRRPISHFCQDLIKNCLERNPENRPSLSNILKHRW 277          
BLAST of Serine/threonine-protein kinase vs. Planmine SMEST
Match: SMESG000017137.1 (SMESG000017137.1)

HSP 1 Score: 236.113 bits (601), Expect = 3.620e-72
Identity = 111/276 (40.22%), Postives = 171/276 (61.96%), Query Frame = 1
Query:  103 DYENYLRKFPFQQGKTKLELKYNYDKELGKGSYGNVLSGFRKKDHFSVAIKVLPTNLIDNWYFSKTLKMNIPMEILLLSLASNIDGVISMIEYYNDLEQSEWYIVMERFAETIDLFNYICSEGFLTEHLASQIFYELTRIIIECHLRGILHRDIKEENILIDKYTKKIWLIDFGSGGLMNDDNHYSYNGTEEYAPPEWIKYGHYRGCQLESWSLGIVLYSMVCGRIPFEDNNEILSNTIKFPRKISNNCKELILKCIERDPKNRIQPSEILKHPWI 930
            D E+ L K  F  G+      Y   +E+G+G +G V  G R  D   V IK +    I + Y  K   + IP+E+ LL+    + GVI M+ +Y    +  WY++M R A+ +DLF+YI    +L+E  A+  F ++  I+ +CH + +LHRDIK+ENIL+D+ T  ++LIDFGSG  +  D++ +++GT  Y+PPEWIK   Y G +LE WSLG++L+ MVCG IPF  +++IL+  +K+   +S +C++LI KC++ DP  RI  +EI  HPW+
Sbjct:    7 DVEDDLNKIEFFNGEEFFRSHYQCHEEIGQGGFGTVFKGTRLSDRLEVIIKFISNKKITDTYKWKAKNLAIPLEVALLAKCRPVKGVIDMLAFYKSDGKKGWYLIMNRIAKFVDLFDYISRAKYLSEEKAAFFFRQIIEILKQCHQQKVLHRDIKDENILVDENTDFVYLIDFGSGAFLKTDDYRNFDGTRVYSPPEWIKNHCYNGFKLEVWSLGVLLFDMVCGDIPFNTDDQILNGKLKYRHCVSADCRDLIEKCLKHDPSYRINLNEISNHPWV 282          
BLAST of Serine/threonine-protein kinase vs. Planmine SMEST
Match: SMESG000017137.1 (SMESG000017137.1)

HSP 1 Score: 236.113 bits (601), Expect = 3.831e-72
Identity = 111/276 (40.22%), Postives = 171/276 (61.96%), Query Frame = 1
Query:  103 DYENYLRKFPFQQGKTKLELKYNYDKELGKGSYGNVLSGFRKKDHFSVAIKVLPTNLIDNWYFSKTLKMNIPMEILLLSLASNIDGVISMIEYYNDLEQSEWYIVMERFAETIDLFNYICSEGFLTEHLASQIFYELTRIIIECHLRGILHRDIKEENILIDKYTKKIWLIDFGSGGLMNDDNHYSYNGTEEYAPPEWIKYGHYRGCQLESWSLGIVLYSMVCGRIPFEDNNEILSNTIKFPRKISNNCKELILKCIERDPKNRIQPSEILKHPWI 930
            D E+ L K  F  G+      Y   +E+G+G +G V  G R  D   V IK +    I + Y  K   + IP+E+ LL+    + GVI M+ +Y    +  WY++M R A+ +DLF+YI    +L+E  A+  F ++  I+ +CH + +LHRDIK+ENIL+D+ T  ++LIDFGSG  +  D++ +++GT  Y+PPEWIK   Y G +LE WSLG++L+ MVCG IPF  +++IL+  +K+   +S +C++LI KC++ DP  RI  +EI  HPW+
Sbjct:   11 DVEDDLNKIEFFNGEEFFRSHYQCHEEIGQGGFGTVFKGTRLSDRLEVIIKFISNKKITDTYKWKAKNLAIPLEVALLAKCRPVKGVIDMLAFYKSDGKKGWYLIMNRIAKFVDLFDYISRAKYLSEEKAAFFFRQIIEILKQCHQQKVLHRDIKDENILVDENTDFVYLIDFGSGAFLKTDDYRNFDGTRVYSPPEWIKNHCYNGFKLEVWSLGVLLFDMVCGDIPFNTDDQILNGKLKYRHCVSADCRDLIEKCLKHDPSYRINLNEISNHPWV 286          
BLAST of Serine/threonine-protein kinase vs. Planmine SMEST
Match: SMESG000027798.1 (SMESG000027798.1)

HSP 1 Score: 192.586 bits (488), Expect = 4.228e-57
Identity = 110/275 (40.00%), Postives = 160/275 (58.18%), Query Frame = 1
Query:  103 DYENYLRKFPFQQGKTKLELKYNYDKELGKGSYGNVLSGFRKKDHFSVAIKVLPTNLIDNWYFSKTLKMNIPMEILLLSLASNIDGVISMIEYYNDLEQSEWYIVMERFAETIDLFNYI--CSEGFLTEHLASQIFYELTRIIIECHLRGILHRDIKEENILIDKYTKKIWLIDFGSGGLMNDDNHYSYNGTEEYAPPEWIKYGHYRGCQLESWSLGIVLYSMVCGRIPFEDNNEILSNTIKFPRKISNNCKELILKCIERDPKNRIQPSEILKH 921
            ++  + +K   +     ++ KY    ++G+G +G V    +  +  SVA+K +  + I  +   +  +  IPME +LL+    I GVI ++E     E   W IVMER    IDLF+YI  CS+  ++E  A  I  +L   +I CH  G+ HRDIK+ENILID  TK+I LIDFGSG   +D  ++ +NGT  Y+PPEWIK  HY   +LESWS+G +LY+M+ G  PF++ NEIL   I      S  C++LIL C+ RD +NR+   +IL H
Sbjct:    2 NHSKFSKKLVVKSTVKYIQNKYAIYGKIGEGGFGKVFKSTKISNGKSVALKFVAKDKISEYCLHEETQQKIPMEAVLLAECQGIPGVIKLLEIVELEEFQVWCIVMERNPNFIDLFDYINRCSQ--ISEETAVFILTQLIHTLIGCHKAGVAHRDIKDENILIDVDTKEIKLIDFGSGHYYHDGEYFDFNGTSIYSPPEWIKDKHYFVKELESWSIGALLYNMITGDGPFKNENEILLAPISIDSA-SAECRDLILSCLCRDRENRMDLDKILCH 273          
The following BLAST results are available for this feature:
BLAST of Serine/threonine-protein kinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PIM11.211e-6138.03Pim-1 proto-oncogene, serine/threonine kinase [Sou... [more]
PIM22.917e-6039.62Pim-2 proto-oncogene, serine/threonine kinase [Sou... [more]
PIM31.138e-5636.63Pim-3 proto-oncogene, serine/threonine kinase [Sou... [more]
PIM22.020e-3846.85Pim-2 proto-oncogene, serine/threonine kinase [Sou... [more]
SIK11.076e-3231.02salt inducible kinase 1 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of Serine/threonine-protein kinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prk-23.588e-4934.70Serine/threonine-protein kinase prk-2 [Source:Uni... [more]
prk-23.588e-4934.70Serine/threonine-protein kinase prk-2 [Source:Uni... [more]
prk-11.163e-4129.93Pim (Mammalian oncogene) Related Kinase [Source:U... [more]
prk-12.084e-4029.93Pim (Mammalian oncogene) Related Kinase [Source:U... [more]
prk-13.080e-4029.93Pim (Mammalian oncogene) Related Kinase [Source:U... [more]
back to top
BLAST of Serine/threonine-protein kinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pask6.310e-3433.33gene:FBgn0034950 transcript:FBtr0072160[more]
Sik31.473e-2930.48gene:FBgn0262103 transcript:FBtr0304024[more]
Sik33.549e-2930.48gene:FBgn0262103 transcript:FBtr0344258[more]
KP78a3.863e-2929.66gene:FBgn0026064 transcript:FBtr0301426[more]
Sik34.097e-2930.48gene:FBgn0262103 transcript:FBtr0344259[more]
back to top
BLAST of Serine/threonine-protein kinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pim12.215e-6140.38Pim-1 proto-oncogene, serine/threonine kinase [Sou... [more]
pim23.370e-6138.79Pim-2 proto-oncogene, serine/threonine kinase [Sou... [more]
pim36.499e-5539.05Pim-3 proto-oncogene, serine/threonine kinase [Sou... [more]
pimr547.202e-4932.95Pim proto-oncogene, serine/threonine kinase, relat... [more]
pimr492.468e-4832.56Pim proto-oncogene, serine/threonine kinase, relat... [more]
back to top
BLAST of Serine/threonine-protein kinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ncbp15.137e-6039.04nuclear cap binding protein subunit 1 [Source:Xenb... [more]
ncbp17.253e-6039.04nuclear cap binding protein subunit 1 [Source:Xenb... [more]
PIM31.253e-5837.37Pim-3 proto-oncogene, serine/threonine kinase [Sou... [more]
PASK2.436e-3333.80PAS domain containing serine/threonine kinase [Sou... [more]
PASK6.522e-3331.29PAS domain containing serine/threonine kinase [Sou... [more]
back to top
BLAST of Serine/threonine-protein kinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pim15.931e-6238.38proviral integration site 1 [Source:MGI Symbol;Acc... [more]
Pim27.328e-6038.52proviral integration site 2 [Source:MGI Symbol;Acc... [more]
Pim28.325e-6038.52proviral integration site 2 [Source:MGI Symbol;Acc... [more]
Pim31.269e-5535.82proviral integration site 3 [Source:MGI Symbol;Acc... [more]
Pim12.025e-3435.41proviral integration site 1 [Source:MGI Symbol;Acc... [more]
back to top
BLAST of Serine/threonine-protein kinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P06803|PIM1_MOUSE4.149e-6138.38Serine/threonine-protein kinase pim-1 OS=Mus muscu... [more]
sp|Q95LJ0|PIM1_FELCA5.345e-6138.03Serine/threonine-protein kinase pim-1 OS=Felis cat... [more]
sp|P26794|PIM1_RAT5.517e-6139.92Serine/threonine-protein kinase pim-1 OS=Rattus no... [more]
sp|P11309|PIM1_HUMAN5.816e-6138.03Serine/threonine-protein kinase pim-1 OS=Homo sapi... [more]
sp|Q9N0P9|PIM1_BOVIN8.967e-6139.92Serine/threonine-protein kinase pim-1 OS=Bos tauru... [more]
back to top
BLAST of Serine/threonine-protein kinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
T1DBL31.935e-7233.87Pim-1 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
I1ZIJ11.208e-6943.61Pim-3 (Fragment) OS=Schmidtea mediterranea OX=7932... [more]
A0A0K2TXV81.245e-6439.86Protein kinase domain-containing protein OS=Lepeop... [more]
A0A067RFR19.240e-6440.51Serine/threonine-protein kinase Pim-3 OS=Zootermop... [more]
A0A087UNB81.752e-6341.67Serine/threonine-protein kinase pim-3 (Fragment) O... [more]
back to top
BLAST of Serine/threonine-protein kinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pim11.095e-6440.00serine/threonine-protein kinase pim-1-like [Source... [more]
PIM32.512e-5937.23Pim-3 proto-oncogene, serine/threonine kinase [Sou... [more]
PIM36.079e-5937.27Pim-3 proto-oncogene, serine/threonine kinase [Sou... [more]
pim32.994e-5838.46serine/threonine-protein kinase pim-3-like [Source... [more]
pim28.750e-5435.84Pim-2 proto-oncogene, serine/threonine kinase [Sou... [more]
back to top
BLAST of Serine/threonine-protein kinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
snrka7.233e-3029.66SNF related kinase a [Source:ZFIN;Acc:ZDB-GENE-040... [more]
aurka9.386e-2727.76aurora kinase A [Source:ZFIN;Acc:ZDB-GENE-040801-1... [more]
MARK39.273e-2526.30microtubule affinity regulating kinase 3 [Source:H... [more]
MARK39.179e-2427.86microtubule affinity regulating kinase 3 [Source:H... [more]
ENSPMAT00000006410.16.046e-2326.62pep scaffold:Pmarinus_7.0:GL476370:17405:31068:-1 ... [more]
back to top
BLAST of Serine/threonine-protein kinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
HSL14.537e-3230.80Nim1p-related protein kinase; septin-binding kinas... [more]
PSK26.171e-2929.57PAS-domain containing serine/threonine protein kin... [more]
KCC41.939e-2830.30Protein kinase of the bud neck involved in the sep... [more]
GIN44.946e-2831.37Protein kinase involved in bud growth and assembly... [more]
SNF13.978e-2729.39AMP-activated S/T protein kinase; forms a complex ... [more]
back to top
BLAST of Serine/threonine-protein kinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO468616.862e-4633.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO336251.994e-3432.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO479612.287e-3131.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO460913.989e-2931.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO379514.144e-2930.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Serine/threonine-protein kinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pim11.395e-6039.92serine/threonine-protein kinase pim-1 [Source:NCBI... [more]
pim33.021e-6036.73Pim-3 proto-oncogene, serine/threonine kinase [Sou... [more]
ENSORLT00000010626.21.229e-5336.82pep primary_assembly:ASM223467v1:12:12000679:12006... [more]
ENSORLT00000032540.12.959e-5336.56serine/threonine-protein kinase pim-2-like [Source... [more]
ENSORLT00000041570.18.548e-5036.09pep primary_assembly:ASM223467v1:10:18938984:18940... [more]
back to top
BLAST of Serine/threonine-protein kinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000072329.10.000e+099.77SMESG000072329.1[more]
SMESG000014593.18.761e-7343.61SMESG000014593.1[more]
SMESG000017137.13.620e-7240.22SMESG000017137.1[more]
SMESG000017137.13.831e-7240.22SMESG000017137.1[more]
SMESG000027798.14.228e-5740.00SMESG000027798.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011797 ID=SMED30011797|Name=Serine/threonine-protein kinase|organism=Schmidtea mediterranea sexual|type=transcript|length=1602bp
GCACAATTGTAGCAACTGATGTAAACGGGGTTTTATTTCATTTTAGTGTA
TTTTCTCAATTCTCAATGACAATGTTATTAACATTTTTTTGTAATGGATT
GTGATTATGAAAATTATTTGAGAAAATTCCCATTTCAGCAAGGAAAAACG
AAATTGGAACTAAAATATAACTATGACAAAGAACTCGGAAAAGGATCATA
TGGTAATGTGCTAAGTGGATTCAGAAAAAAAGATCATTTTTCAGTTGCTA
TAAAAGTTTTACCCACAAACCTTATAGATAATTGGTACTTCAGTAAGACC
TTAAAAATGAATATTCCCATGGAAATATTACTTTTGTCTCTAGCATCAAA
CATTGATGGTGTCATTTCAATGATCGAGTATTACAATGATTTAGAACAGT
CCGAATGGTATATTGTAATGGAAAGATTTGCTGAAACCATTGATCTATTC
AATTATATCTGTTCGGAAGGATTCCTTACAGAACATTTAGCTAGTCAAAT
ATTCTATGAATTAACTCGAATAATAATAGAATGCCATTTACGAGGTATCC
TTCATCGAGATATTAAAGAAGAAAATATTCTAATTGACAAATACACCAAA
AAAATATGGCTTATTGACTTTGGATCTGGAGGTTTGATGAATGATGATAA
TCATTATTCATACAACGGAACTGAAGAATATGCCCCTCCAGAATGGATAA
AATATGGCCATTATCGAGGCTGTCAACTGGAATCGTGGAGTCTTGGAATT
GTTCTTTACTCGATGGTTTGTGGTAGAATTCCCTTTGAGGACAATAACGA
AATTCTTTCAAATACAATTAAATTTCCGAGAAAAATCTCCAATAATTGCA
AAGAACTGATTTTGAAATGCATTGAACGTGATCCTAAAAATAGAATTCAA
CCCAGCGAAATCTTGAAACATCCCTGGATTATAGCAGCACTTGATAATTG
TGACAGTGGTCGTGCTTCTTTTGATGAAGCGTTTCAGGAAGCTTCGAAAG
AAATTCGCAGATGTTCTTGCACATGTGCTGATAATTTTCAGTCATTTTTC
AAGGACGACACTAATCAACCGGAAGCTGCTATTGAATCTATTAACTACAA
TTTAGATTTCATTAATAAATGGCAATTGAAAGTTTTCTCAAAATCTCTTT
CACCAGATATTAAACACCGAAGATTTTCACTAGTTTCATCGGAACATCTA
TCAAACAAACAAAAAACTTCATTTTTTAAATCTATTTCGTTAATGGATTT
GCGCTCAAAACAATCAGATTTCGATGTATTATCCGACATTCAAAGAGATG
AAGATTTCGGATATGAAGCGGACATAGATGATAATTTTCAAAACGAATAC
GAATCTATGATTTATTCAACTGGTGGTTTGTGTGGAATATTGCCACTGTC
CATGGAATGATGGCACCGATTTCAGATAGTTTCTATTTCATCGCATTTAA
CAAACGTTCATTGTCAAGATGACAACTGCTTTTTTCATTTTTTTCATTTT
TTTTTGAAATGATTATTCTATTATTTGAGTTTCATTTTTATTAAGTACAA
ACCTGTTTCATGATTTTTATAGATGAAATATAAACGCATATTTGCAAAAA
AA
back to top

protein sequence of SMED30011797-orf-1

>SMED30011797-orf-1 ID=SMED30011797-orf-1|Name=SMED30011797-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=439bp
MDCDYENYLRKFPFQQGKTKLELKYNYDKELGKGSYGNVLSGFRKKDHFS
VAIKVLPTNLIDNWYFSKTLKMNIPMEILLLSLASNIDGVISMIEYYNDL
EQSEWYIVMERFAETIDLFNYICSEGFLTEHLASQIFYELTRIIIECHLR
GILHRDIKEENILIDKYTKKIWLIDFGSGGLMNDDNHYSYNGTEEYAPPE
WIKYGHYRGCQLESWSLGIVLYSMVCGRIPFEDNNEILSNTIKFPRKISN
NCKELILKCIERDPKNRIQPSEILKHPWIIAALDNCDSGRASFDEAFQEA
SKEIRRCSCTCADNFQSFFKDDTNQPEAAIESINYNLDFINKWQLKVFSK
SLSPDIKHRRFSLVSSEHLSNKQKTSFFKSISLMDLRSKQSDFDVLSDIQ
RDEDFGYEADIDDNFQNEYESMIYSTGGLCGILPLSME*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
Vocabulary: molecular function
TermDefinition
GO:0016740transferase activity
GO:0005524ATP binding
GO:0004672protein kinase activity
GO:0000166nucleotide binding
GO:0004674protein serine/threonine kinase activity
GO:0016301kinase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002075pigment cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000719Prot_kinase_dom
IPR017441Protein_kinase_ATP_BS
IPR008271Ser/Thr_kinase_AS
IPR011009Kinase-like_dom_sf
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0016310phosphorylation
GO:0043066negative regulation of apoptotic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 25..279
e-value: 3.0E-57
score: 206.2
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 25..279
e-value: 1.6E-51
score: 175.2
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 25..279
score: 37.573
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 115..295
e-value: 6.3E-48
score: 164.6
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 10..112
e-value: 1.0E-19
score: 72.7
NoneNo IPR availablePANTHERPTHR22984:SF22SERINE/THREONINE-PROTEIN KINASE PRK-2coord: 16..286
NoneNo IPR availablePANTHERPTHR22984SERINE/THREONINE PROTEIN KINASEcoord: 16..286
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 152..164
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 31..54
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 24..281