Homeobox protein DTH-1

Overview
NameHomeobox protein DTH-1
Smed IDSMED30011793
Length (bp)1926
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Homeobox protein DTH-1 (SMED30011793) t-SNE clustered cells

Violin plots show distribution of expression levels for Homeobox protein DTH-1 (SMED30011793) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Homeobox protein DTH-1 (SMED30011793) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Homeobox protein DTH-1 (SMED30011793) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011793

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30011793h1SMcG0009317 Contig5669GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30011793h1SMcG0009317 Contig5669GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30011793h1SMcG0021644 Contig5669GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30011793h1SMcG0021644 Contig5669GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30011793h1SMcG0009317 dd_Smed_v4_2716_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30011793h1SMcG0009317 dd_Smed_v4_2716_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30011793h1SMcG0009317 dd_Smed_v4_2716_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
tail regionSMED30011793h1SMcG0009317 dd_Smed_v6_2716_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Homeobox protein DTH-1 vs. Ensembl Human
Match: NKX2-2 (NK2 homeobox 2 [Source:HGNC Symbol;Acc:HGNC:7835])

HSP 1 Score: 125.561 bits (314), Expect = 1.155e-31
Identity = 58/80 (72.50%), Postives = 66/80 (82.50%), Query Frame = 3
Query: 1293 VGKKRKRRVLFSKKQILELERHFRQKKYLSAPEREHLANLIGLSPTQVKIWFQNHRYKMKRAHHEKSLEMGNLAVNRRIS 1532
             GKKRKRRVLFSK Q  ELER FRQ++YLSAPEREHLA+LI L+PTQVKIWFQNHRYKMKRA  EK +E+  L   RR++
Sbjct:  125 AGKKRKRRVLFSKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKRARAEKGMEVTPLPSPRRVA 204          
BLAST of Homeobox protein DTH-1 vs. Ensembl Human
Match: NKX2-8 (NK2 homeobox 8 [Source:HGNC Symbol;Acc:HGNC:16364])

HSP 1 Score: 110.153 bits (274), Expect = 1.645e-26
Identity = 50/77 (64.94%), Postives = 62/77 (80.52%), Query Frame = 3
Query: 1299 KKRKRRVLFSKKQILELERHFRQKKYLSAPEREHLANLIGLSPTQVKIWFQNHRYKMKRAHHEKSLEMGNLAVNRRI 1529
            K++KRRVLFSK Q LELER FRQ++YLSAPERE LA+L+ L+PTQVKIWFQNHRYK+KRA    + E  +LA +  +
Sbjct:   83 KRKKRRVLFSKAQTLELERRFRQQRYLSAPEREQLASLLRLTPTQVKIWFQNHRYKLKRARAPGAAESPDLAASAEL 159          
BLAST of Homeobox protein DTH-1 vs. Ensembl Human
Match: NKX2-4 (NK2 homeobox 4 [Source:HGNC Symbol;Acc:HGNC:7837])

HSP 1 Score: 107.842 bits (268), Expect = 8.590e-25
Identity = 47/66 (71.21%), Postives = 58/66 (87.88%), Query Frame = 3
Query: 1302 KRKRRVLFSKKQILELERHFRQKKYLSAPEREHLANLIGLSPTQVKIWFQNHRYKMKRAHHEKSLE 1499
            +RKRRVLFS+ Q+ ELER F+Q+KYLSAPEREHLA++I L+PTQVKIWFQNHRYKMKR   +K+ +
Sbjct:  189 RRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQAKDKAAQ 254          
BLAST of Homeobox protein DTH-1 vs. Ensembl Human
Match: NKX2-1 (NK2 homeobox 1 [Source:HGNC Symbol;Acc:HGNC:11825])

HSP 1 Score: 107.842 bits (268), Expect = 9.644e-25
Identity = 47/64 (73.44%), Postives = 57/64 (89.06%), Query Frame = 3
Query: 1302 KRKRRVLFSKKQILELERHFRQKKYLSAPEREHLANLIGLSPTQVKIWFQNHRYKMKRAHHEKS 1493
            +RKRRVLFS+ Q+ ELER F+Q+KYLSAPEREHLA++I L+PTQVKIWFQNHRYKMKR   +K+
Sbjct:  161 RRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQAKDKA 224          
BLAST of Homeobox protein DTH-1 vs. Ensembl Human
Match: NKX2-1 (NK2 homeobox 1 [Source:HGNC Symbol;Acc:HGNC:11825])

HSP 1 Score: 107.842 bits (268), Expect = 9.644e-25
Identity = 47/64 (73.44%), Postives = 57/64 (89.06%), Query Frame = 3
Query: 1302 KRKRRVLFSKKQILELERHFRQKKYLSAPEREHLANLIGLSPTQVKIWFQNHRYKMKRAHHEKS 1493
            +RKRRVLFS+ Q+ ELER F+Q+KYLSAPEREHLA++I L+PTQVKIWFQNHRYKMKR   +K+
Sbjct:  161 RRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQAKDKA 224          
BLAST of Homeobox protein DTH-1 vs. Ensembl Celegans
Match: ceh-24 (Homeobox protein ceh-24 [Source:UniProtKB/Swiss-Prot;Acc:Q9NLC2])

HSP 1 Score: 103.219 bits (256), Expect = 4.667e-24
Identity = 46/68 (67.65%), Postives = 56/68 (82.35%), Query Frame = 3
Query: 1293 VGKKRKRRVLFSKKQILELERHFRQKKYLSAPEREHLANLIGLSPTQVKIWFQNHRYKMKRAHHEKSL 1496
            + ++RKRRVLFS+ Q+ ELER F+Q KYL+APERE LAN I L+PTQVKIWFQNHRYK KR   EK++
Sbjct:  147 MSQRRKRRVLFSQAQVYELERRFKQAKYLTAPEREQLANSIRLTPTQVKIWFQNHRYKCKRQEKEKAM 214          
BLAST of Homeobox protein DTH-1 vs. Ensembl Celegans
Match: ceh-22 (Homeobox protein ceh-22 [Source:UniProtKB/Swiss-Prot;Acc:P41936])

HSP 1 Score: 92.4337 bits (228), Expect = 4.583e-21
Identity = 42/67 (62.69%), Postives = 49/67 (73.13%), Query Frame = 3
Query: 1317 VLFSKKQILELERHFRQKKYLSAPEREHLANLIGLSPTQVKIWFQNHRYKMKRAHHEKSLEMGNLAV 1517
            VLF+K Q  ELER FR +KYLSAPERE LA  I L+PTQVKIWFQNHRYK K++H +K +    L  
Sbjct:   63 VLFTKAQTYELERRFRSQKYLSAPEREALAMQIRLTPTQVKIWFQNHRYKTKKSHTDKPINAALLTT 129          
BLAST of Homeobox protein DTH-1 vs. Ensembl Celegans
Match: ceh-22 (Homeobox protein ceh-22 [Source:UniProtKB/Swiss-Prot;Acc:P41936])

HSP 1 Score: 93.2041 bits (230), Expect = 6.961e-21
Identity = 42/67 (62.69%), Postives = 49/67 (73.13%), Query Frame = 3
Query: 1317 VLFSKKQILELERHFRQKKYLSAPEREHLANLIGLSPTQVKIWFQNHRYKMKRAHHEKSLEMGNLAV 1517
            VLF+K Q  ELER FR +KYLSAPERE LA  I L+PTQVKIWFQNHRYK K++H +K +    L  
Sbjct:  108 VLFTKAQTYELERRFRSQKYLSAPEREALAMQIRLTPTQVKIWFQNHRYKTKKSHTDKPINAALLTT 174          
BLAST of Homeobox protein DTH-1 vs. Ensembl Celegans
Match: ceh-22 (Homeobox protein ceh-22 [Source:UniProtKB/Swiss-Prot;Acc:P41936])

HSP 1 Score: 92.8189 bits (229), Expect = 1.105e-20
Identity = 42/67 (62.69%), Postives = 49/67 (73.13%), Query Frame = 3
Query: 1317 VLFSKKQILELERHFRQKKYLSAPEREHLANLIGLSPTQVKIWFQNHRYKMKRAHHEKSLEMGNLAV 1517
            VLF+K Q  ELER FR +KYLSAPERE LA  I L+PTQVKIWFQNHRYK K++H +K +    L  
Sbjct:  131 VLFTKAQTYELERRFRSQKYLSAPEREALAMQIRLTPTQVKIWFQNHRYKTKKSHTDKPINAALLTT 197          
BLAST of Homeobox protein DTH-1 vs. Ensembl Celegans
Match: ceh-22 (Homeobox protein ceh-22 [Source:UniProtKB/Swiss-Prot;Acc:P41936])

HSP 1 Score: 92.8189 bits (229), Expect = 3.099e-20
Identity = 42/67 (62.69%), Postives = 49/67 (73.13%), Query Frame = 3
Query: 1317 VLFSKKQILELERHFRQKKYLSAPEREHLANLIGLSPTQVKIWFQNHRYKMKRAHHEKSLEMGNLAV 1517
            VLF+K Q  ELER FR +KYLSAPERE LA  I L+PTQVKIWFQNHRYK K++H +K +    L  
Sbjct:  194 VLFTKAQTYELERRFRSQKYLSAPEREALAMQIRLTPTQVKIWFQNHRYKTKKSHTDKPINAALLTT 260          
BLAST of Homeobox protein DTH-1 vs. Ensembl Fly
Match: scro (gene:FBgn0028993 transcript:FBtr0339923)

HSP 1 Score: 110.153 bits (274), Expect = 2.571e-26
Identity = 46/68 (67.65%), Postives = 59/68 (86.76%), Query Frame = 3
Query: 1293 VGKKRKRRVLFSKKQILELERHFRQKKYLSAPEREHLANLIGLSPTQVKIWFQNHRYKMKRAHHEKSL 1496
            + ++RKRRVLF++ Q+ ELER F+Q++YLSAPEREHLA+LI L+PTQVKIWFQNHRYK KR   EK++
Sbjct:   89 LAQRRKRRVLFTQAQVYELERRFKQQRYLSAPEREHLASLIHLTPTQVKIWFQNHRYKCKRQAKEKAM 156          
BLAST of Homeobox protein DTH-1 vs. Ensembl Fly
Match: vnd (gene:FBgn0261930 transcript:FBtr0110929)

HSP 1 Score: 113.62 bits (283), Expect = 4.437e-26
Identity = 52/67 (77.61%), Postives = 58/67 (86.57%), Query Frame = 3
Query: 1299 KKRKRRVLFSKKQILELERHFRQKKYLSAPEREHLANLIGLSPTQVKIWFQNHRYKMKRAHHEKSLE 1499
            KKRKRRVLF+K Q  ELER FRQ++YLSAPEREHLA+LI L+PTQVKIWFQNHRYK KRA +EK  E
Sbjct:  398 KKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYE 464          
BLAST of Homeobox protein DTH-1 vs. Ensembl Fly
Match: vnd (gene:FBgn0261930 transcript:FBtr0070110)

HSP 1 Score: 113.62 bits (283), Expect = 6.839e-26
Identity = 52/67 (77.61%), Postives = 58/67 (86.57%), Query Frame = 3
Query: 1299 KKRKRRVLFSKKQILELERHFRQKKYLSAPEREHLANLIGLSPTQVKIWFQNHRYKMKRAHHEKSLE 1499
            KKRKRRVLF+K Q  ELER FRQ++YLSAPEREHLA+LI L+PTQVKIWFQNHRYK KRA +EK  E
Sbjct:  544 KKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYE 610          
BLAST of Homeobox protein DTH-1 vs. Ensembl Fly
Match: scro (gene:FBgn0028993 transcript:FBtr0113751)

HSP 1 Score: 110.538 bits (275), Expect = 2.061e-25
Identity = 46/68 (67.65%), Postives = 59/68 (86.76%), Query Frame = 3
Query: 1293 VGKKRKRRVLFSKKQILELERHFRQKKYLSAPEREHLANLIGLSPTQVKIWFQNHRYKMKRAHHEKSL 1496
            + ++RKRRVLF++ Q+ ELER F+Q++YLSAPEREHLA+LI L+PTQVKIWFQNHRYK KR   EK++
Sbjct:  250 LAQRRKRRVLFTQAQVYELERRFKQQRYLSAPEREHLASLIHLTPTQVKIWFQNHRYKCKRQAKEKAM 317          
BLAST of Homeobox protein DTH-1 vs. Ensembl Fly
Match: tin (gene:FBgn0004110 transcript:FBtr0084086)

HSP 1 Score: 82.0333 bits (201), Expect = 3.091e-16
Identity = 39/59 (66.10%), Postives = 44/59 (74.58%), Query Frame = 3
Query: 1302 KRKRRVLFSKKQILELERHFRQKKYLSAPEREHLANLIGLSPTQVKIWFQNHRYKMKRA 1478
            KRK RVLFS+ Q+LELE  FR KKYL+  ERE +A  + LS TQVKIWFQN RYK KR 
Sbjct:  301 KRKPRVLFSQAQVLELECRFRLKKYLTGAEREIIAQKLNLSATQVKIWFQNRRYKSKRG 359          
BLAST of Homeobox protein DTH-1 vs. Ensembl Zebrafish
Match: nkx2.2a (NK2 homeobox 2a [Source:NCBI gene;Acc:30697])

HSP 1 Score: 127.872 bits (320), Expect = 1.298e-32
Identity = 58/79 (73.42%), Postives = 67/79 (84.81%), Query Frame = 3
Query: 1296 GKKRKRRVLFSKKQILELERHFRQKKYLSAPEREHLANLIGLSPTQVKIWFQNHRYKMKRAHHEKSLEMGNLAVNRRIS 1532
            GKKRKRRVLFSK Q  ELER FRQ++YLSAPEREHLA+LI L+PTQVKIWFQNHRYKMKRA  EK +E+ +L   RR++
Sbjct:  123 GKKRKRRVLFSKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKRARAEKGMEVTHLPSPRRVA 201          
BLAST of Homeobox protein DTH-1 vs. Ensembl Zebrafish
Match: nkx2.2a (NK2 homeobox 2a [Source:NCBI gene;Acc:30697])

HSP 1 Score: 127.872 bits (320), Expect = 1.298e-32
Identity = 58/79 (73.42%), Postives = 67/79 (84.81%), Query Frame = 3
Query: 1296 GKKRKRRVLFSKKQILELERHFRQKKYLSAPEREHLANLIGLSPTQVKIWFQNHRYKMKRAHHEKSLEMGNLAVNRRIS 1532
            GKKRKRRVLFSK Q  ELER FRQ++YLSAPEREHLA+LI L+PTQVKIWFQNHRYKMKRA  EK +E+ +L   RR++
Sbjct:  123 GKKRKRRVLFSKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKRARAEKGMEVTHLPSPRRVA 201          
BLAST of Homeobox protein DTH-1 vs. Ensembl Zebrafish
Match: nkx2.2a (NK2 homeobox 2a [Source:NCBI gene;Acc:30697])

HSP 1 Score: 127.487 bits (319), Expect = 1.574e-32
Identity = 58/79 (73.42%), Postives = 67/79 (84.81%), Query Frame = 3
Query: 1296 GKKRKRRVLFSKKQILELERHFRQKKYLSAPEREHLANLIGLSPTQVKIWFQNHRYKMKRAHHEKSLEMGNLAVNRRIS 1532
            GKKRKRRVLFSK Q  ELER FRQ++YLSAPEREHLA+LI L+PTQVKIWFQNHRYKMKRA  EK +E+ +L   RR++
Sbjct:  127 GKKRKRRVLFSKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKRARAEKGMEVTHLPSPRRVA 205          
BLAST of Homeobox protein DTH-1 vs. Ensembl Zebrafish
Match: nkx2.2a (NK2 homeobox 2a [Source:NCBI gene;Acc:30697])

HSP 1 Score: 127.487 bits (319), Expect = 1.574e-32
Identity = 58/79 (73.42%), Postives = 67/79 (84.81%), Query Frame = 3
Query: 1296 GKKRKRRVLFSKKQILELERHFRQKKYLSAPEREHLANLIGLSPTQVKIWFQNHRYKMKRAHHEKSLEMGNLAVNRRIS 1532
            GKKRKRRVLFSK Q  ELER FRQ++YLSAPEREHLA+LI L+PTQVKIWFQNHRYKMKRA  EK +E+ +L   RR++
Sbjct:  127 GKKRKRRVLFSKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKRARAEKGMEVTHLPSPRRVA 205          
BLAST of Homeobox protein DTH-1 vs. Ensembl Zebrafish
Match: nkx2.2a (NK2 homeobox 2a [Source:NCBI gene;Acc:30697])

HSP 1 Score: 127.487 bits (319), Expect = 1.574e-32
Identity = 58/79 (73.42%), Postives = 67/79 (84.81%), Query Frame = 3
Query: 1296 GKKRKRRVLFSKKQILELERHFRQKKYLSAPEREHLANLIGLSPTQVKIWFQNHRYKMKRAHHEKSLEMGNLAVNRRIS 1532
            GKKRKRRVLFSK Q  ELER FRQ++YLSAPEREHLA+LI L+PTQVKIWFQNHRYKMKRA  EK +E+ +L   RR++
Sbjct:  127 GKKRKRRVLFSKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKRARAEKGMEVTHLPSPRRVA 205          
BLAST of Homeobox protein DTH-1 vs. Ensembl Xenopus
Match: NKX2-2 (NK2 homeobox 2 [Source:NCBI gene;Acc:100038077])

HSP 1 Score: 126.716 bits (317), Expect = 3.955e-32
Identity = 58/79 (73.42%), Postives = 66/79 (83.54%), Query Frame = 3
Query: 1296 GKKRKRRVLFSKKQILELERHFRQKKYLSAPEREHLANLIGLSPTQVKIWFQNHRYKMKRAHHEKSLEMGNLAVNRRIS 1532
            GKKRKRRVLFSK Q  ELER FRQ++YLSAPEREHLA+LI L+PTQVKIWFQNHRYKMKRA  EK +E+  L   RR++
Sbjct:  125 GKKRKRRVLFSKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKRARAEKGMEVTPLPSPRRVA 203          
BLAST of Homeobox protein DTH-1 vs. Ensembl Xenopus
Match: fam221a (family with sequence similarity 221 member A [Source:Xenbase;Acc:XB-GENE-1000335])

HSP 1 Score: 109.768 bits (273), Expect = 1.768e-25
Identity = 47/66 (71.21%), Postives = 58/66 (87.88%), Query Frame = 3
Query: 1302 KRKRRVLFSKKQILELERHFRQKKYLSAPEREHLANLIGLSPTQVKIWFQNHRYKMKRAHHEKSLE 1499
            +RKRRVLFS+ Q+ ELER F+Q+KYLSAPEREHLA++I L+PTQVKIWFQNHRYKMKR   +K+ +
Sbjct:  162 RRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQAKDKAAQ 227          
BLAST of Homeobox protein DTH-1 vs. Ensembl Xenopus
Match: trpc3 (transient receptor potential cation channel, subfamily C, member 3 [Source:Xenbase;Acc:XB-GENE-1014039])

HSP 1 Score: 108.612 bits (270), Expect = 3.509e-25
Identity = 47/63 (74.60%), Postives = 56/63 (88.89%), Query Frame = 3
Query: 1302 KRKRRVLFSKKQILELERHFRQKKYLSAPEREHLANLIGLSPTQVKIWFQNHRYKMKRAHHEK 1490
            +RKRRVLFS+ Q+ ELER F+Q+KYLSAPEREHLA++I L+PTQVKIWFQNHRYKMKR   +K
Sbjct:  160 RRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQAKDK 222          
BLAST of Homeobox protein DTH-1 vs. Ensembl Xenopus
Match: NKX2-3 (NK2 homeobox 3 [Source:NCBI gene;Acc:100486189])

HSP 1 Score: 104.375 bits (259), Expect = 8.119e-24
Identity = 47/68 (69.12%), Postives = 56/68 (82.35%), Query Frame = 3
Query: 1302 KRKRRVLFSKKQILELERHFRQKKYLSAPEREHLANLIGLSPTQVKIWFQNHRYKMKRAHHEKSLEMG 1505
            +RK RVLFS+ Q+ ELER F+Q++YLSAPEREHLAN + L+ TQVKIWFQN RYK KR   +KSLEMG
Sbjct:  146 RRKPRVLFSQAQVFELERRFKQQRYLSAPEREHLANSLKLTSTQVKIWFQNRRYKCKRQRQDKSLEMG 213          
BLAST of Homeobox protein DTH-1 vs. Ensembl Xenopus
Match: mtm1 (myotubularin 1 [Source:Xenbase;Acc:XB-GENE-1002030])

HSP 1 Score: 99.3673 bits (246), Expect = 1.045e-22
Identity = 45/78 (57.69%), Postives = 60/78 (76.92%), Query Frame = 3
Query: 1299 KKRKRRVLFSKKQILELERHFRQKKYLSAPEREHLANLIGLSPTQVKIWFQNHRYKMKRAHHEKSLEMGNLAVNRRIS 1532
            ++RK RVLFS+ Q+ ELER F+Q++YLSAPERE LA  + L+ TQVKIWFQN RYK KR   ++SLE+G+    RR++
Sbjct:   93 QRRKPRVLFSQMQVFELERRFKQQRYLSAPEREQLALALKLTSTQVKIWFQNRRYKCKRQKQDRSLELGHPIPPRRVA 170          
BLAST of Homeobox protein DTH-1 vs. Ensembl Mouse
Match: Nkx2-2 (NK2 homeobox 2 [Source:MGI Symbol;Acc:MGI:97347])

HSP 1 Score: 125.946 bits (315), Expect = 6.214e-32
Identity = 58/80 (72.50%), Postives = 66/80 (82.50%), Query Frame = 3
Query: 1293 VGKKRKRRVLFSKKQILELERHFRQKKYLSAPEREHLANLIGLSPTQVKIWFQNHRYKMKRAHHEKSLEMGNLAVNRRIS 1532
             GKKRKRRVLFSK Q  ELER FRQ++YLSAPEREHLA+LI L+PTQVKIWFQNHRYKMKRA  EK +E+  L   RR++
Sbjct:  125 AGKKRKRRVLFSKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKRARAEKGMEVTPLPSPRRVA 204          
BLAST of Homeobox protein DTH-1 vs. Ensembl Mouse
Match: Nkx2-2 (NK2 homeobox 2 [Source:MGI Symbol;Acc:MGI:97347])

HSP 1 Score: 118.627 bits (296), Expect = 1.379e-29
Identity = 57/79 (72.15%), Postives = 64/79 (81.01%), Query Frame = 3
Query: 1293 VGKKRKRRVLFSKKQILELERHFRQKKYLSAPEREHLANLIGLSPTQVKIWFQNHRYKMKRAHHEKSLEMGNLAVNRRI 1529
             GKKRKRRVLFSK Q  ELER FRQ++YLSAPEREHLA+LI L+PTQVKIWFQNHRYKMKRA  EK+ +      NRR+
Sbjct:  125 AGKKRKRRVLFSKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKRARAEKAFQ------NRRM 197          
BLAST of Homeobox protein DTH-1 vs. Ensembl Mouse
Match: Nkx2-9 (NK2 homeobox 9 [Source:MGI Symbol;Acc:MGI:1270158])

HSP 1 Score: 106.686 bits (265), Expect = 1.411e-25
Identity = 49/74 (66.22%), Postives = 58/74 (78.38%), Query Frame = 3
Query: 1299 KKRKRRVLFSKKQILELERHFRQKKYLSAPEREHLANLIGLSPTQVKIWFQNHRYKMKRAHHEKSLEMGNLAVN 1520
            K+RKRRVLFSK Q LELER FRQ++YLSAPERE LA L+ L+PTQVKIWFQNHRYK+KR       E  ++A +
Sbjct:   80 KRRKRRVLFSKAQTLELERRFRQQRYLSAPEREQLARLLRLTPTQVKIWFQNHRYKLKRGRAPGITEPSDMAAS 153          
BLAST of Homeobox protein DTH-1 vs. Ensembl Mouse
Match: Nkx2-4 (NK2 homeobox 4 [Source:MGI Symbol;Acc:MGI:97349])

HSP 1 Score: 109.383 bits (272), Expect = 1.892e-25
Identity = 47/66 (71.21%), Postives = 58/66 (87.88%), Query Frame = 3
Query: 1302 KRKRRVLFSKKQILELERHFRQKKYLSAPEREHLANLIGLSPTQVKIWFQNHRYKMKRAHHEKSLE 1499
            +RKRRVLFS+ Q+ ELER F+Q+KYLSAPEREHLA++I L+PTQVKIWFQNHRYKMKR   +K+ +
Sbjct:  188 RRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQAKDKAAQ 253          
BLAST of Homeobox protein DTH-1 vs. Ensembl Mouse
Match: Nkx2-1 (NK2 homeobox 1 [Source:MGI Symbol;Acc:MGI:108067])

HSP 1 Score: 107.457 bits (267), Expect = 9.583e-25
Identity = 47/64 (73.44%), Postives = 57/64 (89.06%), Query Frame = 3
Query: 1302 KRKRRVLFSKKQILELERHFRQKKYLSAPEREHLANLIGLSPTQVKIWFQNHRYKMKRAHHEKS 1493
            +RKRRVLFS+ Q+ ELER F+Q+KYLSAPEREHLA++I L+PTQVKIWFQNHRYKMKR   +K+
Sbjct:  161 RRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQAKDKA 224          
BLAST of Homeobox protein DTH-1 vs. UniProt/SwissProt
Match: sp|Q00400|DTH1_GIRTI (Homeobox protein DTH-1 OS=Girardia tigrina OX=6162 GN=DTH-1 PE=2 SV=2)

HSP 1 Score: 623.624 bits (1607), Expect = 0.000e+0
Identity = 383/542 (70.66%), Postives = 445/542 (82.10%), Query Frame = 3
Query:  159 MSSNGDCVKYDSNFDREGYSTDTSTDCPIQTDDSLHEIQTSSLPDSFQLFPQNTKAHINELHETFSAANSITQHLQVXXXXXXXXXXXXXXXXXXXXXXTTDSSIY--QNFN--LIPRSFISNDEHSSNMSFVQMLNSPNYAQIDPAFFPNMPGIGNSFMMQSILNPNSSEQEIENPISNSSTYVLVPADXXXXXXXXXXXXXXAYGSLNLTNCGNNLFQYSSQSNQHQYPDINGNGPRLLHCKHEMQYPPDNISPFEYHLSKSIQNSSP-SPYKLSLPEIKTISNEWIKGSPXXXXXXXXXXXXXXXVSDYSNVKSLPQTLLNQNQTDSIYSSSINENRLPVNNFDSPNADREDDSETQDNPNQKXXXXXXXXXXXXXXXXXVGKKRKRRVLFSKKQILELERHFRQKKYLSAPEREHLANLIGLSPTQVKIWFQNHRYKMKRAHHEKSLEMGNLAVNRRISQTMFNDSKSHMPSNFDLGMXXXXXXXXXXXXXXXXXPAANLMGRIPGMSSMIPTYQNGPQSYFNSINPATLAGSNSSWG 1769
            MSSNGD VKYD+NFDREGYSTD+S +CP Q DD L+ I  S   ++FQL+ +N  A  NELHETF     I Q + +++  N    ++++           D SIY  Q F+  L+ R+FI NDE +SNMSFVQMLNS NY QI+PAF+ NMPGIGNSFMMQSILNPN ++QEI+NPIS++STYVLV  DSNI +NPQSN IN  Y SL+L +C +N+F+Y SQ+  HQYPDINGNGPRLLHCK E+ YP  NISPF+Y LS+S+Q+++P S YKLSLPEIKTISN+WIKGS   +NFNQNQ LR+ NVSDY+ +K+LPQ L N NQTDSIYSSSINEN  P+ N+DSPN DREDDSE  +NPN  DTSSVENNDN+NSSSGD+GKKRKRRVLFSKKQILELERHFRQKKYLSAPEREHLANLIGLSPTQVKIWFQNHRYKMKRAHHEK+LEMGNLAVNRR++Q+MFNDSKSH+P NF+LG+NNSFYNSNL+ GNLSLNPA NLMGRIPGMSSM+PTY NG QSYFN+IN ATL GSNSSWG
Sbjct:    1 MSSNGDSVKYDTNFDREGYSTDSSNECPNQIDDPLNGIPNSQNSENFQLYSRNNNA--NELHETFPTTIPIAQQVHLSSFRNSGMVNSNSRSI------GPDGSIYSIQPFDRALLQRNFIPNDEMTSNMSFVQMLNSANYDQIEPAFYQNMPGIGNSFMMQSILNPNPNDQEIDNPISDNSTYVLVQGDSNIPTNPQSNPINPTYVSLDLNDCRSNMFEYPSQTG-HQYPDINGNGPRLLHCKQELSYPQTNISPFDYRLSRSMQSNTPLSSYKLSLPEIKTISNDWIKGS-QNVNFNQNQLLRSTNVSDYTLIKNLPQNLPNPNQTDSIYSSSINENNQPIRNYDSPNPDREDDSEIHENPNPHDTSSVENNDNENSSSGDIGKKRKRRVLFSKKQILELERHFRQKKYLSAPEREHLANLIGLSPTQVKIWFQNHRYKMKRAHHEKALEMGNLAVNRRLNQSMFNDSKSHLPGNFELGINNSFYNSNLALGNLSLNPAVNLMGRIPGMSSMLPTYPNGSQSYFNNINQATLTGSNSSWG 532          
BLAST of Homeobox protein DTH-1 vs. UniProt/SwissProt
Match: sp|Q90481|NX22A_DANRE (Homeobox protein Nkx-2.2a OS=Danio rerio OX=7955 GN=nkx2.2a PE=2 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 9.796e-32
Identity = 58/79 (73.42%), Postives = 67/79 (84.81%), Query Frame = 3
Query: 1296 GKKRKRRVLFSKKQILELERHFRQKKYLSAPEREHLANLIGLSPTQVKIWFQNHRYKMKRAHHEKSLEMGNLAVNRRIS 1532
            GKKRKRRVLFSK Q  ELER FRQ++YLSAPEREHLA+LI L+PTQVKIWFQNHRYKMKRA  EK +E+ +L   RR++
Sbjct:  123 GKKRKRRVLFSKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKRARAEKGMEVTHLPSPRRVA 201          
BLAST of Homeobox protein DTH-1 vs. UniProt/SwissProt
Match: sp|P42586|NKX22_MOUSE (Homeobox protein Nkx-2.2 OS=Mus musculus OX=10090 GN=Nkx2-2 PE=1 SV=2)

HSP 1 Score: 125.946 bits (315), Expect = 4.347e-31
Identity = 58/80 (72.50%), Postives = 66/80 (82.50%), Query Frame = 3
Query: 1293 VGKKRKRRVLFSKKQILELERHFRQKKYLSAPEREHLANLIGLSPTQVKIWFQNHRYKMKRAHHEKSLEMGNLAVNRRIS 1532
             GKKRKRRVLFSK Q  ELER FRQ++YLSAPEREHLA+LI L+PTQVKIWFQNHRYKMKRA  EK +E+  L   RR++
Sbjct:  125 AGKKRKRRVLFSKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKRARAEKGMEVTPLPSPRRVA 204          
BLAST of Homeobox protein DTH-1 vs. UniProt/SwissProt
Match: sp|O95096|NKX22_HUMAN (Homeobox protein Nkx-2.2 OS=Homo sapiens OX=9606 GN=NKX2-2 PE=2 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 5.545e-31
Identity = 58/80 (72.50%), Postives = 66/80 (82.50%), Query Frame = 3
Query: 1293 VGKKRKRRVLFSKKQILELERHFRQKKYLSAPEREHLANLIGLSPTQVKIWFQNHRYKMKRAHHEKSLEMGNLAVNRRIS 1532
             GKKRKRRVLFSK Q  ELER FRQ++YLSAPEREHLA+LI L+PTQVKIWFQNHRYKMKRA  EK +E+  L   RR++
Sbjct:  125 AGKKRKRRVLFSKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKRARAEKGMEVTPLPSPRRVA 204          
BLAST of Homeobox protein DTH-1 vs. UniProt/SwissProt
Match: sp|P42587|HNK2_XENLA (Homeobox protein XENK-2 OS=Xenopus laevis OX=8355 PE=2 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 8.367e-31
Identity = 58/79 (73.42%), Postives = 66/79 (83.54%), Query Frame = 3
Query: 1296 GKKRKRRVLFSKKQILELERHFRQKKYLSAPEREHLANLIGLSPTQVKIWFQNHRYKMKRAHHEKSLEMGNLAVNRRIS 1532
            GKKRKRRVLFSK Q  ELER FRQ++YLSAPEREHLA+LI L+PTQVKIWFQNHRYKMKRA  EK +E+  L   RR++
Sbjct:   67 GKKRKRRVLFSKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKRARSEKGMEVTPLPSPRRVA 145          
BLAST of Homeobox protein DTH-1 vs. TrEMBL
Match: A0A444UL68 (Homeobox protein Nkx-2.2a OS=Acipenser ruthenus OX=7906 GN=EOD39_12434 PE=4 SV=1)

HSP 1 Score: 128.257 bits (321), Expect = 8.154e-30
Identity = 58/79 (73.42%), Postives = 67/79 (84.81%), Query Frame = 3
Query: 1296 GKKRKRRVLFSKKQILELERHFRQKKYLSAPEREHLANLIGLSPTQVKIWFQNHRYKMKRAHHEKSLEMGNLAVNRRIS 1532
            GKKRKRRVLFSK Q  ELER FRQ++YLSAPEREHLA+LI L+PTQVKIWFQNHRYKMKRA  EK +E+ +L   RR++
Sbjct:   84 GKKRKRRVLFSKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKRARAEKGMEVSHLPSPRRVA 162          
BLAST of Homeobox protein DTH-1 vs. TrEMBL
Match: A0A553QS87 (Homeobox domain-containing protein OS=Danionella translucida OX=623744 GN=DNTS_024904 PE=4 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 2.264e-29
Identity = 58/79 (73.42%), Postives = 67/79 (84.81%), Query Frame = 3
Query: 1296 GKKRKRRVLFSKKQILELERHFRQKKYLSAPEREHLANLIGLSPTQVKIWFQNHRYKMKRAHHEKSLEMGNLAVNRRIS 1532
            GKKRKRRVLFSK Q  ELER FRQ++YLSAPEREHLA+LI L+PTQVKIWFQNHRYKMKRA  EK +E+ +L   RR++
Sbjct:  122 GKKRKRRVLFSKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKRARAEKGMEVSHLPSPRRVA 200          
BLAST of Homeobox protein DTH-1 vs. TrEMBL
Match: A0A444TWQ6 (Homeobox protein Nkx-2.2a OS=Acipenser ruthenus OX=7906 GN=EOD39_3035 PE=4 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 2.481e-29
Identity = 58/79 (73.42%), Postives = 67/79 (84.81%), Query Frame = 3
Query: 1296 GKKRKRRVLFSKKQILELERHFRQKKYLSAPEREHLANLIGLSPTQVKIWFQNHRYKMKRAHHEKSLEMGNLAVNRRIS 1532
            GKKRKRRVLFSK Q  ELER FRQ++YLSAPEREHLA+LI L+PTQVKIWFQNHRYKMKRA  EK +E+ +L   RR++
Sbjct:  126 GKKRKRRVLFSKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKRARAEKGMEVSHLPSPRRVA 204          
BLAST of Homeobox protein DTH-1 vs. TrEMBL
Match: A0A3B3QFH1 (NK2 homeobox 2a OS=Paramormyrops kingsleyae OX=1676925 PE=4 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 2.671e-29
Identity = 58/79 (73.42%), Postives = 67/79 (84.81%), Query Frame = 3
Query: 1296 GKKRKRRVLFSKKQILELERHFRQKKYLSAPEREHLANLIGLSPTQVKIWFQNHRYKMKRAHHEKSLEMGNLAVNRRIS 1532
            GKKRKRRVLFSK Q  ELER FRQ++YLSAPEREHLA+LI L+PTQVKIWFQNHRYKMKRA  EK +E+ +L   RR++
Sbjct:  124 GKKRKRRVLFSKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKRARAEKGMEVTHLPSPRRVA 202          
BLAST of Homeobox protein DTH-1 vs. TrEMBL
Match: Q1RM24 (NK2 transcription factor related 2a OS=Danio rerio OX=7955 GN=nkx2.2a PE=2 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 2.903e-29
Identity = 58/79 (73.42%), Postives = 67/79 (84.81%), Query Frame = 3
Query: 1296 GKKRKRRVLFSKKQILELERHFRQKKYLSAPEREHLANLIGLSPTQVKIWFQNHRYKMKRAHHEKSLEMGNLAVNRRIS 1532
            GKKRKRRVLFSK Q  ELER FRQ++YLSAPEREHLA+LI L+PTQVKIWFQNHRYKMKRA  EK +E+ +L   RR++
Sbjct:  123 GKKRKRRVLFSKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKRARAEKGMEVTHLPSPRRVA 201          
BLAST of Homeobox protein DTH-1 vs. Ensembl Cavefish
Match: ENSAMXT00000002203.2 (pep primary_assembly:Astyanax_mexicanus-2.0:9:20913167:20916891:1 gene:ENSAMXG00000002158.2 transcript:ENSAMXT00000002203.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 105.145 bits (261), Expect = 5.365e-26
Identity = 53/88 (60.23%), Postives = 63/88 (71.59%), Query Frame = 3
Query: 1299 KKRKRRVLFSKKQILELERHFRQKKYLSAPEREHLANLIGLSPTQVKIWFQNHRYKMKRAHHEKSLEMGNL--AVNRRISQTMFNDSK 1556
            KK+KRRVLFSK Q  ELER FRQ++YLSAPEREHLA  + L+PTQVKIWFQNHRYKMKRA  E  ++      ++ R I   +  D K
Sbjct:   16 KKKKRRVLFSKTQTYELERRFRQQRYLSAPEREHLARALRLTPTQVKIWFQNHRYKMKRARTECGVQEAGQPPSLRRVIVPVLVRDGK 103          
BLAST of Homeobox protein DTH-1 vs. Ensembl Cavefish
Match: nkx2.1 (homeobox protein Nkx-2.1 [Source:NCBI gene;Acc:103043023])

HSP 1 Score: 108.227 bits (269), Expect = 2.845e-25
Identity = 47/63 (74.60%), Postives = 56/63 (88.89%), Query Frame = 3
Query: 1302 KRKRRVLFSKKQILELERHFRQKKYLSAPEREHLANLIGLSPTQVKIWFQNHRYKMKRAHHEK 1490
            +RKRRVLFS+ Q+ ELER F+Q+KYLSAPEREHLA++I L+PTQVKIWFQNHRYKMKR   +K
Sbjct:  160 RRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQAKDK 222          
BLAST of Homeobox protein DTH-1 vs. Ensembl Cavefish
Match: nkx2.5 (homeobox protein Nkx-2.5 [Source:NCBI gene;Acc:103025318])

HSP 1 Score: 104.76 bits (260), Expect = 2.440e-24
Identity = 47/78 (60.26%), Postives = 57/78 (73.08%), Query Frame = 3
Query: 1299 KKRKRRVLFSKKQILELERHFRQKKYLSAPEREHLANLIGLSPTQVKIWFQNHRYKMKRAHHEKSLEMGNLAVNRRIS 1532
            K+RK RVLFS+ Q+ ELER F Q++YLSA EREHLA  + L+ TQVKIWFQN RYK KR   E++LE   L   RR+S
Sbjct:  131 KRRKPRVLFSQAQVCELERRFTQQRYLSAAEREHLAGALRLTSTQVKIWFQNRRYKCKRQRQERALEAAGLGAPRRVS 208          
BLAST of Homeobox protein DTH-1 vs. Ensembl Cavefish
Match: nkx2.4b (NK2 homeobox 4 [Source:NCBI gene;Acc:103036401])

HSP 1 Score: 103.605 bits (257), Expect = 7.231e-24
Identity = 45/63 (71.43%), Postives = 55/63 (87.30%), Query Frame = 3
Query: 1302 KRKRRVLFSKKQILELERHFRQKKYLSAPEREHLANLIGLSPTQVKIWFQNHRYKMKRAHHEK 1490
            +RKRRVLFS+ Q+ ELER F+Q++YLSAPEREHLA++I L+P QVKIWFQNHRYKMKR   +K
Sbjct:  143 RRKRRVLFSQAQVYELERRFKQQRYLSAPEREHLASMIHLTPNQVKIWFQNHRYKMKRQAKDK 205          
BLAST of Homeobox protein DTH-1 vs. Ensembl Cavefish
Match: nkx2.2b (homeobox protein Nkx-2.2-like [Source:NCBI gene;Acc:107197780])

HSP 1 Score: 95.1301 bits (235), Expect = 9.203e-22
Identity = 49/93 (52.69%), Postives = 60/93 (64.52%), Query Frame = 3
Query: 1317 VLFSKKQILELERHFRQKKYLSAPEREHLANLIGLSPTQVKIWFQNHRYKMKRAHHEKSLEMGNLAVNRRISQTMFNDSKS---HMPSNFDLG 1586
            VLFS+ Q  ELER FRQ++YLS PEREHLA+ + L+PTQVKIWFQNHRYKMKRA   + L +  L  + R      +D  +   H    F LG
Sbjct:  107 VLFSRAQTCELERRFRQQRYLSGPEREHLAHSLRLTPTQVKIWFQNHRYKMKRAERGRELAVPILLRDHRTCSVKPHDFVAPLLHTGLQFPLG 199          
BLAST of Homeobox protein DTH-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005776.1 (pep scaffold:Pmarinus_7.0:GL477528:542110:542457:1 gene:ENSPMAG00000005236.1 transcript:ENSPMAT00000005776.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 105.145 bits (261), Expect = 1.636e-27
Identity = 50/66 (75.76%), Postives = 57/66 (86.36%), Query Frame = 3
Query: 1299 KKRKRRVLFSKKQILELERHFRQKKYLSAPEREHLANLIGLSPTQVKIWFQNHRYKMKRAHHEKSL 1496
            KKRKRRVLFSK Q  ELER FR ++YLSAPEREHLA+L+ L+PTQVKIWFQNHRYKMKRA  E+ +
Sbjct:    1 KKRKRRVLFSKAQTFELERRFRHQRYLSAPEREHLASLLKLTPTQVKIWFQNHRYKMKRARVEQGI 66          
BLAST of Homeobox protein DTH-1 vs. Ensembl Sea Lamprey
Match: nkx2.1 (NK2 homeobox 1 [Source:ZFIN;Acc:ZDB-GENE-010404-1])

HSP 1 Score: 107.842 bits (268), Expect = 7.521e-27
Identity = 47/63 (74.60%), Postives = 56/63 (88.89%), Query Frame = 3
Query: 1302 KRKRRVLFSKKQILELERHFRQKKYLSAPEREHLANLIGLSPTQVKIWFQNHRYKMKRAHHEK 1490
            +RKRRVLFS+ Q+ ELER F+Q+KYLSAPEREHLA++I L+PTQVKIWFQNHRYKMKR   +K
Sbjct:   40 RRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQAKDK 102          
BLAST of Homeobox protein DTH-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001141.1 (pep scaffold:Pmarinus_7.0:GL478075:36995:38394:-1 gene:ENSPMAG00000001023.1 transcript:ENSPMAT00000001141.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 71.2478 bits (173), Expect = 1.505e-15
Identity = 34/61 (55.74%), Postives = 45/61 (73.77%), Query Frame = 3
Query: 1296 GKKRKRRVLFSKKQILELERHFRQKKYLSAPEREHLANLIGLSPTQVKIWFQNHRYKMKRA 1478
            GK R+ R  FS +Q+LELERHF +++YLS P+R  +A+ + L+ TQVKIWFQN R K KR 
Sbjct:    1 GKCRRPRTAFSSQQLLELERHFSRQRYLSRPQRFQVASALMLTETQVKIWFQNRRMKWKRG 61          
BLAST of Homeobox protein DTH-1 vs. Ensembl Sea Lamprey
Match: dlx5a (distal-less homeobox 5a [Source:NCBI gene;Acc:30569])

HSP 1 Score: 69.3218 bits (168), Expect = 7.999e-13
Identity = 31/59 (52.54%), Postives = 41/59 (69.49%), Query Frame = 3
Query: 1299 KKRKRRVLFSKKQILELERHFRQKKYLSAPEREHLANLIGLSPTQVKIWFQNHRYKMKR 1475
            K RK R ++S  Q+  L+R F+Q +YL+ PER  LA  +GL+ TQVKIWFQN R K K+
Sbjct:  201 KIRKPRTIYSSFQLAALQRRFQQTQYLALPERAELAASLGLTQTQVKIWFQNRRSKFKK 259          
BLAST of Homeobox protein DTH-1 vs. Ensembl Sea Lamprey
Match: HMX1 (H6 family homeobox 1 [Source:HGNC Symbol;Acc:HGNC:5017])

HSP 1 Score: 63.929 bits (154), Expect = 1.145e-12
Identity = 31/58 (53.45%), Postives = 40/58 (68.97%), Query Frame = 3
Query: 1302 KRKRRVLFSKKQILELERHFRQKKYLSAPEREHLANLIGLSPTQVKIWFQNHRYKMKR 1475
            K+K R +FS+ Q+ +LE  F  K+YLS+ ER  LA  + L+ TQVKIWFQN R K KR
Sbjct:    1 KKKTRTVFSRSQVFQLESTFDMKRYLSSAERAGLAASLHLTETQVKIWFQNRRNKWKR 58          
BLAST of Homeobox protein DTH-1 vs. Ensembl Yeast
Match: HMRA1 (Silenced copy of a1 at HMR; homeobox corepressor that interacts with Alpha2p to repress haploid-specific gene transcription in diploid cells [Source:SGD;Acc:S000000694])

HSP 1 Score: 44.2838 bits (103), Expect = 4.834e-6
Identity = 18/42 (42.86%), Postives = 30/42 (71.43%), Query Frame = 3
Query: 1347 LERHFRQKKYLSAPEREHLANLIGLSPTQVKIWFQNHRYKMK 1472
            LE+ FR+K+ L++ E+E +A   G++P QV++WF N R + K
Sbjct:   85 LEQVFRRKQSLNSKEKEEVAKKCGITPLQVRVWFINKRMRSK 126          
BLAST of Homeobox protein DTH-1 vs. Ensembl Nematostella
Match: EDO33946 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQP5])

HSP 1 Score: 101.679 bits (252), Expect = 1.452e-25
Identity = 47/65 (72.31%), Postives = 55/65 (84.62%), Query Frame = 3
Query: 1299 KKRKRRVLFSKKQILELERHFRQKKYLSAPEREHLANLIGLSPTQVKIWFQNHRYKMKRAHHEKS 1493
            KKRKRRVLF+K Q  ELER FRQ++YLSAPERE LA +I L+PTQVKIWFQNHRYK K+ ++EK 
Sbjct:    6 KKRKRRVLFTKAQTYELERRFRQQRYLSAPEREQLARIINLTPTQVKIWFQNHRYKFKKQNYEKG 70          
BLAST of Homeobox protein DTH-1 vs. Ensembl Nematostella
Match: NK-2 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQP7])

HSP 1 Score: 98.9821 bits (245), Expect = 1.679e-23
Identity = 45/64 (70.31%), Postives = 53/64 (82.81%), Query Frame = 3
Query: 1299 KKRKRRVLFSKKQILELERHFRQKKYLSAPEREHLANLIGLSPTQVKIWFQNHRYKMKRAHHEK 1490
            +K+KRR+LF+K QI ELER FRQ+KYLSA ERE LA +I L+PTQVKIWFQNHRYK K+   EK
Sbjct:   90 RKKKRRILFTKSQIFELERRFRQQKYLSANEREQLARIIDLTPTQVKIWFQNHRYKFKKQIGEK 153          
BLAST of Homeobox protein DTH-1 vs. Ensembl Nematostella
Match: EDO33947 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQP6])

HSP 1 Score: 93.9745 bits (232), Expect = 2.472e-23
Identity = 44/63 (69.84%), Postives = 51/63 (80.95%), Query Frame = 3
Query: 1299 KKRKRRVLFSKKQILELERHFRQKKYLSAPEREHLANLIGLSPTQVKIWFQNHRYKMKRAHHE 1487
            KKRKRR+LF+K QI ELER FR ++YLSAPERE L  +I L+PTQVKIWFQNHRYK K+   E
Sbjct:    1 KKRKRRILFTKSQIYELERRFRYQRYLSAPEREQLGRMINLTPTQVKIWFQNHRYKHKKQASE 63          
BLAST of Homeobox protein DTH-1 vs. Ensembl Nematostella
Match: EDO45871 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRR7])

HSP 1 Score: 88.5817 bits (218), Expect = 1.067e-21
Identity = 39/62 (62.90%), Postives = 52/62 (83.87%), Query Frame = 3
Query: 1302 KRKRRVLFSKKQILELERHFRQKKYLSAPEREHLANLIGLSPTQVKIWFQNHRYKMKRAHHE 1487
            K+K+R+LF++ QI ELER FR ++YLSAPEREHLA +I L+P QVKIWFQNHRYK ++ + +
Sbjct:    1 KKKKRILFTRSQIYELERRFRVQQYLSAPEREHLARMISLTPVQVKIWFQNHRYKCRQRYKQ 62          
BLAST of Homeobox protein DTH-1 vs. Ensembl Nematostella
Match: EDO33963 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQP4])

HSP 1 Score: 84.3445 bits (207), Expect = 2.688e-20
Identity = 41/64 (64.06%), Postives = 49/64 (76.56%), Query Frame = 3
Query: 1299 KKRKRRVLFSKKQILELERHFRQKKYLSAPEREHLANLIGLSPTQVKIWFQNHRYKMKRAHHEK 1490
            KKRKRR+LF+K Q   LER F Q++YLSAPERE LA +  L+P QVKIWFQNHRYK ++   EK
Sbjct:    3 KKRKRRILFTKAQTFILERRFTQQRYLSAPEREELARIANLTPAQVKIWFQNHRYKYRKQMSEK 66          
BLAST of Homeobox protein DTH-1 vs. Ensembl Medaka
Match: nkx2.2a (homeobox protein Nkx-2.2a [Source:NCBI gene;Acc:101157822])

HSP 1 Score: 124.79 bits (312), Expect = 1.388e-31
Identity = 57/78 (73.08%), Postives = 66/78 (84.62%), Query Frame = 3
Query: 1299 KKRKRRVLFSKKQILELERHFRQKKYLSAPEREHLANLIGLSPTQVKIWFQNHRYKMKRAHHEKSLEMGNLAVNRRIS 1532
            KKRKRRVLFSK Q  ELER FRQ++YLSAPEREHLA+LI L+PTQVKIWFQNHRYKMKRA  EK +E+ +L   RR++
Sbjct:  128 KKRKRRVLFSKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKRARAEKGMEVTHLPSPRRVA 205          
BLAST of Homeobox protein DTH-1 vs. Ensembl Medaka
Match: nkx2.2a (homeobox protein Nkx-2.2a [Source:NCBI gene;Acc:101157822])

HSP 1 Score: 124.79 bits (312), Expect = 1.708e-31
Identity = 57/78 (73.08%), Postives = 66/78 (84.62%), Query Frame = 3
Query: 1299 KKRKRRVLFSKKQILELERHFRQKKYLSAPEREHLANLIGLSPTQVKIWFQNHRYKMKRAHHEKSLEMGNLAVNRRIS 1532
            KKRKRRVLFSK Q  ELER FRQ++YLSAPEREHLA+LI L+PTQVKIWFQNHRYKMKRA  EK +E+ +L   RR++
Sbjct:  134 KKRKRRVLFSKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKRARAEKGMEVTHLPSPRRVA 211          
BLAST of Homeobox protein DTH-1 vs. Ensembl Medaka
Match: nkx2.2a (homeobox protein Nkx-2.2a [Source:NCBI gene;Acc:101157822])

HSP 1 Score: 120.553 bits (301), Expect = 2.631e-30
Identity = 55/68 (80.88%), Postives = 60/68 (88.24%), Query Frame = 3
Query: 1299 KKRKRRVLFSKKQILELERHFRQKKYLSAPEREHLANLIGLSPTQVKIWFQNHRYKMKRAHHEKSLEM 1502
            KKRKRRVLFSK Q  ELER FRQ++YLSAPEREHLA+LI L+PTQVKIWFQNHRYKMKRA  EK LE+
Sbjct:  128 KKRKRRVLFSKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKRARAEKGLEL 195          
BLAST of Homeobox protein DTH-1 vs. Ensembl Medaka
Match: NKX2-8 (NK2 homeobox 8 [Source:NCBI gene;Acc:101166096])

HSP 1 Score: 108.612 bits (270), Expect = 2.348e-26
Identity = 58/136 (42.65%), Postives = 75/136 (55.15%), Query Frame = 3
Query: 1185 SPNADREDDSETQDNPNQKXXXXXXXXXXXXXXXXXVGKKRKRRVLFSKKQILELERHFRQKKYLSAPEREHLANLIGLSPTQVKIWFQNHRYKMKRAHHEKSLEMGNLA----VNRRISQTMFNDSKSHMPSNFD 1580
            SP++ + DDS     P +                    K +KRRVLFSK Q LELER FRQ++YLS PERE LA ++ L+PTQVKIWFQNHRYKMKR   E +L+  + A    + R +   +  + K   P   D
Sbjct:   57 SPDSTKPDDSALDSEPQR------------------TQKSKKRRVLFSKAQTLELERRFRQQRYLSGPEREQLARMLSLTPTQVKIWFQNHRYKMKRGRVEGALQDADAAQPPVLRRVVVPILVREGKPFHPCFLD 174          
BLAST of Homeobox protein DTH-1 vs. Ensembl Medaka
Match: nkx2.1 (NK2 homeobox 1 [Source:NCBI gene;Acc:100049404])

HSP 1 Score: 108.997 bits (271), Expect = 1.538e-25
Identity = 47/64 (73.44%), Postives = 57/64 (89.06%), Query Frame = 3
Query: 1302 KRKRRVLFSKKQILELERHFRQKKYLSAPEREHLANLIGLSPTQVKIWFQNHRYKMKRAHHEKS 1493
            +RKRRVLFS+ Q+ ELER F+Q+KYLSAPEREHLA++I L+PTQVKIWFQNHRYKMKR   +K+
Sbjct:  159 RRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQAKDKA 222          
BLAST of Homeobox protein DTH-1 vs. Planmine SMEST
Match: SMESG000079512.1 (SMESG000079512.1)

HSP 1 Score: 858.981 bits (2218), Expect = 0.000e+0
Identity = 496/538 (92.19%), Postives = 500/538 (92.94%), Query Frame = 3
Query:  159 MSSNGDCVKYDSNFDREGYSTDTSTDCPIQTDDSLHEIQTSSLPDSFQLFPQNTKAHINELHETFSAANSITQHLQVXXXXXXXXXXXXXXXXXXXXXXTTDSSIYQNFNLIPRSFISNDEHSSNMSFVQMLNSPNYAQIDPAFFPNMPGIGNSFMMQSILNPNSSEQEIENPISNSSTYVLVPADXXXXXXXXXXXXXXAYGSLNLTNCGNNLFQYSSQSNQHQYPDINGNGPRLLHCKHEMQYPPDNISPFEYHLSKSIQNSSPSPYKLSLPEIKTISNEWIKGSPXXXXXXXXXXXXXXXVSDYSNVKSLPQTLLNQNQTDSIYSSSINENRLPVNNFDSPNADREDDSETQDNPNQKXXXXXXXXXXXXXXXXXVGKKRKRRVLFSKKQILELERHFRQKKYLSAPEREHLANLIGLSPTQVKIWFQNHRYKMKRAHHEKSLEMGNLAVNRRISQTMFNDSKSHMPSNFDLGMXXXXXXXXXXXXXXXXXPAANLMGRIPGMSSMIPTYQNGPQSYFNSINPATLAGSNSSWGH 1772
            MSSNGDCVKYDSNFDREGYSTDTSTDCPIQTDDSLHEIQTSSLPDSFQLFPQNTKAHINELHETFSAANSITQHLQVNNNN+                   +SSIYQNFNLIPRSFISNDEHSSNMSFVQMLNSPNYAQIDPAFFPNMPGIGNSFMMQSILNPNSSEQEIENPISNSSTYVLVPADSNIQSNPQSNSINSAYGSLNLTNCGNNLFQYS+QSNQHQYPDINGNGPRLLHCKHEMQYPPDNISPFEYHLSKSIQNSSPSPYKLSLPEIKTISNEWIKGSPNIINFNQNQRLRNQNVSDYSNVKSLPQTLLNQNQTDSIYSSSINENRL VNNFDSPNADREDDSETQDNPNQKDTSSVENNDNDNSSSGDVGKKRKRRVLFSKKQILELERHFRQKKYLSAPEREHLANLIGLSPTQVKIWFQNHRYKMKRAHHEKSLEMGNLAVNRRISQTMFNDSKSHMPSNFDLGMNNSFYN             +NL     GMSSMIPTYQNGPQSYFNSINPATLAGSNSSWGH
Sbjct:    1 MSSNGDCVKYDSNFDREGYSTDTSTDCPIQTDDSLHEIQTSSLPDSFQLFPQNTKAHINELHETFSAANSITQHLQVNNNNHI----------------NYNSSIYQNFNLIPRSFISNDEHSSNMSFVQMLNSPNYAQIDPAFFPNMPGIGNSFMMQSILNPNSSEQEIENPISNSSTYVLVPADSNIQSNPQSNSINSAYGSLNLTNCGNNLFQYSNQSNQHQYPDINGNGPRLLHCKHEMQYPPDNISPFEYHLSKSIQNSSPSPYKLSLPEIKTISNEWIKGSPNIINFNQNQRLRNQNVSDYSNVKSLPQTLLNQNQTDSIYSSSINENRLQVNNFDSPNADREDDSETQDNPNQKDTSSVENNDNDNSSSGDVGKKRKRRVLFSKKQILELERHFRQKKYLSAPEREHLANLIGLSPTQVKIWFQNHRYKMKRAHHEKSLEMGNLAVNRRISQTMFNDSKSHMPSNFDLGMNNSFYN-------------SNLSF---GMSSMIPTYQNGPQSYFNSINPATLAGSNSSWGH 506          
BLAST of Homeobox protein DTH-1 vs. Planmine SMEST
Match: SMESG000037282.1 (SMESG000037282.1)

HSP 1 Score: 112.849 bits (281), Expect = 7.284e-27
Identity = 49/69 (71.01%), Postives = 59/69 (85.51%), Query Frame = 3
Query: 1293 VGKKRKRRVLFSKKQILELERHFRQKKYLSAPEREHLANLIGLSPTQVKIWFQNHRYKMKRAHHEKSLE 1499
            + ++RKRR+LFS+ QI ELER F+Q+KYLSAPEREHLANLI L+PTQVKIWFQNHRYK KR+  +K  E
Sbjct:  121 ISQRRKRRILFSQAQIYELERRFKQQKYLSAPEREHLANLINLTPTQVKIWFQNHRYKCKRSQKDKEKE 189          
BLAST of Homeobox protein DTH-1 vs. Planmine SMEST
Match: SMESG000037282.1 (SMESG000037282.1)

HSP 1 Score: 112.849 bits (281), Expect = 8.832e-27
Identity = 49/69 (71.01%), Postives = 59/69 (85.51%), Query Frame = 3
Query: 1293 VGKKRKRRVLFSKKQILELERHFRQKKYLSAPEREHLANLIGLSPTQVKIWFQNHRYKMKRAHHEKSLE 1499
            + ++RKRR+LFS+ QI ELER F+Q+KYLSAPEREHLANLI L+PTQVKIWFQNHRYK KR+  +K  E
Sbjct:  130 ISQRRKRRILFSQAQIYELERRFKQQKYLSAPEREHLANLINLTPTQVKIWFQNHRYKCKRSQKDKEKE 198          
BLAST of Homeobox protein DTH-1 vs. Planmine SMEST
Match: SMESG000081885.1 (SMESG000081885.1)

HSP 1 Score: 97.4413 bits (241), Expect = 1.653e-21
Identity = 41/57 (71.93%), Postives = 50/57 (87.72%), Query Frame = 3
Query: 1317 VLFSKKQILELERHFRQKKYLSAPEREHLANLIGLSPTQVKIWFQNHRYKMKRAHHE 1487
            +LFS+ Q+ ELER F+Q+KYLSAPEREHLA+LI L+PTQVKIWFQNHRYK KR+  +
Sbjct:  136 ILFSQAQVYELERRFKQQKYLSAPEREHLASLINLTPTQVKIWFQNHRYKCKRSQKD 192          
BLAST of Homeobox protein DTH-1 vs. Planmine SMEST
Match: SMESG000062916.1 (SMESG000062916.1)

HSP 1 Score: 93.9745 bits (232), Expect = 3.690e-21
Identity = 43/69 (62.32%), Postives = 53/69 (76.81%), Query Frame = 3
Query: 1293 VGKKRKRRVLFSKKQILELERHFRQKKYLSAPEREHLANLIGLSPTQVKIWFQNHRYKMKRAHHEKSLE 1499
             G++RKRR+LFS+ Q+ ELER F+ +KYLSA ER+ LA  I L+P QVKIWFQNHRYK KR   EK +E
Sbjct:  127 FGQRRKRRILFSQSQVYELERKFKHQKYLSASERDQLAQTINLTPNQVKIWFQNHRYKCKRI--EKDME 193          
The following BLAST results are available for this feature:
BLAST of Homeobox protein DTH-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NKX2-21.155e-3172.50NK2 homeobox 2 [Source:HGNC Symbol;Acc:HGNC:7835][more]
NKX2-81.645e-2664.94NK2 homeobox 8 [Source:HGNC Symbol;Acc:HGNC:16364][more]
NKX2-48.590e-2571.21NK2 homeobox 4 [Source:HGNC Symbol;Acc:HGNC:7837][more]
NKX2-19.644e-2573.44NK2 homeobox 1 [Source:HGNC Symbol;Acc:HGNC:11825][more]
NKX2-19.644e-2573.44NK2 homeobox 1 [Source:HGNC Symbol;Acc:HGNC:11825][more]
back to top
BLAST of Homeobox protein DTH-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ceh-244.667e-2467.65Homeobox protein ceh-24 [Source:UniProtKB/Swiss-P... [more]
ceh-224.583e-2162.69Homeobox protein ceh-22 [Source:UniProtKB/Swiss-P... [more]
ceh-226.961e-2162.69Homeobox protein ceh-22 [Source:UniProtKB/Swiss-P... [more]
ceh-221.105e-2062.69Homeobox protein ceh-22 [Source:UniProtKB/Swiss-P... [more]
ceh-223.099e-2062.69Homeobox protein ceh-22 [Source:UniProtKB/Swiss-P... [more]
back to top
BLAST of Homeobox protein DTH-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
scro2.571e-2667.65gene:FBgn0028993 transcript:FBtr0339923[more]
vnd4.437e-2677.61gene:FBgn0261930 transcript:FBtr0110929[more]
vnd6.839e-2677.61gene:FBgn0261930 transcript:FBtr0070110[more]
scro2.061e-2567.65gene:FBgn0028993 transcript:FBtr0113751[more]
tin3.091e-1666.10gene:FBgn0004110 transcript:FBtr0084086[more]
back to top
BLAST of Homeobox protein DTH-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nkx2.2a1.298e-3273.42NK2 homeobox 2a [Source:NCBI gene;Acc:30697][more]
nkx2.2a1.298e-3273.42NK2 homeobox 2a [Source:NCBI gene;Acc:30697][more]
nkx2.2a1.574e-3273.42NK2 homeobox 2a [Source:NCBI gene;Acc:30697][more]
nkx2.2a1.574e-3273.42NK2 homeobox 2a [Source:NCBI gene;Acc:30697][more]
nkx2.2a1.574e-3273.42NK2 homeobox 2a [Source:NCBI gene;Acc:30697][more]
back to top
BLAST of Homeobox protein DTH-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NKX2-23.955e-3273.42NK2 homeobox 2 [Source:NCBI gene;Acc:100038077][more]
fam221a1.768e-2571.21family with sequence similarity 221 member A [Sour... [more]
trpc33.509e-2574.60transient receptor potential cation channel, subfa... [more]
NKX2-38.119e-2469.12NK2 homeobox 3 [Source:NCBI gene;Acc:100486189][more]
mtm11.045e-2257.69myotubularin 1 [Source:Xenbase;Acc:XB-GENE-1002030... [more]
back to top
BLAST of Homeobox protein DTH-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nkx2-26.214e-3272.50NK2 homeobox 2 [Source:MGI Symbol;Acc:MGI:97347][more]
Nkx2-21.379e-2972.15NK2 homeobox 2 [Source:MGI Symbol;Acc:MGI:97347][more]
Nkx2-91.411e-2566.22NK2 homeobox 9 [Source:MGI Symbol;Acc:MGI:1270158][more]
Nkx2-41.892e-2571.21NK2 homeobox 4 [Source:MGI Symbol;Acc:MGI:97349][more]
Nkx2-19.583e-2573.44NK2 homeobox 1 [Source:MGI Symbol;Acc:MGI:108067][more]
back to top
BLAST of Homeobox protein DTH-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q00400|DTH1_GIRTI0.000e+070.66Homeobox protein DTH-1 OS=Girardia tigrina OX=6162... [more]
sp|Q90481|NX22A_DANRE9.796e-3273.42Homeobox protein Nkx-2.2a OS=Danio rerio OX=7955 G... [more]
sp|P42586|NKX22_MOUSE4.347e-3172.50Homeobox protein Nkx-2.2 OS=Mus musculus OX=10090 ... [more]
sp|O95096|NKX22_HUMAN5.545e-3172.50Homeobox protein Nkx-2.2 OS=Homo sapiens OX=9606 G... [more]
sp|P42587|HNK2_XENLA8.367e-3173.42Homeobox protein XENK-2 OS=Xenopus laevis OX=8355 ... [more]
back to top
BLAST of Homeobox protein DTH-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A444UL688.154e-3073.42Homeobox protein Nkx-2.2a OS=Acipenser ruthenus OX... [more]
A0A553QS872.264e-2973.42Homeobox domain-containing protein OS=Danionella t... [more]
A0A444TWQ62.481e-2973.42Homeobox protein Nkx-2.2a OS=Acipenser ruthenus OX... [more]
A0A3B3QFH12.671e-2973.42NK2 homeobox 2a OS=Paramormyrops kingsleyae OX=167... [more]
Q1RM242.903e-2973.42NK2 transcription factor related 2a OS=Danio rerio... [more]
back to top
BLAST of Homeobox protein DTH-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000002203.25.365e-2660.23pep primary_assembly:Astyanax_mexicanus-2.0:9:2091... [more]
nkx2.12.845e-2574.60homeobox protein Nkx-2.1 [Source:NCBI gene;Acc:103... [more]
nkx2.52.440e-2460.26homeobox protein Nkx-2.5 [Source:NCBI gene;Acc:103... [more]
nkx2.4b7.231e-2471.43NK2 homeobox 4 [Source:NCBI gene;Acc:103036401][more]
nkx2.2b9.203e-2252.69homeobox protein Nkx-2.2-like [Source:NCBI gene;Ac... [more]
back to top
BLAST of Homeobox protein DTH-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000005776.11.636e-2775.76pep scaffold:Pmarinus_7.0:GL477528:542110:542457:1... [more]
nkx2.17.521e-2774.60NK2 homeobox 1 [Source:ZFIN;Acc:ZDB-GENE-010404-1][more]
ENSPMAT00000001141.11.505e-1555.74pep scaffold:Pmarinus_7.0:GL478075:36995:38394:-1 ... [more]
dlx5a7.999e-1352.54distal-less homeobox 5a [Source:NCBI gene;Acc:3056... [more]
HMX11.145e-1253.45H6 family homeobox 1 [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of Homeobox protein DTH-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
HMRA14.834e-642.86Silenced copy of a1 at HMR; homeobox corepressor t... [more]
back to top
BLAST of Homeobox protein DTH-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO339461.452e-2572.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
NK-21.679e-2370.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO339472.472e-2369.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO458711.067e-2162.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO339632.688e-2064.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Homeobox protein DTH-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nkx2.2a1.388e-3173.08homeobox protein Nkx-2.2a [Source:NCBI gene;Acc:10... [more]
nkx2.2a1.708e-3173.08homeobox protein Nkx-2.2a [Source:NCBI gene;Acc:10... [more]
nkx2.2a2.631e-3080.88homeobox protein Nkx-2.2a [Source:NCBI gene;Acc:10... [more]
NKX2-82.348e-2642.65NK2 homeobox 8 [Source:NCBI gene;Acc:101166096][more]
nkx2.11.538e-2573.44NK2 homeobox 1 [Source:NCBI gene;Acc:100049404][more]
back to top
BLAST of Homeobox protein DTH-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000079512.10.000e+092.19SMESG000079512.1[more]
SMESG000037282.17.284e-2771.01SMESG000037282.1[more]
SMESG000037282.18.832e-2771.01SMESG000037282.1[more]
SMESG000081885.11.653e-2171.93SMESG000081885.1[more]
SMESG000062916.13.690e-2162.32SMESG000062916.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011793 ID=SMED30011793|Name=Homeobox protein DTH-1|organism=Schmidtea mediterranea sexual|type=transcript|length=1926bp
ATCTGCGATTTGTCAATTCAACAAAAACCCACTTGACCAATAATCATCAT
ATTTGTTATTATTTCAAACAGAAAATTCAACCTCTCCAATTCTGATAACT
CGAAAATCACATTATTCAACCATTTCCAACCTGTTCAGCTCTAAGTGTCC
ACTTAAAGATGAGTTCAAATGGTGACTGTGTCAAGTACGATTCAAATTTT
GATAGAGAAGGATACTCAACCGACACAAGCACAGATTGCCCAATCCAAAC
CGACGATTCTCTACACGAGATTCAAACGTCCTCTCTGCCAGACAGCTTTC
AATTGTTTCCACAAAATACCAAAGCCCACATCAATGAACTCCATGAAACA
TTCTCTGCCGCCAACTCGATTACGCAACATCTTCAAGTCAACAACAACAA
CAACCACATTAACTACAGTAATTCGAATTTAATCCATTCAAACAATCATT
TCATTACGACAGATTCGTCAATTTACCAGAACTTCAATCTAATTCCAAGG
AGTTTCATTTCCAATGACGAACATTCGTCAAATATGTCCTTCGTACAGAT
GCTAAACTCGCCAAATTATGCTCAGATTGATCCAGCATTTTTTCCCAACA
TGCCGGGAATCGGAAACAGTTTCATGATGCAGAGCATTTTGAATCCGAAT
TCCAGTGAACAAGAAATCGAGAATCCGATTTCAAACAGTTCCACTTACGT
TTTGGTGCCAGCAGACTCAAACATCCAGTCGAATCCTCAGTCGAACTCGA
TTAATTCAGCGTACGGATCACTGAATTTGACCAACTGTGGAAACAACCTA
TTCCAATATTCCAGCCAATCTAATCAACACCAATACCCCGATATCAATGG
AAACGGGCCCCGGCTTTTACATTGTAAACACGAAATGCAGTATCCCCCCG
ATAACATCAGTCCATTTGAATATCATTTATCTAAATCGATACAAAATAGC
TCCCCCTCGCCTTACAAATTATCATTACCAGAAATTAAAACAATTTCAAA
TGAGTGGATCAAAGGATCTCCAAACATTATCAACTTCAATCAAAATCAAC
GTTTACGCAACCAAAACGTATCAGATTATTCCAACGTAAAATCTTTACCT
CAAACTCTGCTTAACCAGAACCAAACAGATTCTATTTATTCCTCCTCGAT
AAACGAAAACCGTTTACCAGTTAATAATTTCGATTCTCCAAACGCTGACA
GAGAAGACGACTCAGAAACCCAAGACAACCCGAACCAGAAAGACACAAGT
TCTGTGGAAAATAATGACAACGACAATTCATCTTCGGGTGATGTTGGTAA
AAAACGAAAACGACGAGTGTTATTTAGTAAGAAACAAATTCTGGAACTCG
AGCGGCACTTTCGACAGAAGAAATATCTCTCAGCACCGGAACGGGAACAT
TTAGCAAATCTAATTGGTTTATCGCCAACCCAGGTGAAAATCTGGTTCCA
GAATCACCGATACAAAATGAAACGAGCCCACCATGAAAAGTCTTTGGAAA
TGGGAAATTTAGCGGTGAATCGTCGAATTAGTCAAACAATGTTCAATGAC
TCCAAATCACATATGCCTTCAAATTTTGATTTGGGAATGAATAATTCTTT
CTATAATTCCAATCTCTCATTTGGTAATTTGAGTTTAAATCCCGCTGCTA
ATTTAATGGGACGAATTCCAGGTATGTCTAGTATGATTCCAACATATCAA
AATGGGCCCCAGTCGTATTTCAACAGCATAAATCCCGCCACATTAGCTGG
CTCTAATTCTTCATGGGGTCATTGAATCGAAAACATTCTCGAATCCACAA
CAACTGCTCAGAACCTTCCTTTCCTCGAGTTTCAAAGACACTGGGATACT
TATTAATTATTATGAACTGATCGTATGTTGAGTGAATATTAATAAAAAAG
GTTTTTTATTTAGAAAAAAAAGATCG
back to top

protein sequence of SMED30011793-orf-1

>SMED30011793-orf-1 ID=SMED30011793-orf-1|Name=SMED30011793-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=539bp
MSSNGDCVKYDSNFDREGYSTDTSTDCPIQTDDSLHEIQTSSLPDSFQLF
PQNTKAHINELHETFSAANSITQHLQVNNNNNHINYSNSNLIHSNNHFIT
TDSSIYQNFNLIPRSFISNDEHSSNMSFVQMLNSPNYAQIDPAFFPNMPG
IGNSFMMQSILNPNSSEQEIENPISNSSTYVLVPADSNIQSNPQSNSINS
AYGSLNLTNCGNNLFQYSSQSNQHQYPDINGNGPRLLHCKHEMQYPPDNI
SPFEYHLSKSIQNSSPSPYKLSLPEIKTISNEWIKGSPNIINFNQNQRLR
NQNVSDYSNVKSLPQTLLNQNQTDSIYSSSINENRLPVNNFDSPNADRED
DSETQDNPNQKDTSSVENNDNDNSSSGDVGKKRKRRVLFSKKQILELERH
FRQKKYLSAPEREHLANLIGLSPTQVKIWFQNHRYKMKRAHHEKSLEMGN
LAVNRRISQTMFNDSKSHMPSNFDLGMNNSFYNSNLSFGNLSLNPAANLM
GRIPGMSSMIPTYQNGPQSYFNSINPATLAGSNSSWGH*
back to top
Aliases
The feature 'Homeobox protein DTH-1' has the following synonyms
Synonym
nkx2.2
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000039gamma neoblast
PLANA:0000070intestinal phagocyte
PLANA:0000421tail
PLANA:0000429neoblast
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR001356Homeobox_dom
IPR009057Homeobox-like_sf
IPR017970Homeobox_CS
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0043565sequence-specific DNA binding
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
GO:0007275multicellular organism development
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001356Homeobox domainSMARTSM00389HOX_1coord: 381..443
e-value: 3.2E-25
score: 99.8
IPR001356Homeobox domainPFAMPF00046Homeodomaincoord: 382..438
e-value: 2.9E-20
score: 71.9
IPR001356Homeobox domainPROSITEPS50071HOMEOBOX_2coord: 379..439
score: 20.212
IPR001356Homeobox domainCDDcd00086homeodomaincoord: 382..440
e-value: 2.71922E-22
score: 88.0692
NoneNo IPR availableGENE3DG3DSA:1.10.10.60coord: 342..443
e-value: 1.3E-24
score: 88.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 342..384
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 357..374
NoneNo IPR availablePANTHERPTHR24340:SF24HOMEOBOX PROTEIN NKX-2.2coord: 321..457
NoneNo IPR availablePANTHERPTHR24340FAMILY NOT NAMEDcoord: 321..457
IPR017970Homeobox, conserved sitePROSITEPS00027HOMEOBOX_1coord: 414..437
IPR009057Homeobox-like domain superfamilySUPERFAMILYSSF46689Homeodomain-likecoord: 367..439