Protein strawberry notch homolog 1

Overview
NameProtein strawberry notch homolog 1
Smed IDSMED30011792
Length (bp)4301
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein strawberry notch homolog 1 (SMED30011792) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein strawberry notch homolog 1 (SMED30011792) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein strawberry notch homolog 1 (SMED30011792) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein strawberry notch homolog 1 (SMED30011792) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30011792

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30011792h1SMcG0002007 SmedASXL_016687SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30011792h1SMcG0002007 SmedASXL_016687SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein strawberry notch homolog 1 vs. Ensembl Human
Match: SBNO1 (strawberry notch homolog 1 [Source:HGNC Symbol;Acc:HGNC:22973])

HSP 1 Score: 525.398 bits (1352), Expect = 1.428e-161
Identity = 259/441 (58.73%), Postives = 332/441 (75.28%), Query Frame = 3
Query:  627 VYSQYQPLKLRKGKVHPYXXXXXXXXXXXXXXXXRYCLSLPDGIIQNALLSNVQLEAVIYGCQRHEEILPTGERAGYLIGDGAGVGKGRTLAAIIYENYILHRKRAVWISVSNDLKHDAERDLCDLDANHIKIHPLNKMRYAKINSPENGNVRKGVLFSTYASLIGECQNMTKSKYKTRFRQIVQWFGTDYDGVIVFDECHKAKNLMPQGSQKKTKTAEIVLKLQETLPKARIVYASATGASEPRNMAYMTRLGLWGPGTPFKKFEDFVEKLEDK-VGAMELVAVDMKQRGMYIARQLSFANVTFRVHEVQLTNVKIGEHYFMNVYNESVDLWTRIFDNMNQALNTRFIAKKHAKTVWGQYWAAHQRFFKYLCMAGKVQECVRITMDAITQHKCVVIGLQSTGEAKTNEMLEDYGGEVTEFVSCARGILQSFVERFFPTEE 1946
             Y++Y P+KL+ G  HP  VVE+SSLSSV  P+V Y  S+ +  I N  LS +QLEA+ Y  Q+HE  LP G+RAG+LIGDGAGVGKGRT+A IIYENY+L RKRA+W SVSNDLK+DAERDL D+ A +I +H LNK +Y KI+S  NG+V+KGV+F+TY+SLIGE Q  +  KYKTR +Q++ W G D+DGVIVFDECHKAKNL P GS K TKT   VL+LQ  LPKAR+VYASATGASEPRNMAYM RLG+WG GTPF++F DF++ +E + VGAME+VA+DMK RGMYIARQLSF  VTF++ EV L+        ++ +YN++V LW    +   QA +     ++  K++WGQ+W+AHQRFFKYLC+A KV+  V++  + I   KCVVIGLQSTGEA+T E LE+ GGE+ +FVS A+G+LQS +E+ FP  +
Sbjct:  241 TYAEYMPIKLKIGLRHPDAVVETSSLSSVTPPDVWYKTSISEETIDNGWLSALQLEAITYAAQQHETFLPNGDRAGFLIGDGAGVGKGRTIAGIIYENYLLSRKRALWFSVSNDLKYDAERDLRDIGAKNILVHSLNKFKYGKISSKHNGSVKKGVIFATYSSLIGESQ--SGGKYKTRLKQLLHWCGDDFDGVIVFDECHKAKNLCPVGSSKPTKTGLAVLELQNKLPKARVVYASATGASEPRNMAYMNRLGIWGEGTPFREFSDFIQAVERRGVGAMEIVAMDMKLRGMYIARQLSFTGVTFKIEEVLLS------QSYVKMYNKAVKLWVIARERFQQAADLIDAEQRMKKSMWGQFWSAHQRFFKYLCIASKVKRVVQLAREEIKNGKCVVIGLQSTGEARTLEALEEGGGELNDFVSTAKGVLQSLIEKHFPAPD 673          

HSP 2 Score: 412.535 bits (1059), Expect = 1.266e-120
Identity = 222/520 (42.69%), Postives = 313/520 (60.19%), Query Frame = 3
Query: 2301 QRELLDSIDRLAPKLPINTLDDLIRELGGPDYVAEMSGRKGRMVMDVNTGDVSYQPRREDDVTLEQVNMVEKERFNTCQKLVAIISDAASTGISLHADKRYENSLQRVHITLELPWSADRAIQQFGRTHRSNQIYPPEYVFLISDLAGERRFASTVAKRLESLGALTHGDRRATETRDLSQFNIDNKFGRRALDSIFDTAFKSKSSLVPMPKGI------DLQAAFDSVGL-----------QPKDGKNVSKFLNRILGMRLEVQNGLFQYYTDTMDELIKQAKRNQEFDRGIIDLAKEDDNIFVEETQVFRMTFLGDDIKVQLHRVKNITGMSWRSALEVPRGGNNSLDGFYIT-KNETQRKIVLAVQKKDRHGTWFNVFSPNVGEQSNLIENKSLNEAFKKATLEEAERMWNDMYSVTENRCLHYFWYKHCNYSK---NCDTGCRSKIRYVLSGSIFYIWD-------IISAINKSPQLARVRLNDGSKIIGCIINPSHKERITEILANRESHPQQTI 3776
            +++LLD +++LA  LP NTLD+LI ELGGP+ VAEM+GRKGR+V + + G +SY+ R E DV +E +N+ EK+RF    K +AIIS+AAS+GISL AD+R +N  +RVH+TLELPWSADRAIQQFGRTHRSNQ+  PEYVFLIS+LAGE+RFAS VAKRLESLGALTHGDRRATE+RDLS+FN DNK+GR AL+ +  +     S +V  P         D++     VGL             KD  N+ KFLNRILGM +  QN LFQY+ DT+  +++ AK+N  +D GI+DL   D+ +   + + F          V+L+ +    GMSW  A ++        DGFY++ +    +K  + V++ +     F V+ PN G+Q  L     L + +KK   ++A   W D Y+ + + C H +W  +C  +     C+ G R +  YVL GS+  +W         +S  N   Q+ R+R  DG +I+G II  +    +  +L+  +   Q  +
Sbjct:  855 KKDLLDKLEKLAEDLPPNTLDELIDELGGPENVAEMTGRKGRVVSN-DDGSISYESRSELDVPVEILNITEKQRFMDGDKNIAIISEAASSGISLQADRRAKNQRRRVHMTLELPWSADRAIQQFGRTHRSNQVTAPEYVFLISELAGEQRFASIVAKRLESLGALTHGDRRATESRDLSRFNFDNKYGRNALEIVMKSIVNLDSPMVSPPPDYPGEFFKDVRQGLIGVGLINVEDRSGILTLDKDYNNIGKFLNRILGMEVHQQNALFQYFADTLTAVVQNAKKNGRYDMGILDLGSGDEKVRKSDVKKFLTPGYSTSGHVELYTISVERGMSWEEATKIWAELTGPDDGFYLSLQIRNNKKTAILVKEVNPKKKLFLVYRPNTGKQLKLEIYADLKKKYKKVVSDDALMHWLDQYNSSADTCTHAYWRGNCKKASLGLVCEIGLRCRTYYVLCGSVLSVWTKVEGVLASVSGTNVKMQIVRLRTEDGQRIVGLIIPANCVSPLVNLLSTSDQSQQLAV 1373          
BLAST of Protein strawberry notch homolog 1 vs. Ensembl Human
Match: SBNO1 (strawberry notch homolog 1 [Source:HGNC Symbol;Acc:HGNC:22973])

HSP 1 Score: 525.398 bits (1352), Expect = 1.428e-161
Identity = 259/441 (58.73%), Postives = 332/441 (75.28%), Query Frame = 3
Query:  627 VYSQYQPLKLRKGKVHPYXXXXXXXXXXXXXXXXRYCLSLPDGIIQNALLSNVQLEAVIYGCQRHEEILPTGERAGYLIGDGAGVGKGRTLAAIIYENYILHRKRAVWISVSNDLKHDAERDLCDLDANHIKIHPLNKMRYAKINSPENGNVRKGVLFSTYASLIGECQNMTKSKYKTRFRQIVQWFGTDYDGVIVFDECHKAKNLMPQGSQKKTKTAEIVLKLQETLPKARIVYASATGASEPRNMAYMTRLGLWGPGTPFKKFEDFVEKLEDK-VGAMELVAVDMKQRGMYIARQLSFANVTFRVHEVQLTNVKIGEHYFMNVYNESVDLWTRIFDNMNQALNTRFIAKKHAKTVWGQYWAAHQRFFKYLCMAGKVQECVRITMDAITQHKCVVIGLQSTGEAKTNEMLEDYGGEVTEFVSCARGILQSFVERFFPTEE 1946
             Y++Y P+KL+ G  HP  VVE+SSLSSV  P+V Y  S+ +  I N  LS +QLEA+ Y  Q+HE  LP G+RAG+LIGDGAGVGKGRT+A IIYENY+L RKRA+W SVSNDLK+DAERDL D+ A +I +H LNK +Y KI+S  NG+V+KGV+F+TY+SLIGE Q  +  KYKTR +Q++ W G D+DGVIVFDECHKAKNL P GS K TKT   VL+LQ  LPKAR+VYASATGASEPRNMAYM RLG+WG GTPF++F DF++ +E + VGAME+VA+DMK RGMYIARQLSF  VTF++ EV L+        ++ +YN++V LW    +   QA +     ++  K++WGQ+W+AHQRFFKYLC+A KV+  V++  + I   KCVVIGLQSTGEA+T E LE+ GGE+ +FVS A+G+LQS +E+ FP  +
Sbjct:  241 TYAEYMPIKLKIGLRHPDAVVETSSLSSVTPPDVWYKTSISEETIDNGWLSALQLEAITYAAQQHETFLPNGDRAGFLIGDGAGVGKGRTIAGIIYENYLLSRKRALWFSVSNDLKYDAERDLRDIGAKNILVHSLNKFKYGKISSKHNGSVKKGVIFATYSSLIGESQ--SGGKYKTRLKQLLHWCGDDFDGVIVFDECHKAKNLCPVGSSKPTKTGLAVLELQNKLPKARVVYASATGASEPRNMAYMNRLGIWGEGTPFREFSDFIQAVERRGVGAMEIVAMDMKLRGMYIARQLSFTGVTFKIEEVLLS------QSYVKMYNKAVKLWVIARERFQQAADLIDAEQRMKKSMWGQFWSAHQRFFKYLCIASKVKRVVQLAREEIKNGKCVVIGLQSTGEARTLEALEEGGGELNDFVSTAKGVLQSLIEKHFPAPD 673          

HSP 2 Score: 412.535 bits (1059), Expect = 1.266e-120
Identity = 222/520 (42.69%), Postives = 313/520 (60.19%), Query Frame = 3
Query: 2301 QRELLDSIDRLAPKLPINTLDDLIRELGGPDYVAEMSGRKGRMVMDVNTGDVSYQPRREDDVTLEQVNMVEKERFNTCQKLVAIISDAASTGISLHADKRYENSLQRVHITLELPWSADRAIQQFGRTHRSNQIYPPEYVFLISDLAGERRFASTVAKRLESLGALTHGDRRATETRDLSQFNIDNKFGRRALDSIFDTAFKSKSSLVPMPKGI------DLQAAFDSVGL-----------QPKDGKNVSKFLNRILGMRLEVQNGLFQYYTDTMDELIKQAKRNQEFDRGIIDLAKEDDNIFVEETQVFRMTFLGDDIKVQLHRVKNITGMSWRSALEVPRGGNNSLDGFYIT-KNETQRKIVLAVQKKDRHGTWFNVFSPNVGEQSNLIENKSLNEAFKKATLEEAERMWNDMYSVTENRCLHYFWYKHCNYSK---NCDTGCRSKIRYVLSGSIFYIWD-------IISAINKSPQLARVRLNDGSKIIGCIINPSHKERITEILANRESHPQQTI 3776
            +++LLD +++LA  LP NTLD+LI ELGGP+ VAEM+GRKGR+V + + G +SY+ R E DV +E +N+ EK+RF    K +AIIS+AAS+GISL AD+R +N  +RVH+TLELPWSADRAIQQFGRTHRSNQ+  PEYVFLIS+LAGE+RFAS VAKRLESLGALTHGDRRATE+RDLS+FN DNK+GR AL+ +  +     S +V  P         D++     VGL             KD  N+ KFLNRILGM +  QN LFQY+ DT+  +++ AK+N  +D GI+DL   D+ +   + + F          V+L+ +    GMSW  A ++        DGFY++ +    +K  + V++ +     F V+ PN G+Q  L     L + +KK   ++A   W D Y+ + + C H +W  +C  +     C+ G R +  YVL GS+  +W         +S  N   Q+ R+R  DG +I+G II  +    +  +L+  +   Q  +
Sbjct:  855 KKDLLDKLEKLAEDLPPNTLDELIDELGGPENVAEMTGRKGRVVSN-DDGSISYESRSELDVPVEILNITEKQRFMDGDKNIAIISEAASSGISLQADRRAKNQRRRVHMTLELPWSADRAIQQFGRTHRSNQVTAPEYVFLISELAGEQRFASIVAKRLESLGALTHGDRRATESRDLSRFNFDNKYGRNALEIVMKSIVNLDSPMVSPPPDYPGEFFKDVRQGLIGVGLINVEDRSGILTLDKDYNNIGKFLNRILGMEVHQQNALFQYFADTLTAVVQNAKKNGRYDMGILDLGSGDEKVRKSDVKKFLTPGYSTSGHVELYTISVERGMSWEEATKIWAELTGPDDGFYLSLQIRNNKKTAILVKEVNPKKKLFLVYRPNTGKQLKLEIYADLKKKYKKVVSDDALMHWLDQYNSSADTCTHAYWRGNCKKASLGLVCEIGLRCRTYYVLCGSVLSVWTKVEGVLASVSGTNVKMQIVRLRTEDGQRIVGLIIPANCVSPLVNLLSTSDQSQQLAV 1373          
BLAST of Protein strawberry notch homolog 1 vs. Ensembl Human
Match: SBNO1 (strawberry notch homolog 1 [Source:HGNC Symbol;Acc:HGNC:22973])

HSP 1 Score: 525.398 bits (1352), Expect = 1.428e-161
Identity = 259/440 (58.86%), Postives = 332/440 (75.45%), Query Frame = 3
Query:  630 YSQYQPLKLRKGKVHPYXXXXXXXXXXXXXXXXRYCLSLPDGIIQNALLSNVQLEAVIYGCQRHEEILPTGERAGYLIGDGAGVGKGRTLAAIIYENYILHRKRAVWISVSNDLKHDAERDLCDLDANHIKIHPLNKMRYAKINSPENGNVRKGVLFSTYASLIGECQNMTKSKYKTRFRQIVQWFGTDYDGVIVFDECHKAKNLMPQGSQKKTKTAEIVLKLQETLPKARIVYASATGASEPRNMAYMTRLGLWGPGTPFKKFEDFVEKLEDK-VGAMELVAVDMKQRGMYIARQLSFANVTFRVHEVQLTNVKIGEHYFMNVYNESVDLWTRIFDNMNQALNTRFIAKKHAKTVWGQYWAAHQRFFKYLCMAGKVQECVRITMDAITQHKCVVIGLQSTGEAKTNEMLEDYGGEVTEFVSCARGILQSFVERFFPTEE 1946
            Y++Y P+KL+ G  HP  VVE+SSLSSV  P+V Y  S+ +  I N  LS +QLEA+ Y  Q+HE  LP G+RAG+LIGDGAGVGKGRT+A IIYENY+L RKRA+W SVSNDLK+DAERDL D+ A +I +H LNK +Y KI+S  NG+V+KGV+F+TY+SLIGE Q  +  KYKTR +Q++ W G D+DGVIVFDECHKAKNL P GS K TKT   VL+LQ  LPKAR+VYASATGASEPRNMAYM RLG+WG GTPF++F DF++ +E + VGAME+VA+DMK RGMYIARQLSF  VTF++ EV L+        ++ +YN++V LW    +   QA +     ++  K++WGQ+W+AHQRFFKYLC+A KV+  V++  + I   KCVVIGLQSTGEA+T E LE+ GGE+ +FVS A+G+LQS +E+ FP  +
Sbjct:  241 YAEYMPIKLKIGLRHPDAVVETSSLSSVTPPDVWYKTSISEETIDNGWLSALQLEAITYAAQQHETFLPNGDRAGFLIGDGAGVGKGRTIAGIIYENYLLSRKRALWFSVSNDLKYDAERDLRDIGAKNILVHSLNKFKYGKISSKHNGSVKKGVIFATYSSLIGESQ--SGGKYKTRLKQLLHWCGDDFDGVIVFDECHKAKNLCPVGSSKPTKTGLAVLELQNKLPKARVVYASATGASEPRNMAYMNRLGIWGEGTPFREFSDFIQAVERRGVGAMEIVAMDMKLRGMYIARQLSFTGVTFKIEEVLLS------QSYVKMYNKAVKLWVIARERFQQAADLIDAEQRMKKSMWGQFWSAHQRFFKYLCIASKVKRVVQLAREEIKNGKCVVIGLQSTGEARTLEALEEGGGELNDFVSTAKGVLQSLIEKHFPAPD 672          

HSP 2 Score: 412.535 bits (1059), Expect = 1.285e-120
Identity = 222/520 (42.69%), Postives = 313/520 (60.19%), Query Frame = 3
Query: 2301 QRELLDSIDRLAPKLPINTLDDLIRELGGPDYVAEMSGRKGRMVMDVNTGDVSYQPRREDDVTLEQVNMVEKERFNTCQKLVAIISDAASTGISLHADKRYENSLQRVHITLELPWSADRAIQQFGRTHRSNQIYPPEYVFLISDLAGERRFASTVAKRLESLGALTHGDRRATETRDLSQFNIDNKFGRRALDSIFDTAFKSKSSLVPMPKGI------DLQAAFDSVGL-----------QPKDGKNVSKFLNRILGMRLEVQNGLFQYYTDTMDELIKQAKRNQEFDRGIIDLAKEDDNIFVEETQVFRMTFLGDDIKVQLHRVKNITGMSWRSALEVPRGGNNSLDGFYIT-KNETQRKIVLAVQKKDRHGTWFNVFSPNVGEQSNLIENKSLNEAFKKATLEEAERMWNDMYSVTENRCLHYFWYKHCNYSK---NCDTGCRSKIRYVLSGSIFYIWD-------IISAINKSPQLARVRLNDGSKIIGCIINPSHKERITEILANRESHPQQTI 3776
            +++LLD +++LA  LP NTLD+LI ELGGP+ VAEM+GRKGR+V + + G +SY+ R E DV +E +N+ EK+RF    K +AIIS+AAS+GISL AD+R +N  +RVH+TLELPWSADRAIQQFGRTHRSNQ+  PEYVFLIS+LAGE+RFAS VAKRLESLGALTHGDRRATE+RDLS+FN DNK+GR AL+ +  +     S +V  P         D++     VGL             KD  N+ KFLNRILGM +  QN LFQY+ DT+  +++ AK+N  +D GI+DL   D+ +   + + F          V+L+ +    GMSW  A ++        DGFY++ +    +K  + V++ +     F V+ PN G+Q  L     L + +KK   ++A   W D Y+ + + C H +W  +C  +     C+ G R +  YVL GS+  +W         +S  N   Q+ R+R  DG +I+G II  +    +  +L+  +   Q  +
Sbjct:  854 KKDLLDKLEKLAEDLPPNTLDELIDELGGPENVAEMTGRKGRVVSN-DDGSISYESRSELDVPVEILNITEKQRFMDGDKNIAIISEAASSGISLQADRRAKNQRRRVHMTLELPWSADRAIQQFGRTHRSNQVTAPEYVFLISELAGEQRFASIVAKRLESLGALTHGDRRATESRDLSRFNFDNKYGRNALEIVMKSIVNLDSPMVSPPPDYPGEFFKDVRQGLIGVGLINVEDRSGILTLDKDYNNIGKFLNRILGMEVHQQNALFQYFADTLTAVVQNAKKNGRYDMGILDLGSGDEKVRKSDVKKFLTPGYSTSGHVELYTISVERGMSWEEATKIWAELTGPDDGFYLSLQIRNNKKTAILVKEVNPKKKLFLVYRPNTGKQLKLEIYADLKKKYKKVVSDDALMHWLDQYNSSADTCTHAYWRGNCKKASLGLVCEIGLRCRTYYVLCGSVLSVWTKVEGVLASVSGTNVKMQIVRLRTEDGQRIVGLIIPANCVSPLVNLLSTSDQSQQLAV 1372          
BLAST of Protein strawberry notch homolog 1 vs. Ensembl Human
Match: SBNO2 (strawberry notch homolog 2 [Source:HGNC Symbol;Acc:HGNC:29158])

HSP 1 Score: 442.965 bits (1138), Expect = 3.496e-132
Identity = 231/439 (52.62%), Postives = 307/439 (69.93%), Query Frame = 3
Query:  627 VYSQYQPLKLRKGKVHPYXXXXXXXXXXXXXXXXRYCLSLPDGIIQNALLSNVQLEAVIYGCQRHEEILPTGERAGYLIGDGAGVGKGRTLAAIIYENYILHRKRAVWISVSNDLKHDAERDLCDLDANHIKIHPLNKMRYAKINSPENGNVRKGVLFSTYASLIGECQNMTKSKYKTRFRQIVQWFGTDYDGVIVFDECHKAKNLMPQGSQKKTKTAEIVLKLQETLPKARIVYASATGASEPRNMAYMTRLGLWGPGTPFKKFEDFVEKLEDK-VGAMELVAVDMKQRGMYIARQLSFANVTFRVHEVQLTNVKIGEHYFMNVYNESVDLWTRIFDNMNQALNTRFIAKKHAKTVWGQYWAAHQRFFKYLCMAGKVQECVRITMDAITQHKCVVIGLQSTGEAKTNEMLEDYGGEVTEFVSCARGILQSFVERFFPT 1940
             Y+ Y P K + GK HP  VVE+S+LSSV  P++ Y L+LP     +  LS +QLEA+ Y CQ+HE +LP+G+RAG+LIGDGAGVGKGRT+A +I EN++  RK+A+W SVSNDLK+DAERDL D++A  I +H L+K++Y    + E      GVLF+TY++LIGE Q     +++TR RQI+ W G  ++GVIVFDECHKAKN    GS   TK  + VL LQ  LP AR+VYASATGASEPRNM YM+RLG+WG GTPF+ FE+F+  +E + VGAME+VA+DMK  GMYIARQLSF+ VTFR+ E+ L         F  VYN +  LW    +   QA +  +I  +  K++WGQ+W+AHQRFFKYLC+A KV+  V +  + + + KCVVIGLQSTGEA+T E+L +  G +  FVS A G+  S +++ FP+
Sbjct:  144 TYADYVPSKSKIGKQHPDRVVETSTLSSVPPPDITYTLALPS---DSGALSALQLEAITYACQQHEVLLPSGQRAGFLIGDGAGVGKGRTVAGVILENHLRGRKKALWFSVSNDLKYDAERDLRDIEATGIAVHALSKIKYGDTTTSE------GVLFATYSALIGESQ--AGGQHRTRLRQILDWCGEAFEGVIVFDECHKAKN---AGS---TKMGKAVLDLQNKLPLARVVYASATGASEPRNMIYMSRLGIWGEGTPFRNFEEFLHAIEKRGVGAMEIVAMDMKVSGMYIARQLSFSGVTFRIEEIPLAPA------FECVYNRAALLWAEALNVFQQAAD--WIGLESRKSLWGQFWSAHQRFFKYLCIAAKVRRLVELAREELARDKCVVIGLQSTGEARTREVLGENDGHLNCFVSAAEGVFLSLIQKHFPS 557          

HSP 2 Score: 408.683 bits (1049), Expect = 8.514e-120
Identity = 221/509 (43.42%), Postives = 316/509 (62.08%), Query Frame = 3
Query: 2301 QRELLDSIDRLAPKLPINTLDDLIRELGGPDYVAEMSGRKGRMVMDVNTGDVSYQPRREDDVTLEQVNMVEKERFNTCQKLVAIISDAASTGISLHADKRYENSLQRVHITLELPWSADRAIQQFGRTHRSNQIYPPEYVFLISDLAGERRFASTVAKRLESLGALTHGDRRATETRDLSQFNIDNKFGRRALDSIFDTAFKSKSSLVPMPKGI---------DLQAAFDSVGLQPKDGKN----------VSKFLNRILGMRLEVQNGLFQYYTDTMDELIKQAKRNQEFDRGIIDLAKEDDNIFVEETQVFRMTFLGDDIKVQLHRVKNITGMSWRSALEVPRGGNNSLDGFYITKNETQRKIVLAVQKKDRHGTWFNVFSPNVGEQSNLIENKSLNEAFKKATLEEAERMWNDMYSVTENRCLHYFWYKHCNYS---KNCDTGCRSKIRYVLSGSIFYIWDIISAI------NKSPQLARVRLNDGSKIIGCIINPSHKERITEIL 3743
            +++LLD + RL  +LP+NTLD+LI +LGGP  VAEM+GRKGR+V   + G V+++ R E  ++++ VN+ EK+RF + +KLVAIIS+A+S+G+SL AD+R +N  +RVH+TLELPWSADRAIQQFGRTHRSNQ+  PEYVFLIS+LAGERRFAS VAKRLESLGALTHGDRRATE+RDLS++N +NK+G RAL  +  T      + VP+P+G          D++    SVG+  ++ +N          ++KFLNRILG+ +  QN LFQY++DT D LI+  KR  ++D GI+DLA   + I+ E  QVF       D +V  +++    G+ W  A           DGFY++      K    + +++R G +F V+ PN+G QS L    SL   F + T EEA+  W   Y+++   C H  W +HC  +   K+C  G R +  Y+L G++  +W  I+A+      +   Q+ R++  D  K +G  I      R+ + L
Sbjct:  658 KQDLLDKVRRLGRELPVNTLDELIDQLGGPQRVAEMTGRKGRVVSRPD-GTVAFESRAEQGLSIDHVNLREKQRFMSGEKLVAIISEASSSGVSLQADRRVQNQRRRVHMTLELPWSADRAIQQFGRTHRSNQVSAPEYVFLISELAGERRFASIVAKRLESLGALTHGDRRATESRDLSKYNFENKYGTRALHCVLTTILSQTENKVPVPQGYPGGVPTFFRDMKQGLLSVGIGGRESRNGCLDVEKDCSITKFLNRILGLEVHKQNALFQYFSDTFDHLIEMDKREGKYDMGILDLAPGIEEIYEESQQVFLAPGHPQDGQVVFYKISVDRGLKWEDAFAKSLALTGPYDGFYLSYKVRGNKPSCLLAEQNR-GQFFTVYKPNIGRQSQLEALDSLRRKFHRVTAEEAKEPWESGYALSLTHCSHSAWNRHCRLAQEGKDCLQGLRLRHHYMLCGALLRVWGRIAAVMADVSSSSYLQIVRLKTKDRKKQVGIKIPEGCVRRVLQEL 1164          
BLAST of Protein strawberry notch homolog 1 vs. Ensembl Human
Match: SBNO2 (strawberry notch homolog 2 [Source:HGNC Symbol;Acc:HGNC:29158])

HSP 1 Score: 442.965 bits (1138), Expect = 3.496e-132
Identity = 231/439 (52.62%), Postives = 307/439 (69.93%), Query Frame = 3
Query:  627 VYSQYQPLKLRKGKVHPYXXXXXXXXXXXXXXXXRYCLSLPDGIIQNALLSNVQLEAVIYGCQRHEEILPTGERAGYLIGDGAGVGKGRTLAAIIYENYILHRKRAVWISVSNDLKHDAERDLCDLDANHIKIHPLNKMRYAKINSPENGNVRKGVLFSTYASLIGECQNMTKSKYKTRFRQIVQWFGTDYDGVIVFDECHKAKNLMPQGSQKKTKTAEIVLKLQETLPKARIVYASATGASEPRNMAYMTRLGLWGPGTPFKKFEDFVEKLEDK-VGAMELVAVDMKQRGMYIARQLSFANVTFRVHEVQLTNVKIGEHYFMNVYNESVDLWTRIFDNMNQALNTRFIAKKHAKTVWGQYWAAHQRFFKYLCMAGKVQECVRITMDAITQHKCVVIGLQSTGEAKTNEMLEDYGGEVTEFVSCARGILQSFVERFFPT 1940
             Y+ Y P K + GK HP  VVE+S+LSSV  P++ Y L+LP     +  LS +QLEA+ Y CQ+HE +LP+G+RAG+LIGDGAGVGKGRT+A +I EN++  RK+A+W SVSNDLK+DAERDL D++A  I +H L+K++Y    + E      GVLF+TY++LIGE Q     +++TR RQI+ W G  ++GVIVFDECHKAKN    GS   TK  + VL LQ  LP AR+VYASATGASEPRNM YM+RLG+WG GTPF+ FE+F+  +E + VGAME+VA+DMK  GMYIARQLSF+ VTFR+ E+ L         F  VYN +  LW    +   QA +  +I  +  K++WGQ+W+AHQRFFKYLC+A KV+  V +  + + + KCVVIGLQSTGEA+T E+L +  G +  FVS A G+  S +++ FP+
Sbjct:  144 TYADYVPSKSKIGKQHPDRVVETSTLSSVPPPDITYTLALPS---DSGALSALQLEAITYACQQHEVLLPSGQRAGFLIGDGAGVGKGRTVAGVILENHLRGRKKALWFSVSNDLKYDAERDLRDIEATGIAVHALSKIKYGDTTTSE------GVLFATYSALIGESQ--AGGQHRTRLRQILDWCGEAFEGVIVFDECHKAKN---AGS---TKMGKAVLDLQNKLPLARVVYASATGASEPRNMIYMSRLGIWGEGTPFRNFEEFLHAIEKRGVGAMEIVAMDMKVSGMYIARQLSFSGVTFRIEEIPLAPA------FECVYNRAALLWAEALNVFQQAAD--WIGLESRKSLWGQFWSAHQRFFKYLCIAAKVRRLVELAREELARDKCVVIGLQSTGEARTREVLGENDGHLNCFVSAAEGVFLSLIQKHFPS 557          

HSP 2 Score: 408.683 bits (1049), Expect = 8.514e-120
Identity = 221/509 (43.42%), Postives = 316/509 (62.08%), Query Frame = 3
Query: 2301 QRELLDSIDRLAPKLPINTLDDLIRELGGPDYVAEMSGRKGRMVMDVNTGDVSYQPRREDDVTLEQVNMVEKERFNTCQKLVAIISDAASTGISLHADKRYENSLQRVHITLELPWSADRAIQQFGRTHRSNQIYPPEYVFLISDLAGERRFASTVAKRLESLGALTHGDRRATETRDLSQFNIDNKFGRRALDSIFDTAFKSKSSLVPMPKGI---------DLQAAFDSVGLQPKDGKN----------VSKFLNRILGMRLEVQNGLFQYYTDTMDELIKQAKRNQEFDRGIIDLAKEDDNIFVEETQVFRMTFLGDDIKVQLHRVKNITGMSWRSALEVPRGGNNSLDGFYITKNETQRKIVLAVQKKDRHGTWFNVFSPNVGEQSNLIENKSLNEAFKKATLEEAERMWNDMYSVTENRCLHYFWYKHCNYS---KNCDTGCRSKIRYVLSGSIFYIWDIISAI------NKSPQLARVRLNDGSKIIGCIINPSHKERITEIL 3743
            +++LLD + RL  +LP+NTLD+LI +LGGP  VAEM+GRKGR+V   + G V+++ R E  ++++ VN+ EK+RF + +KLVAIIS+A+S+G+SL AD+R +N  +RVH+TLELPWSADRAIQQFGRTHRSNQ+  PEYVFLIS+LAGERRFAS VAKRLESLGALTHGDRRATE+RDLS++N +NK+G RAL  +  T      + VP+P+G          D++    SVG+  ++ +N          ++KFLNRILG+ +  QN LFQY++DT D LI+  KR  ++D GI+DLA   + I+ E  QVF       D +V  +++    G+ W  A           DGFY++      K    + +++R G +F V+ PN+G QS L    SL   F + T EEA+  W   Y+++   C H  W +HC  +   K+C  G R +  Y+L G++  +W  I+A+      +   Q+ R++  D  K +G  I      R+ + L
Sbjct:  658 KQDLLDKVRRLGRELPVNTLDELIDQLGGPQRVAEMTGRKGRVVSRPD-GTVAFESRAEQGLSIDHVNLREKQRFMSGEKLVAIISEASSSGVSLQADRRVQNQRRRVHMTLELPWSADRAIQQFGRTHRSNQVSAPEYVFLISELAGERRFASIVAKRLESLGALTHGDRRATESRDLSKYNFENKYGTRALHCVLTTILSQTENKVPVPQGYPGGVPTFFRDMKQGLLSVGIGGRESRNGCLDVEKDCSITKFLNRILGLEVHKQNALFQYFSDTFDHLIEMDKREGKYDMGILDLAPGIEEIYEESQQVFLAPGHPQDGQVVFYKISVDRGLKWEDAFAKSLALTGPYDGFYLSYKVRGNKPSCLLAEQNR-GQFFTVYKPNIGRQSQLEALDSLRRKFHRVTAEEAKEPWESGYALSLTHCSHSAWNRHCRLAQEGKDCLQGLRLRHHYMLCGALLRVWGRIAAVMADVSSSSYLQIVRLKTKDRKKQVGIKIPEGCVRRVLQEL 1164          
BLAST of Protein strawberry notch homolog 1 vs. Ensembl Celegans
Match: let-765 (Notch signaling pathway homolog-1 [Source:UniProtKB/TrEMBL;Acc:O01737])

HSP 1 Score: 521.546 bits (1342), Expect = 3.086e-157
Identity = 255/451 (56.54%), Postives = 334/451 (74.06%), Query Frame = 3
Query:  627 VYSQYQPLKLRKGKVHPYXXXXXXXXXXXXXXXXRYCLSLPDGIIQNALLSNVQLEAVIYGCQRHEEILPTGERAGYLIGDGAGVGKGRTLAAIIYENYILHRKRAVWISVSNDLKHDAERDLCDLDANHIKIHPLNKMRYAKINSPENGNVRKGVLFSTYASLIGECQNMTKSKYKTRFRQIVQWFGTDYDGVIVFDECHKAKNLMPQGSQKKTKTAEIVLKLQETLPKARIVYASATGASEPRNMAYMTRLGLWGPGTPFKKFEDFVEKLEDK-VGAMELVAVDMKQRGMYIARQLSFANVTFRVHEVQLTNVKIGEHYFMNVYNESVDLWT---RIFDNMNQALNTRFIAKKHAKTVWGQYWAAHQRFFKYLCMAGKVQECVRITMDAITQHKCVVIGLQSTGEAKTNEMLEDYGGEVTEFVSCARGILQSFVERFFPTEENINQMDK 1967
             YS+Y P KLR G  HP  VVES+SLSSV  P+V+Y +S+P+ +I    +S +QLEAVIY CQ HE  +P+GER GYLIGDGAGVGKGRT+A II+ENY+  RKRA+W+SVS+DLK DAERDL D  A +I ++ LNKM+YAKI+  ENG+++KGV+F+TY SLIGEC+     KY++R  Q++QWFG DYDGVI+ DECH+AKNL+P    K TKT  +VL+LQ+ LP AR+VYASATGA+EPRNMAYMTRLGLWG    F +F DF+  +E + VGAME+VA+DMKQRG+Y+ARQLSF  V+F V EVQL++       F+ +Y+ +V LW    R F  + + ++     +   KTVWGQ+WA HQRFFKYLC+A KV  CV+++ +AI   KCVVIGLQSTGE+ T E LE+ GGE+ EFVS A+ +L   +++ FPT+ + +  D+
Sbjct:  615 TYSEYTPAKLRSGMAHPDSVVESASLSSVSPPDVKYQISIPEYLIDMGHISALQLEAVIYACQMHERRMPSGERYGYLIGDGAGVGKGRTVACIIFENYLQGRKRAIWLSVSSDLKFDAERDLRDCGAPNIPVYALNKMKYAKISGKENGSIKKGVMFATYTSLIGECRGAKSRKYRSRISQLIQWFGQDYDGVIILDECHRAKNLVPTAGAKPTKTGRMVLELQKALPNARVVYASATGATEPRNMAYMTRLGLWGERQAFPEFHDFISAVERRGVGAMEIVAMDMKQRGLYLARQLSFRGVSFAVQEVQLSS------EFVKMYDAAVKLWMEARRQFQTVIETMDEE--ERSTCKTVWGQFWACHQRFFKYLCIAAKVDTCVQLSREAIKAKKCVVIGLQSTGESATLETLEEMGGELNEFVSTAKTVLYGLIDKHFPTDASFSMGDR 1057          

HSP 2 Score: 432.95 bits (1112), Expect = 4.065e-126
Identity = 234/533 (43.90%), Postives = 327/533 (61.35%), Query Frame = 3
Query: 2280 DVSCRITQRELLDSIDRLAPKLPINTLDDLIRELGGPDYVAEMSGRKGRMVMDVNTGDVSYQPRRED-DVTLEQVNMVEKERFNTCQKLVAIISDAASTGISLHADKRYENSLQRVHITLELPWSADRAIQQFGRTHRSNQIYPPEYVFLISDLAGERRFASTVAKRLESLGALTHGDRRATETRDLSQFNIDNKFGRRALDSIFDTAF-KSKSSLVPMPKGI-------DLQAAFDSVGLQP----------KDGKNVSKFLNRILGMRLEVQNGLFQYYTDTMDELIKQAKRNQEFDRGIIDLAKEDDNIFVEETQVFRMTFLGDDIKVQLHRVKNITGMSWRSALEVPRGGNNSLDGFYIT----KNETQRKIVLAVQ------KKDRHGTWFNVFSPNVGEQSNLIENKSLNEAFKKATLEEAERMWNDMYSVTENRCLHYFWYKHCNYSKN---CDTGCRSKIRYVLSGSIFYIWDIISAI-------NKSPQLARVRLNDGSKIIGCIINPSHKERITEILANRESH 3761
            D++  + + ELL +++RLAP LP NTLD LI E+GGP+YVAEM+GR+G MV    TGDV YQ R  + +V+LE +NM EKE+F   +KL+AIIS+AAS+GISL +D+R  N  +RVHITLELPWSAD+AIQQFGRTHRSNQ+  PEYVFLIS+LAGE+RFAS VAKRLESLGALTHGDRRATETRDLSQFN+DNK+GR ALD++  T   ++ + L+  PK         D++   + VGL            K+   + KFLNRILG+ +  QN LF Y+++ + ELI Q+K +  +D GI+DL   DD +   ET+VF         +V++H++    G+SW  A+E+ +  +N  DGFYI      N    K V A+       + D     + +  P+ G    L+    L++ F K +++EA+ +W   Y    N C H + Y  C    N   C+ G R++  +VLSGS+  +W I+  +       +   Q+ RVR     KI+G ++ P+H   + + L   E+H
Sbjct: 1328 DINPMLIKTELLAAVERLAPSLPANTLDQLIDEMGGPEYVAEMTGRRGHMVTS-ETGDVMYQRRNANAEVSLELINMEEKEKFMRGEKLIAIISEAASSGISLQSDRRAINKRRRVHITLELPWSADKAIQQFGRTHRSNQVSGPEYVFLISELAGEKRFASIVAKRLESLGALTHGDRRATETRDLSQFNMDNKYGRVALDTLLKTVIGQAGTPLIDPPKDYKAGEFFEDMRLYMEGVGLLAKNKTGQYTIEKEAATIPKFLNRILGLPVHAQNSLFHYFSEIVAELIAQSKHDGTYDTGIMDLGTGDDQVRKLETRVFTGRVDNGSFRVEIHKIGVERGVSWEEAMELHKEHSNDDDGFYICHPGGANTANTKKVAALVYGIGKIRMDNGARLYAITRPSTGRSPKLMTMADLSKRFHKVSIDEAKEVWKQQYDSAANMCQHNYVYGKCRTESNGTYCEVGRRTRTYFVLSGSVLSVWPIVEEVLAGSDRKSSRMQVIRVRTEQDQKIVGLLVLPTHVRHLVQQL---ETH 1856          
BLAST of Protein strawberry notch homolog 1 vs. Ensembl Fly
Match: CG3491 (gene:FBgn0028887 transcript:FBtr0080675)

HSP 1 Score: 831.632 bits (2147), Expect = 0.000e+0
Identity = 487/1081 (45.05%), Postives = 645/1081 (59.67%), Query Frame = 3
Query:  627 VYSQYQPLKLRKGKVHPYXXXXXXXXXXXXXXXXRYCLSLPDGIIQNALLSNVQLEAVIYGCQRHEEILPTGERAGYLIGDGAGVGKGRTLAAIIYENYILHRKRAVWISVSNDLKHDAERDLCDLDANH-IKIHPLNKMRYAKINSPENGNVRKGVLFSTYASLIGECQNMTKSKYKTRFRQIVQWFGTDYDGVIVFDECHKAKNLMPQGSQKKTKTAEIVLKLQETLPKARIVYASATGASEPRNMAYMTRLGLWGPGTPFKKFEDFVEKLEDK-VGAMELVAVDMKQRGMYIARQLSFANVTFRVHEVQLTNVKIGEHYFMNVYNESVDLWTRIFDNMNQALNTRFIAKKHAKTVWGQYWAAHQRFFKYLCMAGKVQECVRITMDAITQHKCVVIGLQSTGEAKTNEMLEDYGGEVTEFVSCARGILQSFVERFFPTEENINQMDKREDKTKTQNSKTNRKKGSSKKPISLQDALGKDFLEKVTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIM------MEDFSRSYENNSMKTGADVSCRITQRE----------LLDSIDRLAPKLPINTLDDLIRELGGPDYVAEMSGRKGRMVMDVNTGDVSYQPRREDDVTLEQVNMVEKERFNTCQKLVAIISDAASTGISLHADKRYENSLQRVHITLELPWSADRAIQQFGRTHRSNQIYPPEYVFLISDLAGERRFASTVAKRLESLGALTHGDRRATETRDLSQFNIDNKFGRRALDSIFDTAFKSKS---SLVPMP-KG---IDLQAAFDSVGL-------------QPKDGKNVSKFLNRILGMRLEVQNGLFQYYTDTMDELIKQAKRNQEFDRGIIDLAKEDDNIFVEETQVFRMTFLGDDIKVQLHRVKNITGMSWRSALEVPRG-GNNSLDGFYITKNETQRK--IVLAVQKKDRHGTWFN------VFSPNVGEQSNLIENKSLNEAFKKATLEEAERMWNDMYSVTENRCLHYFWYKHCNYSKNCDTGCRSKIRYVLSGSIFYIWDIISAI----NKSPQLARVRLNDGSKIIGCIINPS 3716
             ++ Y P KL+ G+ HP PVVE+++LSSVE+PN+ Y L+LP    +   LS +QLEAV+Y CQ HE+ILP+G+RAG+L+GDGAGVGKGRT+A II++NY+  RKRA+W+SVS+DLK DAERDL D+ A+  I++  +NK +Y+ I+S EN N ++GV+F TY +LIGE    T SKYKTRFRQ+  W G  ++GVIVFDECHKAKNL      K TKT   VL LQ+ LP AR+VYASATGASEPRNMAYM RLGLWGPGT + +F +FV  +E + +GAME+VA+DMK RG YIARQLSF +V+FR+ EV ++        F   YN S +LW  I     +A     +  +  K +  Q+W AHQRFFK LC+A KV   V++T  A    K VVIGLQSTGE++T E LE + G++  FVS A+ I+QSFVE+ FP         KR+      N+     +  S+ P   +  +  D++E   +  A       +  S  +     +   +++    K +  +       I+      M +     E+ +      V   IT+R+          LL+ ID L  KLP NTLD LI ELGG + VAEM+GR+GR+V     G   Y+PR E+D T++ VN  EK+RF    K VAIIS+AAS+GISL +DKR  N  +R+HITLELPWSADRAIQQFGRTHRSNQ+  PEYVF+I+DLAGERRFASTVAKRLESLGALT GDRRAT+ RDLSQFNIDN  GR AL+++      +K    S VP   KG    D   A   VG+               KD  N+SKFLNRILG R+EVQN LF+++ D M  LI Q KR   FD GI+DL     ++   +   F           +LH V    GMS+ +AL   R  G    +GFYI +   Q K   +L +Q         N      ++ PN G Q  L  + S++  + K + EEA+  W   Y +  N C H +W + C     C+ G R +  +VLSG +  IWD I  I        Q+ R++ +   KI+G ++ P+
Sbjct:  720 TFAAYWPSKLKFGRAHPDPVVETATLSSVELPNINYQLALPSKTTE--CLSALQLEAVVYACQAHEQILPSGDRAGFLLGDGAGVGKGRTIAGIIFDNYLKGRKRALWVSVSSDLKFDAERDLADIGAHEKIRVATINKFKYSPIDSEENENFKRGVIFCTYTALIGESMT-TNSKYKTRFRQLTNWLGKKFEGVIVFDECHKAKNLSLMNVGKSTKTGTTVLDLQKLLPNARVVYASATGASEPRNMAYMVRLGLWGPGTAYPEFYEFVNAVEKRGIGAMEIVAMDMKLRGTYIARQLSFKDVSFRIEEVNMSK------EFRKSYNLSAELWADIHKKFQKACRLMCVENRVQKIITCQFWCAHQRFFKNLCIASKVNHVVKMTRQATRMGKAVVIGLQSTGESRTLEHLERHHGKLNSFVSTAKMIIQSFVEKHFPAP-------KRDSFHHLLNTGEFEPEARSRPPKQKKSKMNTDWVEDDMDAEAGESDIEMYERSCTAAVEKIKSGQKRRGRPPKADKVEKITMQERILEHLCNNMREQDNEDESTNTSDNTKVKVNITERDVERCINMREMLLEKIDVLGRKLPPNTLDKLISELGGTNLVAEMTGRRGRVVRTEYDG-YKYEPRCENDSTMDLVNYREKQRFMDGSKHVAIISEAASSGISLQSDKRVSNQRRRLHITLELPWSADRAIQQFGRTHRSNQVNAPEYVFVITDLAGERRFASTVAKRLESLGALTQGDRRATDARDLSQFNIDNSIGRSALENVMQQLTSNKPLDRSQVPQSYKGNFIYDCCVAMAGVGMINVREENKVKVFTVEKDSNNISKFLNRILGCRVEVQNALFKFFLDKMYSLIMQMKRTGRFDLGILDLDAHGASVKSIKLMRFIRKHATGTAATELHTVTVERGMSFETALAKYRKEGQYEHEGFYILQKRRQNKNSAILCLQAPSNSSDVSNGKINLQIYRPNTGPQVRLETHASISSRYVKVSPEEAQTYWVQQYELCLNMCSHLYWNRTCPMPTGCEVGLRMRTYHVLSGLMLPIWDRIELIIVNSGHKIQIIRMKTDANKKIVGTVVPPA 1783          
BLAST of Protein strawberry notch homolog 1 vs. Ensembl Fly
Match: sno (gene:FBgn0265630 transcript:FBtr0340488)

HSP 1 Score: 514.612 bits (1324), Expect = 1.354e-156
Identity = 260/460 (56.52%), Postives = 335/460 (72.83%), Query Frame = 3
Query:  627 VYSQYQPLKLRKGKVHPYXXXXXXXXXXXXXXXXRYCLSLPDGIIQNALLSNVQLEAVIYGCQRHEEILPTGERAGYLIGDGAGVGKGRTLAAIIYENYILHRKRAVWISVSNDLKHDAERDLCDLDANHIKIHPLNKMRYAKINSPENGNVRKGVLFSTYASLIGECQNMTKSKYKTRFRQIVQWFGTDYDGVIVFDECHKAKNLMPQGSQKKTKTAEIVLKLQETLPKARIVYASATGASEPRNMAYMTRLGLWGPGTPFKKFEDFVEKLEDK-VGAMELVAVDMKQRGMYIARQLSFANVTFRVHEVQLTNVKIGEHYFMNVYNESVDLWTRIFDNMNQALNTRFIAKKHAKTVWGQYWAAHQRFFKYLCMAGKVQECVRITMDAITQHKCVVIGLQSTGEAKTNEMLEDYGGEVTEFVSCARGILQSFVERFFPTEE--NINQMDKREDKTKTQNS 1997
             Y+ Y P KL+ GK HP  VVE++SLSSVE  +V Y LSLP   I +  LS +QLE++ Y  Q H+ +LP G RAG+LIGDGAGVGKGRT+A IIYENY+  RK+A+WISVSNDLK+DAERDL D+ A  I++H LNK +YAKI+S  N N ++GV+FSTY++LIGE  N T  KY++RFRQ++QW G D++G+I+FDECHKAKNL P GS K TKT + VL+LQ+ LPKAR+VYASATGASEP+NMAYM RLGLWG GT F  F DF+  +E + VGAME+VA+DMK RGMYIARQLSF  V+F++ EV L+        F  +Y++SV+LW        +A        +  KT+WGQ+W++HQRFFKYLC+A KV   V +  ++I   KCVVIGLQSTGEA+T + LE   GE+T+FVS A+G+ QSFVER FP  +   IN++    D+T + +S
Sbjct:  325 TYADYWPAKLKLGKKHPDAVVETASLSSVEPCDVYYKLSLPLETINSGHLSALQLESITYASQAHDHLLPDGSRAGFLIGDGAGVGKGRTIAGIIYENYLKGRKKALWISVSNDLKYDAERDLSDIGATRIEVHALNKFKYAKISSDVNNNCKRGVIFSTYSALIGESNNKT-GKYRSRFRQLLQWCGEDFEGLIIFDECHKAKNLCPVGSGKPTKTGQTVLELQQKLPKARVVYASATGASEPKNMAYMVRLGLWGQGTAFGNFNDFITAVERRGVGAMEIVAMDMKLRGMYIARQLSFKGVSFKIEEVPLS------KEFRKIYDQSVELWVEAMQKFTEAAELIDAESRMKKTMWGQFWSSHQRFFKYLCIAAKVNHAVLVARESIKYGKCVVIGLQSTGEARTLDQLERDDGELTDFVSTAKGVFQSFVERHFPAPDRNRINRILGLYDETPSLSS 777          

HSP 2 Score: 415.616 bits (1067), Expect = 3.584e-121
Identity = 231/520 (44.42%), Postives = 310/520 (59.62%), Query Frame = 3
Query: 2301 QRELLDSIDRLAPKLPINTLDDLIRELGGPDYVAEMSGRKGRMVMDVNTGDVSYQPRREDDVTLEQVNMVEKERFNTCQKLVAIISDAASTGISLHADKRYENSLQRVHITLELPWSADRAIQQFGRTHRSNQIYPPEYVFLISDLAGERRFASTVAKRLESLGALTHGDRRATETRDLSQFNIDNKFGRRALDSIFDTAFKSKSSLVPMPKGI------DLQAAFDSVGL------QP------KDGKNVSKFLNRILGMRLEVQNGLFQYYTDTMDELIKQAKRNQEFDRGIIDLAKEDDNIFVEETQVFRMTFLGDDIKVQLHRVKNITGMSWRSALEVPRGGNNSLDGFYITKN--ETQRKIVLAVQKKDRHGT-----------------------WFNVFSPNVGEQSNLIENKSLNEAFKKATLEEAERMWNDMYSVTENRCLHYFWYKHC---NYSKNCDTGCRSKIRYVLSGSIFYIWDIISAI-----NKSPQLARVRLNDGSKIIGCII 3707
            + ELL  I+RL  +LP NTLD LI ELGGPD VAEM+GR+GR+V   + G + Y+ R E DV LE +N+ EK+RF   +K VAIIS+AAS+GISL +D+R  N  +RVHITLELPWSADRAIQQFGRTHRSNQ+  PEY+FLISDLAGERRFASTVAKRLESLGALTHGDRRATETRDLSQFNIDNK+GR+AL+++  T    +S LVP P         D+  A   VG+       P      KD  N+SKFLNRILG  +++QN LF+Y+TDTM  +I+QAKR   FD GI+DL    +N+       F           ++H V+   GM W+ A++      N  +GFY++      +R  ++ V  + R+ +                          ++ PN G Q        L + ++K   EEAE  W + Y  + N C H +W  +C   +   +C+ G R ++ +VL+GS+  +W  +  I     N   Q+ R++  +G KI+G +I
Sbjct: 1005 KEELLRKIERLGARLPPNTLDQLIDELGGPDNVAEMTGRRGRVVQ-TDDGSIQYESRTESDVPLETLNITEKQRFMDGEKDVAIISEAASSGISLQSDRRVFNQRRRVHITLELPWSADRAIQQFGRTHRSNQVNAPEYIFLISDLAGERRFASTVAKRLESLGALTHGDRRATETRDLSQFNIDNKYGRQALETVMRTIMGYESPLVPPPTDYSGEFFKDIAGALVGVGIIVNSESHPGVLSLDKDYNNISKFLNRILGCPVDLQNRLFKYFTDTMTAIIQQAKRGGRFDLGILDLGAAGENVTRVRLIRFVRKHATGVAPTEMHTVRVERGMIWQEAIDKYADLFNENEGFYLSHQLRNQKRTAIMVVILESRNSSSTSSTTDLDSGSKKKKTHSKKEIMCQIYRPNTGLQVRHESLFELEKKYRKVASEEAEPHWTEQYDASVNTCSHAYWNGNCRNVSLGNDCEVGLRQRLYHVLAGSVLSVWGRVEHILNTRSNSKMQVIRMKTTEGEKIVGTLI 1523          
BLAST of Protein strawberry notch homolog 1 vs. Ensembl Fly
Match: sno (gene:FBgn0265630 transcript:FBtr0340489)

HSP 1 Score: 515.383 bits (1326), Expect = 3.494e-156
Identity = 260/460 (56.52%), Postives = 335/460 (72.83%), Query Frame = 3
Query:  627 VYSQYQPLKLRKGKVHPYXXXXXXXXXXXXXXXXRYCLSLPDGIIQNALLSNVQLEAVIYGCQRHEEILPTGERAGYLIGDGAGVGKGRTLAAIIYENYILHRKRAVWISVSNDLKHDAERDLCDLDANHIKIHPLNKMRYAKINSPENGNVRKGVLFSTYASLIGECQNMTKSKYKTRFRQIVQWFGTDYDGVIVFDECHKAKNLMPQGSQKKTKTAEIVLKLQETLPKARIVYASATGASEPRNMAYMTRLGLWGPGTPFKKFEDFVEKLEDK-VGAMELVAVDMKQRGMYIARQLSFANVTFRVHEVQLTNVKIGEHYFMNVYNESVDLWTRIFDNMNQALNTRFIAKKHAKTVWGQYWAAHQRFFKYLCMAGKVQECVRITMDAITQHKCVVIGLQSTGEAKTNEMLEDYGGEVTEFVSCARGILQSFVERFFPTEE--NINQMDKREDKTKTQNS 1997
             Y+ Y P KL+ GK HP  VVE++SLSSVE  +V Y LSLP   I +  LS +QLE++ Y  Q H+ +LP G RAG+LIGDGAGVGKGRT+A IIYENY+  RK+A+WISVSNDLK+DAERDL D+ A  I++H LNK +YAKI+S  N N ++GV+FSTY++LIGE  N T  KY++RFRQ++QW G D++G+I+FDECHKAKNL P GS K TKT + VL+LQ+ LPKAR+VYASATGASEP+NMAYM RLGLWG GT F  F DF+  +E + VGAME+VA+DMK RGMYIARQLSF  V+F++ EV L+        F  +Y++SV+LW        +A        +  KT+WGQ+W++HQRFFKYLC+A KV   V +  ++I   KCVVIGLQSTGEA+T + LE   GE+T+FVS A+G+ QSFVER FP  +   IN++    D+T + +S
Sbjct:  431 TYADYWPAKLKLGKKHPDAVVETASLSSVEPCDVYYKLSLPLETINSGHLSALQLESITYASQAHDHLLPDGSRAGFLIGDGAGVGKGRTIAGIIYENYLKGRKKALWISVSNDLKYDAERDLSDIGATRIEVHALNKFKYAKISSDVNNNCKRGVIFSTYSALIGESNNKT-GKYRSRFRQLLQWCGEDFEGLIIFDECHKAKNLCPVGSGKPTKTGQTVLELQQKLPKARVVYASATGASEPKNMAYMVRLGLWGQGTAFGNFNDFITAVERRGVGAMEIVAMDMKLRGMYIARQLSFKGVSFKIEEVPLS------KEFRKIYDQSVELWVEAMQKFTEAAELIDAESRMKKTMWGQFWSSHQRFFKYLCIAAKVNHAVLVARESIKYGKCVVIGLQSTGEARTLDQLERDDGELTDFVSTAKGVFQSFVERHFPAPDRNRINRILGLYDETPSLSS 883          

HSP 2 Score: 416.387 bits (1069), Expect = 5.536e-121
Identity = 231/520 (44.42%), Postives = 310/520 (59.62%), Query Frame = 3
Query: 2301 QRELLDSIDRLAPKLPINTLDDLIRELGGPDYVAEMSGRKGRMVMDVNTGDVSYQPRREDDVTLEQVNMVEKERFNTCQKLVAIISDAASTGISLHADKRYENSLQRVHITLELPWSADRAIQQFGRTHRSNQIYPPEYVFLISDLAGERRFASTVAKRLESLGALTHGDRRATETRDLSQFNIDNKFGRRALDSIFDTAFKSKSSLVPMPKGI------DLQAAFDSVGL------QP------KDGKNVSKFLNRILGMRLEVQNGLFQYYTDTMDELIKQAKRNQEFDRGIIDLAKEDDNIFVEETQVFRMTFLGDDIKVQLHRVKNITGMSWRSALEVPRGGNNSLDGFYITKN--ETQRKIVLAVQKKDRHGT-----------------------WFNVFSPNVGEQSNLIENKSLNEAFKKATLEEAERMWNDMYSVTENRCLHYFWYKHC---NYSKNCDTGCRSKIRYVLSGSIFYIWDIISAI-----NKSPQLARVRLNDGSKIIGCII 3707
            + ELL  I+RL  +LP NTLD LI ELGGPD VAEM+GR+GR+V   + G + Y+ R E DV LE +N+ EK+RF   +K VAIIS+AAS+GISL +D+R  N  +RVHITLELPWSADRAIQQFGRTHRSNQ+  PEY+FLISDLAGERRFASTVAKRLESLGALTHGDRRATETRDLSQFNIDNK+GR+AL+++  T    +S LVP P         D+  A   VG+       P      KD  N+SKFLNRILG  +++QN LF+Y+TDTM  +I+QAKR   FD GI+DL    +N+       F           ++H V+   GM W+ A++      N  +GFY++      +R  ++ V  + R+ +                          ++ PN G Q        L + ++K   EEAE  W + Y  + N C H +W  +C   +   +C+ G R ++ +VL+GS+  +W  +  I     N   Q+ R++  +G KI+G +I
Sbjct: 1111 KEELLRKIERLGARLPPNTLDQLIDELGGPDNVAEMTGRRGRVVQ-TDDGSIQYESRTESDVPLETLNITEKQRFMDGEKDVAIISEAASSGISLQSDRRVFNQRRRVHITLELPWSADRAIQQFGRTHRSNQVNAPEYIFLISDLAGERRFASTVAKRLESLGALTHGDRRATETRDLSQFNIDNKYGRQALETVMRTIMGYESPLVPPPTDYSGEFFKDIAGALVGVGIIVNSESHPGVLSLDKDYNNISKFLNRILGCPVDLQNRLFKYFTDTMTAIIQQAKRGGRFDLGILDLGAAGENVTRVRLIRFVRKHATGVAPTEMHTVRVERGMIWQEAIDKYADLFNENEGFYLSHQLRNQKRTAIMVVILESRNSSSTSSTTDLDSGSKKKKTHSKKEIMCQIYRPNTGLQVRHESLFELEKKYRKVASEEAEPHWTEQYDASVNTCSHAYWNGNCRNVSLGNDCEVGLRQRLYHVLAGSVLSVWGRVEHILNTRSNSKMQVIRMKTTEGEKIVGTLI 1629          
BLAST of Protein strawberry notch homolog 1 vs. Ensembl Zebrafish
Match: sbno1 (strawberry notch homolog 1 (Drosophila) [Source:ZFIN;Acc:ZDB-GENE-080522-2])

HSP 1 Score: 527.324 bits (1357), Expect = 1.576e-162
Identity = 268/473 (56.66%), Postives = 346/473 (73.15%), Query Frame = 3
Query:  630 YSQYQPLKLRKGKVHPYXXXXXXXXXXXXXXXXRYCLSLPDGIIQNALLSNVQLEAVIYGCQRHEEILPTGERAGYLIGDGAGVGKGRTLAAIIYENYILHRKRAVWISVSNDLKHDAERDLCDLDANHIKIHPLNKMRYAKINSPENGNVRKGVLFSTYASLIGECQNMTKSKYKTRFRQIVQWFGTDYDGVIVFDECHKAKNLMPQGSQKKTKTAEIVLKLQETLPKARIVYASATGASEPRNMAYMTRLGLWGPGTPFKKFEDFVEKLEDK-VGAMELVAVDMKQRGMYIARQLSFANVTFRVHEVQLTNVKIGEHYFMNVYNESVDLWTRIFDNMNQALNTRFIAKKHAKTVWGQYWAAHQRFFKYLCMAGKVQECVRITMDAITQHKCVVIGLQSTGEAKTNEMLEDYGGEVTEFVSCARGILQSFVERFFPTEE-----NINQMDKREDKTKTQNSKTNRKKGSSKK 2030
            Y++Y P+KLR G  HP PVVE+SSLSSV  P+V Y LS+P+  I    LS +QLEAV Y  Q+HE  LP G+RA YLIGDGAGVGKGRT+A IIYENY+L RKR++W SVSNDLK+DAERDL D+ A +I++H LNK +Y KI+S  NG+V+KGV+F+TY+SLIGE Q  +  KYKTRF+Q++ W G D+DGVIVFDECHKAKN+ P GS K TKT   VL+LQ  LPKAR+VYASATGASEPRNMAYM RLG+WG GTPF++F +F++ +E + VGAME+VA+DMK RGMYIARQLSF  VTF++ EV LT        ++ +YN++V LW    +   QA       ++  K++WGQ+W+AHQRFFKYLC+A KV+  V++  + +   KCVVIGLQSTGEA+T E LE+ GGE+ +FVS A+G+LQS VE+ FP  +     ++  +D    KT +       +KG  +K
Sbjct:  240 YAEYMPMKLRIGLRHPDPVVETSSLSSVNPPDVWYRLSIPEETIDRGWLSALQLEAVTYAAQQHETFLPNGDRAAYLIGDGAGVGKGRTIAGIIYENYLLGRKRSLWFSVSNDLKYDAERDLRDIGAKNIQVHSLNKFKYGKISSKHNGSVKKGVIFATYSSLIGESQ--SGGKYKTRFKQLLHWCGDDFDGVIVFDECHKAKNVCPIGSSKPTKTGLAVLELQNKLPKARVVYASATGASEPRNMAYMNRLGIWGEGTPFREFANFIQAVERRGVGAMEIVAMDMKLRGMYIARQLSFTGVTFKIEEVPLT------LDYIKMYNKAVRLWVSAREKFQQAAQLMDAEQRMKKSMWGQFWSAHQRFFKYLCIASKVRRVVQLAREDVKNGKCVVIGLQSTGEARTLEALEEGGGELNDFVSTAKGVLQSLVEKHFPAPDRQKLFSLLGIDLSAKKTPSPAENKTEQKGKKRK 704          

HSP 2 Score: 403.29 bits (1035), Expect = 1.225e-117
Identity = 222/497 (44.67%), Postives = 302/497 (60.76%), Query Frame = 3
Query: 2346 PINTLDDLIRELGGPDYVAEMSGRKGRMVMDVNTGDVSYQPRREDDVTLEQVNMVEKERFNTCQKLVAIISDAASTGISLHADKRYENSLQRVHITLELPWSADRAIQQFGRTHRSNQIYPPEYVFLISDLAGERRFASTVAKRLESLGALTHGDRRATETRDLSQFNIDNKFGRRALDSIFDTAFKSKSSLVPMPKGID------LQAAFDSVGL-----------QPKDGKNVSKFLNRILGMRLEVQNGLFQYYTDTMDELIKQAKRNQEFDRGIIDLAKEDDNIFVEETQVFRMTFLGDDIKVQLHRVKNITGMSWRSALEVPRGGNNSLDGFYITKNETQRKIVLAVQKKDRHGTWFNVFSPNVGEQSNLIENKSLNEAFKKATLEEAERMWNDMYSVTENRCLHYFWYKHCNYSK---NCDTGCRSKIRYVLSGSIFYIWD-------IISAINKSPQLARVRLNDGSKIIGCIINPSHKERITEILANRE 3755
            P NTLD LI ELGGPD VAEM+GRKGR+V + + G +SY+ R E DV +E +N+ EK+RF    K +AIIS+AAS+GISL AD R +N  +RVH+TLELPWSADRAIQQFGRTHRSNQ+  PEYVFLIS+LAGE+RFAS VAKRLESLGALTHGDRRATETRDLS+FN DNK+GR AL+ +  +     S LV  P   D      ++     VGL             KD  N+ KFLNRILGM ++ QN LFQY++DT+  +I+ AK++  +D GI+DL   D+ +   + + F          V+L+ V    GMSW  A  V    N   DGFY+ +    +KI + V++ +     F V+ PN+G+Q  L     + +  KK   ++A++ W D YS + + C H +W  +C  +     C+ G R +  +VL GS+  +W         +S  N   Q+ R+R  DG +I+G II  +    +  IL++ +
Sbjct:  865 PPNTLDQLIDELGGPDNVAEMTGRKGRVVSN-DDGSISYESRSELDVPVEILNLTEKQRFMDGDKNIAIISEAASSGISLQAD-RVKNQRRRVHMTLELPWSADRAIQQFGRTHRSNQVTAPEYVFLISELAGEQRFASIVAKRLESLGALTHGDRRATETRDLSRFNFDNKYGRNALEIVMKSIVSLDSPLVSPPADFDGDFFKEIRNGLIGVGLINVEDRSGVLSLDKDYNNIGKFLNRILGMEVQQQNALFQYFSDTLSAVIQNAKKSGRYDMGILDLGSGDEKVKKVDVKKFLTPGYSTSGHVELYTVSVERGMSWEEATHVWADQNGPDDGFYV-QVRNNKKIAILVKEVNPRKRLFMVYRPNIGKQVKLETYTDIKKRSKKVLSDDAKQHWMDQYSCSADVCSHAYWRGNCKKASVGLQCEIGLRCRTYFVLCGSVLSVWTKVEGVLASVSGANVKMQIVRLRTEDGQRIVGLIIPQNCVSPLVNILSSSD 1358          
BLAST of Protein strawberry notch homolog 1 vs. Ensembl Zebrafish
Match: sbno2a (strawberry notch homolog 2a [Source:ZFIN;Acc:ZDB-GENE-100629-3])

HSP 1 Score: 457.603 bits (1176), Expect = 2.730e-137
Identity = 237/464 (51.08%), Postives = 320/464 (68.97%), Query Frame = 3
Query:  627 VYSQYQPLKLRKGKVHPYXXXXXXXXXXXXXXXXRYCLSLPDGIIQNALLSNVQLEAVIYGCQRHEEILPTGERAGYLIGDGAGVGKGRTLAAIIYENYILHRKRAVWISVSNDLKHDAERDLCDLDANHIKIHPLNKMRYAKINSPENGNVRKGVLFSTYASLIGECQNMTKSKYKTRFRQIVQWFGTDYDGVIVFDECHKAKNLMPQGSQKKTKTAEIVLKLQETLPKARIVYASATGASEPRNMAYMTRLGLWGPGTPFKKFEDFVEKLEDK-VGAMELVAVDMKQRGMYIARQLSFANVTFRVHEVQLTNVKIGEHYFMNVYNESVDLWTRIFDNMNQALNTRFIAKKHAKTVWGQYWAAHQRFFKYLCMAGKVQECVRITMDAITQHKCVVIGLQSTGEAKTNEMLEDYGGEVTEFVSCARGILQSFVERFFPTEENINQMDKREDKTKTQNSKTNRKK 2015
             Y++Y+P K   G  HP  VVE+++LSSV  P++ Y LS+PD  +   LLS +QLEA+IY CQ+HE IL  G+RAG+LIGDGAGVGKGRT+A II EN++  RKRA+W SVSNDLK+DAERDL D+DA +I +  LNK++Y    + E      GVLF+TY++LIGE Q     +++TR +QI+ W    +DGVIVFDECHKAKN         TK  + VL LQ  LP+AR+VYASATGASEP+NM YM+RLG+WG GTPFK F+DF+  +E + VGAME+VA+DMK  GMYIARQLSF+ V+FR+ E+ L      +  F  VYN++  LW    +  N+A +T  +A +  K++WGQ+W++HQRFFKYLC+A KV+  V +    + Q KC+VIGLQSTGEA+T E+L++  G + +F+S A  + QS V++ FPT+           K K + S  N++K
Sbjct:  205 TYAEYKPSKSTIGISHPDIVVETNTLSSVPPPDITYTLSIPDSTVSTGLLSALQLEAIIYACQQHEVILQNGQRAGFLIGDGAGVGKGRTVAGIILENFLKGRKRALWFSVSNDLKYDAERDLKDIDAPNIPVFALNKIKYGDTATSE------GVLFATYSALIGESQ--AGGQHRTRLKQILDWCKPSFDGVIVFDECHKAKN------ATSTKMGKAVLDLQSKLPRARVVYASATGASEPKNMIYMSRLGIWGQGTPFKTFDDFLHAIEKRGVGAMEIVAMDMKVSGMYIARQLSFSGVSFRIEEIAL------DEEFKLVYNKAARLWAEALELFNRAADTLGLASR--KSLWGQFWSSHQRFFKYLCIAAKVRRLVDLAHMEMQQGKCIVIGLQSTGEARTREVLDENDGHLDKFISAAERVFQSLVQKHFPTQ-----------KPKREKSAANKRK 635          

HSP 2 Score: 367.851 bits (943), Expect = 1.785e-105
Identity = 214/498 (42.97%), Postives = 304/498 (61.04%), Query Frame = 3
Query: 2301 QRELLDSIDRLAPKLPINTLDDLIRELGGPDYVAEMSGRKGRMVMDVNTGDVSYQPRREDDVTLEQVNMVEKERFNTCQKLVAIISDAASTGISLHADKRYENSLQRVHITLELPWSADRAIQQFGRTHRSNQIYPPEYVFLISDLAGERRFASTVAKRLESLGALTHGDRRATETRDLSQFNIDNKFGRRALDSIFDTAFKSKSSLVPMPKGI---------DLQAAFDSVGL---QPKDGKN------VSKFLNRILGMRLEVQNGLFQYYTDTMDELIKQAKRNQEFDRGIIDLAKEDDNIFVEETQVFRMTFLGDDIKVQLHRVKNITGMSWRSALEVPRGGNNSLDGFYITKN--ETQRKIVLAVQKKDRHGTWFNVFSPNVGEQSNLIENKSLNEAFKKATLEEAERMWNDMYSVTENRCLHYFWYKHCNY---SKNCDTGCRSKIRYVLSGSIFYIW----DIISAINKSP--QLARVRLNDGSKIIGCII 3707
            ++ LL  I  L  +LP+NTLD+LI   GGP+ V+EM+GRKGR+V   + G V Y+ R E  +T++ VN+ EKERF + +KL+AIIS+AAS+GISL ADKR +N  +RVH+TLELPWSADRAIQQFGRTHRSNQ+  PEY+FLIS+LAGERRFAS VAKRLESLGALTHGDRRATE+RDLSQ+N +NK+G +ALD I         + VP PKG          D++     VG+   +P+ G N      ++KFLNRILG+ +  QN LFQY+T+  D LI++ K+  ++D GI+DLA  +D I  E  + F       + +V L+++    GM W+ A           +GFY++     +Q  ++LA Q + R+     ++ PN+G+Q++     +L   + K   E+A+ +W   +  +   C H  W   C      + C  G R +  ++L G++  +W    DI+S I  S   Q+ R++    SK +G  I
Sbjct:  703 KQRLLHRIAELGKELPLNTLDELIDRFGGPEKVSEMTGRKGRVVRRPD-GSVRYESRAEQGLTIDHVNVREKERFMSGEKLIAIISEAASSGISLQADKRVQNRRRRVHMTLELPWSADRAIQQFGRTHRSNQVTAPEYIFLISELAGERRFASIVAKRLESLGALTHGDRRATESRDLSQYNFENKYGTKALDKITKAILGHIDNKVPPPKGYPGGGLMFFRDMKKGMIDVGIFCKEPRMGLNTEKDCTLTKFLNRILGLEVHHQNFLFQYFTENFDYLIEKDKKEGKYDMGILDLAPGNDEIHEETQEKFLTPGNPQEGQVILYKISVDRGMPWKEACSKAEKLTGDYEGFYLSNKLRGSQPCVLLAEQGRGRN---LILYKPNIGKQAHPENLDNLLLRYYKVLPEDAKDVWESQFDFSFTNCSHANWKGKCKQIEEGQECFLGMRLRQYHMLCGALLRVWKRVSDIVSDITNSSILQIVRLKTKQNSKQVGIKI 1196          
BLAST of Protein strawberry notch homolog 1 vs. Ensembl Zebrafish
Match: SBNO2 (si:ch73-63e15.2 [Source:ZFIN;Acc:ZDB-GENE-091204-463])

HSP 1 Score: 448.743 bits (1153), Expect = 6.928e-134
Identity = 237/478 (49.58%), Postives = 325/478 (67.99%), Query Frame = 3
Query:  627 VYSQYQPLKLRKGKVHPYXXXXXXXXXXXXXXXXRYCLSLPDGIIQNALLSNVQLEAVIYGCQRHEEILPTGERAGYLIGDGAGVGKGRTLAAIIYENYILHRKRAVWISVSNDLKHDAERDLCDLDANHIKIHPLNKMRYAKINSPENGNVRKGVLFSTYASLIGECQNMTKSKYKTRFRQIVQWFGTDYDGVIVFDECHKAKNLMPQGSQKKTKTAEIVLKLQETLPKARIVYASATGASEPRNMAYMTRLGLWGPGTPFKKFEDFVEKLEDK-VGAMELVAVDMKQRGMYIARQLSFANVTFRVHEVQLTNVKIGEHYFMNVYNESVDLWTRIFDNMNQALNTRFIAKKHAKTVWGQYWAAHQRFFKYLCMAGKVQECVRITMDAITQHKCVVIGLQSTGEAKTNEMLEDYGGEVTEFVSCARGILQSFVERFFPTEENINQM---DKREDKTKTQNSKTNRKKGSSKKPISLQD 2048
             Y+ Y+P K + G  HP  VVE+++LSSV  P++ Y LS+P+  I++ LLS +QLEA+ Y CQ+HE IL   +RAG+LIGDGAGVGKGRT+A II EN +  RK+A+W SVSNDLK+DAERDL D+ A  I++H LNK++Y    + E      GVLF TY++LIGE Q     +++TR +QI+ W   ++DGVI+FDECHKAKN         TK  + VL LQ  LP AR+VYASATGASEP+NM YM+RLG+WG GTPF+ F+DF+  +E + VGAME+VA+DMK  GMYIARQLSF+ V+FR+ E+ L N       F  VYN++  LW        QA +   ++ +  K++WGQ+W++HQRFFKYLC+A KV+  V +    +   KCVVIGLQSTGEA+T E+L++  G +  FVS A G+ QS V + FP+E+ + +    +KR+ K + + SK  R +G+    I++ D
Sbjct:  121 TYADYKPSKSKIGISHPDRVVETNTLSSVPPPDITYTLSIPEDTIKDGLLSALQLEAITYACQQHEVILQNSQRAGFLIGDGAGVGKGRTVAGIILENNLKGRKKALWFSVSNDLKYDAERDLQDIGAVSIRVHALNKIKYGDTATSE------GVLFVTYSALIGESQ--AGGQHRTRLKQILDWCEPEFDGVIIFDECHKAKNAT------STKMGKAVLDLQNKLPLARVVYASATGASEPKNMIYMSRLGIWGEGTPFRTFDDFLHTIEKRGVGAMEIVAMDMKVSGMYIARQLSFSGVSFRIEEISLDN------DFKLVYNKAAKLWAEALRVFMQAADELCMSSR--KSLWGQFWSSHQRFFKYLCIAAKVRCLVELAKKELEAGKCVVIGLQSTGEARTREVLDENDGHLDRFVSAAEGVFQSLVFKHFPSEKQMREKGAGNKRKRKPRARQSKQPR-QGTDIAVINISD 575          

HSP 2 Score: 388.652 bits (997), Expect = 1.351e-112
Identity = 230/588 (39.12%), Postives = 337/588 (57.31%), Query Frame = 3
Query: 2310 LLDSIDRLAPKLPINTLDDLIRELGGPDYVAEMSGRKGRMVMDVNTGDVSYQPRREDDVTLEQVNMVEKERFNTCQKLVAIISDAASTGISLHADKRYENSLQRVHITLELPWSADRAIQQFGRTHRSNQIYPPEYVFLISDLAGERRFASTVAKRLESLGALTHGDRRATETRDLSQFNIDNKFGRRALDSIFDTAFKSKSSLVPMPKGI---------DLQAAFDSVGLQPKDGK---------NVSKFLNRILGMRLEVQNGLFQYYTDTMDELIKQAKRNQEFDRGIIDLAKEDDNIFVEETQVFRMTFLGDDIKVQLHRVKNITGMSWRSALEVPRGGNNSLDGFYITK--NETQRKIVLAVQKKDRHGTWFNVFSPNVGEQSNLIENKSLNEAFKKATLEEAERMWNDMYSVTENRCLHYFWYKHC---NYSKNCDTGCRSKIRYVLSGSIFYIW----DIISAINKSP--QLARVRLNDGSKIIGCIINPSHKERITEILANRESHPQQTIPVSTAGRAQQQVQLQKDRPMLQRPVRLVQQPKLSTQDHQFYAGQNMKGFIQRPRMATIVSSPALRYPQTP 3986
            LL+ I  L  +LP+NTLD+LI + GGP+ V+EM+GRKGR+V   + G V Y+ R E   T++Q+N+ EK+RF   +KLVAIIS+AAS+GISL AD+R +N  +RVH+TLELPWSADRAIQQFGRTHRSNQ+  PEY+FLIS+LAGERRFAS VAKRLESLGALTHGDRRATE+RDLS++N +NK+G +ALD I  T      S VP PK           D++     VG+     +         N++KFLNRILG+ +  QN LFQY+TD  D LI+  K+   +D GI+DLA  +D I+ E  + F       D +V L+++    GM W  ALE         +GFY++         ++LAVQ K+R+     ++ PN+G+Q        L + ++K T  + +  W + ++ +  +C H   Y  C   +  + C  G R +  ++L G++  +W    DI++ I  S   Q+ R++  D +K +G  I  +   ++ + L   +S  +Q          +QQ   Q+    L++      Q  ++ Q HQ    +       +   AT +++P + +P  P
Sbjct:  622 LLNKIAELGKELPLNTLDELIDKFGGPEKVSEMTGRKGRVVRRPD-GSVQYESRAEQGHTIDQINIKEKDRFMNGEKLVAIISEAASSGISLQADRRVKNQCRRVHMTLELPWSADRAIQQFGRTHRSNQVNAPEYIFLISELAGERRFASIVAKRLESLGALTHGDRRATESRDLSKYNFENKYGTKALDKITKTILGQTESKVPPPKDYPGGEAMFFRDMKYGMMDVGMLCSQSRLGINIEKDCNITKFLNRILGLEVHKQNSLFQYFTDNFDYLIEMDKKVGNYDLGILDLAPGNDQIYEETQEKFLTAGNPQDGQVVLYKISVDRGMPWSEALEKFETLTKPDEGFYMSYRLRSNHPCVLLAVQGKERN---MILYKPNIGKQLQPESIDKLQQKYRKVTPADVQDSWENQFNFSLRKCSHANQYGRCKRIDDGQECTMGTRLRQYHMLCGALLRVWKRVSDIVADITSSSILQIVRLKTKDSNKQVGIKIPETCITKVRQELLRMDSEVKQRRREKEQKALEQQALEQQ---ALEQRQAEEHQRLMAQQQHQ----ELFSNLFNQSLAATSLTTPYISFPSFP 1198          
BLAST of Protein strawberry notch homolog 1 vs. Ensembl Zebrafish
Match: SBNO2 (si:ch73-63e15.2 [Source:ZFIN;Acc:ZDB-GENE-091204-463])

HSP 1 Score: 448.358 bits (1152), Expect = 3.113e-133
Identity = 237/478 (49.58%), Postives = 325/478 (67.99%), Query Frame = 3
Query:  627 VYSQYQPLKLRKGKVHPYXXXXXXXXXXXXXXXXRYCLSLPDGIIQNALLSNVQLEAVIYGCQRHEEILPTGERAGYLIGDGAGVGKGRTLAAIIYENYILHRKRAVWISVSNDLKHDAERDLCDLDANHIKIHPLNKMRYAKINSPENGNVRKGVLFSTYASLIGECQNMTKSKYKTRFRQIVQWFGTDYDGVIVFDECHKAKNLMPQGSQKKTKTAEIVLKLQETLPKARIVYASATGASEPRNMAYMTRLGLWGPGTPFKKFEDFVEKLEDK-VGAMELVAVDMKQRGMYIARQLSFANVTFRVHEVQLTNVKIGEHYFMNVYNESVDLWTRIFDNMNQALNTRFIAKKHAKTVWGQYWAAHQRFFKYLCMAGKVQECVRITMDAITQHKCVVIGLQSTGEAKTNEMLEDYGGEVTEFVSCARGILQSFVERFFPTEENINQM---DKREDKTKTQNSKTNRKKGSSKKPISLQD 2048
             Y+ Y+P K + G  HP  VVE+++LSSV  P++ Y LS+P+  I++ LLS +QLEA+ Y CQ+HE IL   +RAG+LIGDGAGVGKGRT+A II EN +  RK+A+W SVSNDLK+DAERDL D+ A  I++H LNK++Y    + E      GVLF TY++LIGE Q     +++TR +QI+ W   ++DGVI+FDECHKAKN         TK  + VL LQ  LP AR+VYASATGASEP+NM YM+RLG+WG GTPF+ F+DF+  +E + VGAME+VA+DMK  GMYIARQLSF+ V+FR+ E+ L N       F  VYN++  LW        QA +   ++ +  K++WGQ+W++HQRFFKYLC+A KV+  V +    +   KCVVIGLQSTGEA+T E+L++  G +  FVS A G+ QS V + FP+E+ + +    +KR+ K + + SK  R +G+    I++ D
Sbjct:  193 TYADYKPSKSKIGISHPDRVVETNTLSSVPPPDITYTLSIPEDTIKDGLLSALQLEAITYACQQHEVILQNSQRAGFLIGDGAGVGKGRTVAGIILENNLKGRKKALWFSVSNDLKYDAERDLQDIGAVSIRVHALNKIKYGDTATSE------GVLFVTYSALIGESQ--AGGQHRTRLKQILDWCEPEFDGVIIFDECHKAKNAT------STKMGKAVLDLQNKLPLARVVYASATGASEPKNMIYMSRLGIWGEGTPFRTFDDFLHTIEKRGVGAMEIVAMDMKVSGMYIARQLSFSGVSFRIEEISLDN------DFKLVYNKAAKLWAEALRVFMQAADELCMSSR--KSLWGQFWSSHQRFFKYLCIAAKVRCLVELAKKELEAGKCVVIGLQSTGEARTREVLDENDGHLDRFVSAAEGVFQSLVFKHFPSEKQMREKGAGNKRKRKPRARQSKQPR-QGTDIAVINISD 647          

HSP 2 Score: 387.882 bits (995), Expect = 6.055e-112
Identity = 230/588 (39.12%), Postives = 337/588 (57.31%), Query Frame = 3
Query: 2310 LLDSIDRLAPKLPINTLDDLIRELGGPDYVAEMSGRKGRMVMDVNTGDVSYQPRREDDVTLEQVNMVEKERFNTCQKLVAIISDAASTGISLHADKRYENSLQRVHITLELPWSADRAIQQFGRTHRSNQIYPPEYVFLISDLAGERRFASTVAKRLESLGALTHGDRRATETRDLSQFNIDNKFGRRALDSIFDTAFKSKSSLVPMPKGI---------DLQAAFDSVGLQPKDGK---------NVSKFLNRILGMRLEVQNGLFQYYTDTMDELIKQAKRNQEFDRGIIDLAKEDDNIFVEETQVFRMTFLGDDIKVQLHRVKNITGMSWRSALEVPRGGNNSLDGFYITK--NETQRKIVLAVQKKDRHGTWFNVFSPNVGEQSNLIENKSLNEAFKKATLEEAERMWNDMYSVTENRCLHYFWYKHC---NYSKNCDTGCRSKIRYVLSGSIFYIW----DIISAINKSP--QLARVRLNDGSKIIGCIINPSHKERITEILANRESHPQQTIPVSTAGRAQQQVQLQKDRPMLQRPVRLVQQPKLSTQDHQFYAGQNMKGFIQRPRMATIVSSPALRYPQTP 3986
            LL+ I  L  +LP+NTLD+LI + GGP+ V+EM+GRKGR+V   + G V Y+ R E   T++Q+N+ EK+RF   +KLVAIIS+AAS+GISL AD+R +N  +RVH+TLELPWSADRAIQQFGRTHRSNQ+  PEY+FLIS+LAGERRFAS VAKRLESLGALTHGDRRATE+RDLS++N +NK+G +ALD I  T      S VP PK           D++     VG+     +         N++KFLNRILG+ +  QN LFQY+TD  D LI+  K+   +D GI+DLA  +D I+ E  + F       D +V L+++    GM W  ALE         +GFY++         ++LAVQ K+R+     ++ PN+G+Q        L + ++K T  + +  W + ++ +  +C H   Y  C   +  + C  G R +  ++L G++  +W    DI++ I  S   Q+ R++  D +K +G  I  +   ++ + L   +S  +Q          +QQ   Q+    L++      Q  ++ Q HQ    +       +   AT +++P + +P  P
Sbjct:  694 LLNKIAELGKELPLNTLDELIDKFGGPEKVSEMTGRKGRVVRRPD-GSVQYESRAEQGHTIDQINIKEKDRFMNGEKLVAIISEAASSGISLQADRRVKNQCRRVHMTLELPWSADRAIQQFGRTHRSNQVNAPEYIFLISELAGERRFASIVAKRLESLGALTHGDRRATESRDLSKYNFENKYGTKALDKITKTILGQTESKVPPPKDYPGGEAMFFRDMKYGMMDVGMLCSQSRLGINIEKDCNITKFLNRILGLEVHKQNSLFQYFTDNFDYLIEMDKKVGNYDLGILDLAPGNDQIYEETQEKFLTAGNPQDGQVVLYKISVDRGMPWSEALEKFETLTKPDEGFYMSYRLRSNHPCVLLAVQGKERN---MILYKPNIGKQLQPESIDKLQQKYRKVTPADVQDSWENQFNFSLRKCSHANQYGRCKRIDDGQECTMGTRLRQYHMLCGALLRVWKRVSDIVADITSSSILQIVRLKTKDSNKQVGIKIPETCITKVRQELLRMDSEVKQRRREKEQKALEQQALEQQ---ALEQRQAEEHQRLMAQQQHQ----ELFSNLFNQSLAATSLTTPYISFPSFP 1270          
BLAST of Protein strawberry notch homolog 1 vs. Ensembl Xenopus
Match: sidt2 (SID1 transmembrane family member 2 [Source:Xenbase;Acc:XB-GENE-982521])

HSP 1 Score: 530.02 bits (1364), Expect = 2.670e-165
Identity = 262/441 (59.41%), Postives = 336/441 (76.19%), Query Frame = 3
Query:  627 VYSQYQPLKLRKGKVHPYXXXXXXXXXXXXXXXXRYCLSLPDGIIQNALLSNVQLEAVIYGCQRHEEILPTGERAGYLIGDGAGVGKGRTLAAIIYENYILHRKRAVWISVSNDLKHDAERDLCDLDANHIKIHPLNKMRYAKINSPENGNVRKGVLFSTYASLIGECQNMTKSKYKTRFRQIVQWFGTDYDGVIVFDECHKAKNLMPQGSQKKTKTAEIVLKLQETLPKARIVYASATGASEPRNMAYMTRLGLWGPGTPFKKFEDFVEKLEDK-VGAMELVAVDMKQRGMYIARQLSFANVTFRVHEVQLTNVKIGEHYFMNVYNESVDLWTRIFDNMNQALNTRFIAKKHAKTVWGQYWAAHQRFFKYLCMAGKVQECVRITMDAITQHKCVVIGLQSTGEAKTNEMLEDYGGEVTEFVSCARGILQSFVERFFPTEE 1946
             Y++Y P+KL+ G  HP PVVE+SSLSSV  P+V +  ++P+  I N  LS +QLEAV Y  Q+HE  LP GERAG+LIGDGAGVGKGRT+A II+ENY+L RKR++W SVSNDLK+DAERDL D+ A +I++H LNK +Y KI+S  NG+V+KGV+F+TY+SLIGE Q  +  KYKTR +Q++ W G D+DGVIVFDECHKAKNL P GS K TKT   VL+LQ  LPKAR+VYASATGASEPRNMAYM+RLG+WG GTPF++F DF++ +E + VGAME+VA+DMK RGMYIARQLSF  VTF++ EV L       H ++ +YN+SV LW    +   QA +     ++  K++WGQ+W+AHQRFFKYLC+A KV+  V++  + I   KCVVIGLQSTGEA+T E LE+ GGE+ +FVS ARG+LQS +E+ FP  +
Sbjct:  217 TYAEYMPIKLKVGLRHPDPVVETSSLSSVTPPDVWFQTTIPEETIDNGWLSALQLEAVTYAAQQHETFLPNGERAGFLIGDGAGVGKGRTIAGIIFENYLLSRKRSLWFSVSNDLKYDAERDLRDIGAKNIQVHSLNKFKYGKISSKHNGSVKKGVIFATYSSLIGESQ--SGGKYKTRLKQLLHWCGEDFDGVIVFDECHKAKNLCPVGSSKPTKTGLAVLELQNKLPKARVVYASATGASEPRNMAYMSRLGIWGEGTPFREFNDFIQAVERRGVGAMEIVAMDMKLRGMYIARQLSFTGVTFKIEEVPLG------HDYVKMYNKSVKLWVLARERFQQAADLIDAEQRMKKSMWGQFWSAHQRFFKYLCIASKVRRVVQLAREEIKNGKCVVIGLQSTGEARTLEALEEGGGELNDFVSTARGVLQSLIEKHFPAPD 649          

HSP 2 Score: 294.664 bits (753), Expect = 1.908e-81
Identity = 167/355 (47.04%), Postives = 217/355 (61.13%), Query Frame = 3
Query: 2256 NNSMKTGADVSCRITQ--RELLDSIDRLAPKLPINTLDDLIRELGGPDYVAEMSGRKGRMVMDVNTGDVSYQPRREDDVTLEQVNMVEKERFNTCQKLVAIISDAASTGISLHADKRYENSLQRVHITLELPWSADRAIQQFGRTHRSNQIYPPEYVFLISDLAGERRFASTVAKRLESLGALTHGDRRATETRDLSQFNIDNKFGRRALDSIFDTAFKSKSSLVPMPKGIDLQAAFDSVGLQPKDGKNVSKFLNRILGMRLEVQNGLFQYYTDTMDELIKQAKRNQEFDRGIIDLAKEDDNIFVEETQVFRMTFLGDDIKVQLHRVKNITGMSWRSALEVPRGGNNSLDGFYIT 3314
            +NS  T  D   R  Q  +ELLD ++ LA  LP NTLD+LI ELGGPD VAEM+GRKGR+V + + G +SY+ R E DV +E +N+ EK+RF   +K +AIIS+AAS+GISL AD+R +N  +RVH+TLELPWSADRAIQQFGRTHRSNQ+  PEYVFLIS+LAGE+RFAS VAKRLESLGALTHGDRRATE+RDLS+FN DNK+GR AL+ +  +     S L            +D                          +  LF         +I+ AK+N  +D GI+DL   D+ +   + + F          V+L+ +    GMSW  A ++        DGFY++
Sbjct:  820 SNSCVTSQDAVERAQQMKKELLDKLENLAEALPPNTLDELIDELGGPDNVAEMTGRKGRVVSN-DDGSISYESRSELDVPVEILNITEKQRFMDGEKNIAIISEAASSGISLQADRRAKNQRRRVHMTLELPWSADRAIQQFGRTHRSNQVTAPEYVFLISELAGEQRFASIVAKRLESLGALTHGDRRATESRDLSRFNFDNKYGRNALEIVMKSIVSLDSPL------------YD-----------------------YHFKGKLF------FHAVIQNAKKNGRYDMGILDLGSGDEKVRKSDAKKFLTPGYSTSGHVELYTISVERGMSWEDATKIWAEQTGPDDGFYLS 1132          
BLAST of Protein strawberry notch homolog 1 vs. Ensembl Xenopus
Match: sidt2 (SID1 transmembrane family member 2 [Source:Xenbase;Acc:XB-GENE-982521])

HSP 1 Score: 531.946 bits (1369), Expect = 7.548e-165
Identity = 262/441 (59.41%), Postives = 336/441 (76.19%), Query Frame = 3
Query:  627 VYSQYQPLKLRKGKVHPYXXXXXXXXXXXXXXXXRYCLSLPDGIIQNALLSNVQLEAVIYGCQRHEEILPTGERAGYLIGDGAGVGKGRTLAAIIYENYILHRKRAVWISVSNDLKHDAERDLCDLDANHIKIHPLNKMRYAKINSPENGNVRKGVLFSTYASLIGECQNMTKSKYKTRFRQIVQWFGTDYDGVIVFDECHKAKNLMPQGSQKKTKTAEIVLKLQETLPKARIVYASATGASEPRNMAYMTRLGLWGPGTPFKKFEDFVEKLEDK-VGAMELVAVDMKQRGMYIARQLSFANVTFRVHEVQLTNVKIGEHYFMNVYNESVDLWTRIFDNMNQALNTRFIAKKHAKTVWGQYWAAHQRFFKYLCMAGKVQECVRITMDAITQHKCVVIGLQSTGEAKTNEMLEDYGGEVTEFVSCARGILQSFVERFFPTEE 1946
             Y++Y P+KL+ G  HP PVVE+SSLSSV  P+V +  ++P+  I N  LS +QLEAV Y  Q+HE  LP GERAG+LIGDGAGVGKGRT+A II+ENY+L RKR++W SVSNDLK+DAERDL D+ A +I++H LNK +Y KI+S  NG+V+KGV+F+TY+SLIGE Q  +  KYKTR +Q++ W G D+DGVIVFDECHKAKNL P GS K TKT   VL+LQ  LPKAR+VYASATGASEPRNMAYM+RLG+WG GTPF++F DF++ +E + VGAME+VA+DMK RGMYIARQLSF  VTF++ EV L       H ++ +YN+SV LW    +   QA +     ++  K++WGQ+W+AHQRFFKYLC+A KV+  V++  + I   KCVVIGLQSTGEA+T E LE+ GGE+ +FVS ARG+LQS +E+ FP  +
Sbjct:  202 TYAEYMPIKLKVGLRHPDPVVETSSLSSVTPPDVWFQTTIPEETIDNGWLSALQLEAVTYAAQQHETFLPNGERAGFLIGDGAGVGKGRTIAGIIFENYLLSRKRSLWFSVSNDLKYDAERDLRDIGAKNIQVHSLNKFKYGKISSKHNGSVKKGVIFATYSSLIGESQ--SGGKYKTRLKQLLHWCGEDFDGVIVFDECHKAKNLCPVGSSKPTKTGLAVLELQNKLPKARVVYASATGASEPRNMAYMSRLGIWGEGTPFREFNDFIQAVERRGVGAMEIVAMDMKLRGMYIARQLSFTGVTFKIEEVPLG------HDYVKMYNKSVKLWVLARERFQQAADLIDAEQRMKKSMWGQFWSAHQRFFKYLCIASKVRRVVQLAREEIKNGKCVVIGLQSTGEARTLEALEEGGGELNDFVSTARGVLQSLIEKHFPAPD 634          

HSP 2 Score: 355.14 bits (910), Expect = 3.038e-101
Identity = 208/497 (41.85%), Postives = 285/497 (57.34%), Query Frame = 3
Query: 2256 NNSMKTGADVSCRITQ--RELLDSIDRLAPKLPINTLDDLIRELGGPDYVAEMSGRKGRMVMDVNTGDVSYQPRREDDVTLEQVNMVEKERFNTCQKLVAIISDAASTGISLHADKRYENSLQRVHITLELPWSADRAIQQFGRTHRSNQIYPPEYVFLISDLAGERRFASTVAKRLESLGALTHGDRRATETRDLSQFNIDNKFGRRALDSIFDTAFKSKSSLVPMPKGIDLQAAFDSVGLQPKDGKNVSKFLNRILGMRLEVQNGLFQYYTDTMDELIKQAKRNQEFDRGIIDLAKEDDNIFVEETQVFRMTFLGDDIKVQLHRVKNITGMSWRSALEVPRGGNNSLDGFYIT-KNETQRKIVLAVQKKDRHGTWFNVFSPNVGEQSNLIENKSLNEAFKKATLEEAERMWNDMYSVTENRCLHYFWYKHCNYSK---NCDTGCRSKIRYVLSGSIFYIWD-------IISAINKSPQLARVRLNDGSKIIGCII 3707
            +NS  T  D   R  Q  +ELLD ++ LA  LP NTLD+LI ELGGPD VAEM+GRKGR+V + + G +SY+ R E DV +E +N+ EK+RF   +K +AIIS+AAS+GISL AD+R +N  +RVH+TLELPWSADRAIQQFGRTHRSNQ+  PEYVFLIS+LAGE+RFAS VAKRLESLGALTHGDRRATE+RDLS+FN DNK+GR AL+ +  +     S L            +D                          +  LF         +I+ AK+N  +D GI+DL   D+ +   + + F          V+L+ +    GMSW  A ++        DGFY++ +    +K  + V++ +     F V+ PN G+Q  L     L + +KK T E+A+  W + Y  + + C H +W  +C  +     C+ G R +  YVL GS+  +W         +S  N   Q+ R+R  DG +I+G II
Sbjct:  807 SNSCVTSQDAVERAQQMKKELLDKLENLAEALPPNTLDELIDELGGPDNVAEMTGRKGRVVSN-DDGSISYESRSELDVPVEILNITEKQRFMDGEKNIAIISEAASSGISLQADRRAKNQRRRVHMTLELPWSADRAIQQFGRTHRSNQVTAPEYVFLISELAGEQRFASIVAKRLESLGALTHGDRRATESRDLSRFNFDNKYGRNALEIVMKSIVSLDSPL------------YD-----------------------YHFKGKLF------FHAVIQNAKKNGRYDMGILDLGSGDEKVRKSDAKKFLTPGYSTSGHVELYTISVERGMSWEDATKIWAEQTGPDDGFYLSLQIRNNKKTGILVKEINPKKKLFLVYRPNTGKQLKLETLLDLKKKYKKVTSEDAQSHWKEQYISSADICTHAYWRGNCKKASLGLVCEIGLRCRTYYVLCGSVLSVWTKVEGVLASVSGTNVKMQIVRLRTEDGQRIVGLII 1261          
BLAST of Protein strawberry notch homolog 1 vs. Ensembl Xenopus
Match: sidt2 (SID1 transmembrane family member 2 [Source:Xenbase;Acc:XB-GENE-982521])

HSP 1 Score: 532.332 bits (1370), Expect = 1.391e-164
Identity = 262/441 (59.41%), Postives = 336/441 (76.19%), Query Frame = 3
Query:  627 VYSQYQPLKLRKGKVHPYXXXXXXXXXXXXXXXXRYCLSLPDGIIQNALLSNVQLEAVIYGCQRHEEILPTGERAGYLIGDGAGVGKGRTLAAIIYENYILHRKRAVWISVSNDLKHDAERDLCDLDANHIKIHPLNKMRYAKINSPENGNVRKGVLFSTYASLIGECQNMTKSKYKTRFRQIVQWFGTDYDGVIVFDECHKAKNLMPQGSQKKTKTAEIVLKLQETLPKARIVYASATGASEPRNMAYMTRLGLWGPGTPFKKFEDFVEKLEDK-VGAMELVAVDMKQRGMYIARQLSFANVTFRVHEVQLTNVKIGEHYFMNVYNESVDLWTRIFDNMNQALNTRFIAKKHAKTVWGQYWAAHQRFFKYLCMAGKVQECVRITMDAITQHKCVVIGLQSTGEAKTNEMLEDYGGEVTEFVSCARGILQSFVERFFPTEE 1946
             Y++Y P+KL+ G  HP PVVE+SSLSSV  P+V +  ++P+  I N  LS +QLEAV Y  Q+HE  LP GERAG+LIGDGAGVGKGRT+A II+ENY+L RKR++W SVSNDLK+DAERDL D+ A +I++H LNK +Y KI+S  NG+V+KGV+F+TY+SLIGE Q  +  KYKTR +Q++ W G D+DGVIVFDECHKAKNL P GS K TKT   VL+LQ  LPKAR+VYASATGASEPRNMAYM+RLG+WG GTPF++F DF++ +E + VGAME+VA+DMK RGMYIARQLSF  VTF++ EV L       H ++ +YN+SV LW    +   QA +     ++  K++WGQ+W+AHQRFFKYLC+A KV+  V++  + I   KCVVIGLQSTGEA+T E LE+ GGE+ +FVS ARG+LQS +E+ FP  +
Sbjct:  251 TYAEYMPIKLKVGLRHPDPVVETSSLSSVTPPDVWFQTTIPEETIDNGWLSALQLEAVTYAAQQHETFLPNGERAGFLIGDGAGVGKGRTIAGIIFENYLLSRKRSLWFSVSNDLKYDAERDLRDIGAKNIQVHSLNKFKYGKISSKHNGSVKKGVIFATYSSLIGESQ--SGGKYKTRLKQLLHWCGEDFDGVIVFDECHKAKNLCPVGSSKPTKTGLAVLELQNKLPKARVVYASATGASEPRNMAYMSRLGIWGEGTPFREFNDFIQAVERRGVGAMEIVAMDMKLRGMYIARQLSFTGVTFKIEEVPLG------HDYVKMYNKSVKLWVLARERFQQAADLIDAEQRMKKSMWGQFWSAHQRFFKYLCIASKVRRVVQLAREEIKNGKCVVIGLQSTGEARTLEALEEGGGELNDFVSTARGVLQSLIEKHFPAPD 683          

HSP 2 Score: 355.525 bits (911), Expect = 3.904e-101
Identity = 208/497 (41.85%), Postives = 285/497 (57.34%), Query Frame = 3
Query: 2256 NNSMKTGADVSCRITQ--RELLDSIDRLAPKLPINTLDDLIRELGGPDYVAEMSGRKGRMVMDVNTGDVSYQPRREDDVTLEQVNMVEKERFNTCQKLVAIISDAASTGISLHADKRYENSLQRVHITLELPWSADRAIQQFGRTHRSNQIYPPEYVFLISDLAGERRFASTVAKRLESLGALTHGDRRATETRDLSQFNIDNKFGRRALDSIFDTAFKSKSSLVPMPKGIDLQAAFDSVGLQPKDGKNVSKFLNRILGMRLEVQNGLFQYYTDTMDELIKQAKRNQEFDRGIIDLAKEDDNIFVEETQVFRMTFLGDDIKVQLHRVKNITGMSWRSALEVPRGGNNSLDGFYIT-KNETQRKIVLAVQKKDRHGTWFNVFSPNVGEQSNLIENKSLNEAFKKATLEEAERMWNDMYSVTENRCLHYFWYKHCNYSK---NCDTGCRSKIRYVLSGSIFYIWD-------IISAINKSPQLARVRLNDGSKIIGCII 3707
            +NS  T  D   R  Q  +ELLD ++ LA  LP NTLD+LI ELGGPD VAEM+GRKGR+V + + G +SY+ R E DV +E +N+ EK+RF   +K +AIIS+AAS+GISL AD+R +N  +RVH+TLELPWSADRAIQQFGRTHRSNQ+  PEYVFLIS+LAGE+RFAS VAKRLESLGALTHGDRRATE+RDLS+FN DNK+GR AL+ +  +     S L            +D                          +  LF         +I+ AK+N  +D GI+DL   D+ +   + + F          V+L+ +    GMSW  A ++        DGFY++ +    +K  + V++ +     F V+ PN G+Q  L     L + +KK T E+A+  W + Y  + + C H +W  +C  +     C+ G R +  YVL GS+  +W         +S  N   Q+ R+R  DG +I+G II
Sbjct:  855 SNSCVTSQDAVERAQQMKKELLDKLENLAEALPPNTLDELIDELGGPDNVAEMTGRKGRVVSN-DDGSISYESRSELDVPVEILNITEKQRFMDGEKNIAIISEAASSGISLQADRRAKNQRRRVHMTLELPWSADRAIQQFGRTHRSNQVTAPEYVFLISELAGEQRFASIVAKRLESLGALTHGDRRATESRDLSRFNFDNKYGRNALEIVMKSIVSLDSPL------------YD-----------------------YHFKGKLF------FHAVIQNAKKNGRYDMGILDLGSGDEKVRKSDAKKFLTPGYSTSGHVELYTISVERGMSWEDATKIWAEQTGPDDGFYLSLQIRNNKKTGILVKEINPKKKLFLVYRPNTGKQLKLETLLDLKKKYKKVTSEDAQSHWKEQYISSADICTHAYWRGNCKKASLGLVCEIGLRCRTYYVLCGSVLSVWTKVEGVLASVSGTNVKMQIVRLRTEDGQRIVGLII 1309          
BLAST of Protein strawberry notch homolog 1 vs. Ensembl Xenopus
Match: sidt2 (SID1 transmembrane family member 2 [Source:Xenbase;Acc:XB-GENE-982521])

HSP 1 Score: 532.717 bits (1371), Expect = 2.975e-164
Identity = 262/440 (59.55%), Postives = 336/440 (76.36%), Query Frame = 3
Query:  630 YSQYQPLKLRKGKVHPYXXXXXXXXXXXXXXXXRYCLSLPDGIIQNALLSNVQLEAVIYGCQRHEEILPTGERAGYLIGDGAGVGKGRTLAAIIYENYILHRKRAVWISVSNDLKHDAERDLCDLDANHIKIHPLNKMRYAKINSPENGNVRKGVLFSTYASLIGECQNMTKSKYKTRFRQIVQWFGTDYDGVIVFDECHKAKNLMPQGSQKKTKTAEIVLKLQETLPKARIVYASATGASEPRNMAYMTRLGLWGPGTPFKKFEDFVEKLEDK-VGAMELVAVDMKQRGMYIARQLSFANVTFRVHEVQLTNVKIGEHYFMNVYNESVDLWTRIFDNMNQALNTRFIAKKHAKTVWGQYWAAHQRFFKYLCMAGKVQECVRITMDAITQHKCVVIGLQSTGEAKTNEMLEDYGGEVTEFVSCARGILQSFVERFFPTEE 1946
            Y++Y P+KL+ G  HP PVVE+SSLSSV  P+V +  ++P+  I N  LS +QLEAV Y  Q+HE  LP GERAG+LIGDGAGVGKGRT+A II+ENY+L RKR++W SVSNDLK+DAERDL D+ A +I++H LNK +Y KI+S  NG+V+KGV+F+TY+SLIGE Q  +  KYKTR +Q++ W G D+DGVIVFDECHKAKNL P GS K TKT   VL+LQ  LPKAR+VYASATGASEPRNMAYM+RLG+WG GTPF++F DF++ +E + VGAME+VA+DMK RGMYIARQLSF  VTF++ EV L       H ++ +YN+SV LW    +   QA +     ++  K++WGQ+W+AHQRFFKYLC+A KV+  V++  + I   KCVVIGLQSTGEA+T E LE+ GGE+ +FVS ARG+LQS +E+ FP  +
Sbjct:  237 YAEYMPIKLKVGLRHPDPVVETSSLSSVTPPDVWFQTTIPEETIDNGWLSALQLEAVTYAAQQHETFLPNGERAGFLIGDGAGVGKGRTIAGIIFENYLLSRKRSLWFSVSNDLKYDAERDLRDIGAKNIQVHSLNKFKYGKISSKHNGSVKKGVIFATYSSLIGESQ--SGGKYKTRLKQLLHWCGEDFDGVIVFDECHKAKNLCPVGSSKPTKTGLAVLELQNKLPKARVVYASATGASEPRNMAYMSRLGIWGEGTPFREFNDFIQAVERRGVGAMEIVAMDMKLRGMYIARQLSFTGVTFKIEEVPLG------HDYVKMYNKSVKLWVLARERFQQAADLIDAEQRMKKSMWGQFWSAHQRFFKYLCIASKVRRVVQLAREEIKNGKCVVIGLQSTGEARTLEALEEGGGELNDFVSTARGVLQSLIEKHFPAPD 668          

HSP 2 Score: 413.69 bits (1062), Expect = 4.309e-121
Identity = 231/514 (44.94%), Postives = 313/514 (60.89%), Query Frame = 3
Query: 2256 NNSMKTGADVSCRITQ--RELLDSIDRLAPKLPINTLDDLIRELGGPDYVAEMSGRKGRMVMDVNTGDVSYQPRREDDVTLEQVNMVEKERFNTCQKLVAIISDAASTGISLHADKRYENSLQRVHITLELPWSADRAIQQFGRTHRSNQIYPPEYVFLISDLAGERRFASTVAKRLESLGALTHGDRRATETRDLSQFNIDNKFGRRALDSIFDTAFKSKSSLVPMPKGI------DLQAAFDSVGL-----------QPKDGKNVSKFLNRILGMRLEVQNGLFQYYTDTMDELIKQAKRNQEFDRGIIDLAKEDDNIFVEETQVFRMTFLGDDIKVQLHRVKNITGMSWRSALEVPRGGNNSLDGFYIT-KNETQRKIVLAVQKKDRHGTWFNVFSPNVGEQSNLIENKSLNEAFKKATLEEAERMWNDMYSVTENRCLHYFWYKHCNYSK---NCDTGCRSKIRYVLSGSIFYIWD-------IISAINKSPQLARVRLNDGSKIIGCII 3707
            +NS  T  D   R  Q  +ELLD ++ LA  LP NTLD+LI ELGGPD VAEM+GRKGR+V + + G +SY+ R E DV +E +N+ EK+RF   +K +AIIS+AAS+GISL AD+R +N  +RVH+TLELPWSADRAIQQFGRTHRSNQ+  PEYVFLIS+LAGE+RFAS VAKRLESLGALTHGDRRATE+RDLS+FN DNK+GR AL+ +  +     S LV  P         D++     VGL             KD  N+ KFLNRILGM +  QN LFQY++DT+  +I+ AK+N  +D GI+DL   D+ +   + + F          V+L+ +    GMSW  A ++        DGFY++ +    +K  + V++ +     F V+ PN G+Q  L     L + +KK T E+A+  W + Y  + + C H +W  +C  +     C+ G R +  YVL GS+  +W         +S  N   Q+ R+R  DG +I+G II
Sbjct:  840 SNSCVTSQDAVERAQQMKKELLDKLENLAEALPPNTLDELIDELGGPDNVAEMTGRKGRVVSN-DDGSISYESRSELDVPVEILNITEKQRFMDGEKNIAIISEAASSGISLQADRRAKNQRRRVHMTLELPWSADRAIQQFGRTHRSNQVTAPEYVFLISELAGEQRFASIVAKRLESLGALTHGDRRATESRDLSRFNFDNKYGRNALEIVMKSIVSLDSPLVSPPPEFPGDFFKDVRQGLIGVGLINVEDRSGILTLDKDYNNIGKFLNRILGMEVHQQNALFQYFSDTLSAVIQNAKKNGRYDMGILDLGSGDEKVRKSDAKKFLTPGYSTSGHVELYTISVERGMSWEDATKIWAEQTGPDDGFYLSLQIRNNKKTGILVKEINPKKKLFLVYRPNTGKQLKLETLLDLKKKYKKVTSEDAQSHWKEQYISSADICTHAYWRGNCKKASLGLVCEIGLRCRTYYVLCGSVLSVWTKVEGVLASVSGTNVKMQIVRLRTEDGQRIVGLII 1352          
BLAST of Protein strawberry notch homolog 1 vs. Ensembl Xenopus
Match: sidt2 (SID1 transmembrane family member 2 [Source:Xenbase;Acc:XB-GENE-982521])

HSP 1 Score: 532.332 bits (1370), Expect = 5.737e-164
Identity = 262/440 (59.55%), Postives = 336/440 (76.36%), Query Frame = 3
Query:  630 YSQYQPLKLRKGKVHPYXXXXXXXXXXXXXXXXRYCLSLPDGIIQNALLSNVQLEAVIYGCQRHEEILPTGERAGYLIGDGAGVGKGRTLAAIIYENYILHRKRAVWISVSNDLKHDAERDLCDLDANHIKIHPLNKMRYAKINSPENGNVRKGVLFSTYASLIGECQNMTKSKYKTRFRQIVQWFGTDYDGVIVFDECHKAKNLMPQGSQKKTKTAEIVLKLQETLPKARIVYASATGASEPRNMAYMTRLGLWGPGTPFKKFEDFVEKLEDK-VGAMELVAVDMKQRGMYIARQLSFANVTFRVHEVQLTNVKIGEHYFMNVYNESVDLWTRIFDNMNQALNTRFIAKKHAKTVWGQYWAAHQRFFKYLCMAGKVQECVRITMDAITQHKCVVIGLQSTGEAKTNEMLEDYGGEVTEFVSCARGILQSFVERFFPTEE 1946
            Y++Y P+KL+ G  HP PVVE+SSLSSV  P+V +  ++P+  I N  LS +QLEAV Y  Q+HE  LP GERAG+LIGDGAGVGKGRT+A II+ENY+L RKR++W SVSNDLK+DAERDL D+ A +I++H LNK +Y KI+S  NG+V+KGV+F+TY+SLIGE Q  +  KYKTR +Q++ W G D+DGVIVFDECHKAKNL P GS K TKT   VL+LQ  LPKAR+VYASATGASEPRNMAYM+RLG+WG GTPF++F DF++ +E + VGAME+VA+DMK RGMYIARQLSF  VTF++ EV L       H ++ +YN+SV LW    +   QA +     ++  K++WGQ+W+AHQRFFKYLC+A KV+  V++  + I   KCVVIGLQSTGEA+T E LE+ GGE+ +FVS ARG+LQS +E+ FP  +
Sbjct:  252 YAEYMPIKLKVGLRHPDPVVETSSLSSVTPPDVWFQTTIPEETIDNGWLSALQLEAVTYAAQQHETFLPNGERAGFLIGDGAGVGKGRTIAGIIFENYLLSRKRSLWFSVSNDLKYDAERDLRDIGAKNIQVHSLNKFKYGKISSKHNGSVKKGVIFATYSSLIGESQ--SGGKYKTRLKQLLHWCGEDFDGVIVFDECHKAKNLCPVGSSKPTKTGLAVLELQNKLPKARVVYASATGASEPRNMAYMSRLGIWGEGTPFREFNDFIQAVERRGVGAMEIVAMDMKLRGMYIARQLSFTGVTFKIEEVPLG------HDYVKMYNKSVKLWVLARERFQQAADLIDAEQRMKKSMWGQFWSAHQRFFKYLCIASKVRRVVQLAREEIKNGKCVVIGLQSTGEARTLEALEEGGGELNDFVSTARGVLQSLIEKHFPAPD 683          

HSP 2 Score: 413.69 bits (1062), Expect = 5.068e-121
Identity = 231/514 (44.94%), Postives = 313/514 (60.89%), Query Frame = 3
Query: 2256 NNSMKTGADVSCRITQ--RELLDSIDRLAPKLPINTLDDLIRELGGPDYVAEMSGRKGRMVMDVNTGDVSYQPRREDDVTLEQVNMVEKERFNTCQKLVAIISDAASTGISLHADKRYENSLQRVHITLELPWSADRAIQQFGRTHRSNQIYPPEYVFLISDLAGERRFASTVAKRLESLGALTHGDRRATETRDLSQFNIDNKFGRRALDSIFDTAFKSKSSLVPMPKGI------DLQAAFDSVGL-----------QPKDGKNVSKFLNRILGMRLEVQNGLFQYYTDTMDELIKQAKRNQEFDRGIIDLAKEDDNIFVEETQVFRMTFLGDDIKVQLHRVKNITGMSWRSALEVPRGGNNSLDGFYIT-KNETQRKIVLAVQKKDRHGTWFNVFSPNVGEQSNLIENKSLNEAFKKATLEEAERMWNDMYSVTENRCLHYFWYKHCNYSK---NCDTGCRSKIRYVLSGSIFYIWD-------IISAINKSPQLARVRLNDGSKIIGCII 3707
            +NS  T  D   R  Q  +ELLD ++ LA  LP NTLD+LI ELGGPD VAEM+GRKGR+V + + G +SY+ R E DV +E +N+ EK+RF   +K +AIIS+AAS+GISL AD+R +N  +RVH+TLELPWSADRAIQQFGRTHRSNQ+  PEYVFLIS+LAGE+RFAS VAKRLESLGALTHGDRRATE+RDLS+FN DNK+GR AL+ +  +     S LV  P         D++     VGL             KD  N+ KFLNRILGM +  QN LFQY++DT+  +I+ AK+N  +D GI+DL   D+ +   + + F          V+L+ +    GMSW  A ++        DGFY++ +    +K  + V++ +     F V+ PN G+Q  L     L + +KK T E+A+  W + Y  + + C H +W  +C  +     C+ G R +  YVL GS+  +W         +S  N   Q+ R+R  DG +I+G II
Sbjct:  855 SNSCVTSQDAVERAQQMKKELLDKLENLAEALPPNTLDELIDELGGPDNVAEMTGRKGRVVSN-DDGSISYESRSELDVPVEILNITEKQRFMDGEKNIAIISEAASSGISLQADRRAKNQRRRVHMTLELPWSADRAIQQFGRTHRSNQVTAPEYVFLISELAGEQRFASIVAKRLESLGALTHGDRRATESRDLSRFNFDNKYGRNALEIVMKSIVSLDSPLVSPPPEFPGDFFKDVRQGLIGVGLINVEDRSGILTLDKDYNNIGKFLNRILGMEVHQQNALFQYFSDTLSAVIQNAKKNGRYDMGILDLGSGDEKVRKSDAKKFLTPGYSTSGHVELYTISVERGMSWEDATKIWAEQTGPDDGFYLSLQIRNNKKTGILVKEINPKKKLFLVYRPNTGKQLKLETLLDLKKKYKKVTSEDAQSHWKEQYISSADICTHAYWRGNCKKASLGLVCEIGLRCRTYYVLCGSVLSVWTKVEGVLASVSGTNVKMQIVRLRTEDGQRIVGLII 1367          
BLAST of Protein strawberry notch homolog 1 vs. Ensembl Mouse
Match: Sbno1 (strawberry notch 1 [Source:MGI Symbol;Acc:MGI:2384298])

HSP 1 Score: 524.242 bits (1349), Expect = 1.267e-169
Identity = 260/440 (59.09%), Postives = 332/440 (75.45%), Query Frame = 3
Query:  630 YSQYQPLKLRKGKVHPYXXXXXXXXXXXXXXXXRYCLSLPDGIIQNALLSNVQLEAVIYGCQRHEEILPTGERAGYLIGDGAGVGKGRTLAAIIYENYILHRKRAVWISVSNDLKHDAERDLCDLDANHIKIHPLNKMRYAKINSPENGNVRKGVLFSTYASLIGECQNMTKSKYKTRFRQIVQWFGTDYDGVIVFDECHKAKNLMPQGSQKKTKTAEIVLKLQETLPKARIVYASATGASEPRNMAYMTRLGLWGPGTPFKKFEDFVEKLEDK-VGAMELVAVDMKQRGMYIARQLSFANVTFRVHEVQLTNVKIGEHYFMNVYNESVDLWTRIFDNMNQALNTRFIAKKHAKTVWGQYWAAHQRFFKYLCMAGKVQECVRITMDAITQHKCVVIGLQSTGEAKTNEMLEDYGGEVTEFVSCARGILQSFVERFFPTEE 1946
            Y++Y P+KL+ G  HP  VVE+SSLSSV  P+V Y  S+ +  I N  LS +QLEAV Y  Q+HE  LP G+RAG+LIGDGAGVGKGRT+A IIYENY+L RKRA+W SVSNDLK+DAERDL D+ A +I +H LNK +Y KI+S  NG+V+KGV+F+TY+SLIGE Q  +  KYKTR +Q++ W G D+DGVIVFDECHKAKNL P GS K TKT   VL+LQ  LPKAR+VYASATGASEPRNMAYM RLG+WG GTPF++F DF++ +E + VGAME+VA+DMK RGMYIARQLSF  VTF++ EV L+        ++ +YN++V LW    +   QA +     ++  K++WGQ+W+AHQRFFKYLC+A KV+  V++  + I   KCVVIGLQSTGEA+T E LE+ GGE+ +FVS A+G+LQS +E+ FP  +
Sbjct:  206 YAEYMPIKLKIGLRHPDAVVETSSLSSVTPPDVWYKTSISEETIDNGWLSALQLEAVTYAAQQHETFLPNGDRAGFLIGDGAGVGKGRTIAGIIYENYLLSRKRALWFSVSNDLKYDAERDLRDIGAKNILVHSLNKFKYGKISSKHNGSVKKGVIFATYSSLIGESQ--SGGKYKTRLKQLLHWCGDDFDGVIVFDECHKAKNLCPVGSSKPTKTGLAVLELQNKLPKARVVYASATGASEPRNMAYMNRLGIWGEGTPFREFSDFIQAVERRGVGAMEIVAMDMKLRGMYIARQLSFTGVTFKIEEVLLS------QSYVKMYNKAVKLWVIARERFQQAADLIDAEQRMKKSMWGQFWSAHQRFFKYLCIASKVKRVVQLAREEIKNGKCVVIGLQSTGEARTLEALEEGGGELNDFVSTAKGVLQSLIEKHFPAPD 637          
BLAST of Protein strawberry notch homolog 1 vs. Ensembl Mouse
Match: Sbno1 (strawberry notch 1 [Source:MGI Symbol;Acc:MGI:2384298])

HSP 1 Score: 525.398 bits (1352), Expect = 8.339e-169
Identity = 260/441 (58.96%), Postives = 332/441 (75.28%), Query Frame = 3
Query:  627 VYSQYQPLKLRKGKVHPYXXXXXXXXXXXXXXXXRYCLSLPDGIIQNALLSNVQLEAVIYGCQRHEEILPTGERAGYLIGDGAGVGKGRTLAAIIYENYILHRKRAVWISVSNDLKHDAERDLCDLDANHIKIHPLNKMRYAKINSPENGNVRKGVLFSTYASLIGECQNMTKSKYKTRFRQIVQWFGTDYDGVIVFDECHKAKNLMPQGSQKKTKTAEIVLKLQETLPKARIVYASATGASEPRNMAYMTRLGLWGPGTPFKKFEDFVEKLEDK-VGAMELVAVDMKQRGMYIARQLSFANVTFRVHEVQLTNVKIGEHYFMNVYNESVDLWTRIFDNMNQALNTRFIAKKHAKTVWGQYWAAHQRFFKYLCMAGKVQECVRITMDAITQHKCVVIGLQSTGEAKTNEMLEDYGGEVTEFVSCARGILQSFVERFFPTEE 1946
             Y++Y P+KL+ G  HP  VVE+SSLSSV  P+V Y  S+ +  I N  LS +QLEAV Y  Q+HE  LP G+RAG+LIGDGAGVGKGRT+A IIYENY+L RKRA+W SVSNDLK+DAERDL D+ A +I +H LNK +Y KI+S  NG+V+KGV+F+TY+SLIGE Q  +  KYKTR +Q++ W G D+DGVIVFDECHKAKNL P GS K TKT   VL+LQ  LPKAR+VYASATGASEPRNMAYM RLG+WG GTPF++F DF++ +E + VGAME+VA+DMK RGMYIARQLSF  VTF++ EV L+        ++ +YN++V LW    +   QA +     ++  K++WGQ+W+AHQRFFKYLC+A KV+  V++  + I   KCVVIGLQSTGEA+T E LE+ GGE+ +FVS A+G+LQS +E+ FP  +
Sbjct:  204 TYAEYMPIKLKIGLRHPDAVVETSSLSSVTPPDVWYKTSISEETIDNGWLSALQLEAVTYAAQQHETFLPNGDRAGFLIGDGAGVGKGRTIAGIIYENYLLSRKRALWFSVSNDLKYDAERDLRDIGAKNILVHSLNKFKYGKISSKHNGSVKKGVIFATYSSLIGESQ--SGGKYKTRLKQLLHWCGDDFDGVIVFDECHKAKNLCPVGSSKPTKTGLAVLELQNKLPKARVVYASATGASEPRNMAYMNRLGIWGEGTPFREFSDFIQAVERRGVGAMEIVAMDMKLRGMYIARQLSFTGVTFKIEEVLLS------QSYVKMYNKAVKLWVIARERFQQAADLIDAEQRMKKSMWGQFWSAHQRFFKYLCIASKVKRVVQLAREEIKNGKCVVIGLQSTGEARTLEALEEGGGELNDFVSTAKGVLQSLIEKHFPAPD 636          
BLAST of Protein strawberry notch homolog 1 vs. Ensembl Mouse
Match: Sbno1 (strawberry notch 1 [Source:MGI Symbol;Acc:MGI:2384298])

HSP 1 Score: 525.783 bits (1353), Expect = 1.369e-168
Identity = 260/441 (58.96%), Postives = 332/441 (75.28%), Query Frame = 3
Query:  627 VYSQYQPLKLRKGKVHPYXXXXXXXXXXXXXXXXRYCLSLPDGIIQNALLSNVQLEAVIYGCQRHEEILPTGERAGYLIGDGAGVGKGRTLAAIIYENYILHRKRAVWISVSNDLKHDAERDLCDLDANHIKIHPLNKMRYAKINSPENGNVRKGVLFSTYASLIGECQNMTKSKYKTRFRQIVQWFGTDYDGVIVFDECHKAKNLMPQGSQKKTKTAEIVLKLQETLPKARIVYASATGASEPRNMAYMTRLGLWGPGTPFKKFEDFVEKLEDK-VGAMELVAVDMKQRGMYIARQLSFANVTFRVHEVQLTNVKIGEHYFMNVYNESVDLWTRIFDNMNQALNTRFIAKKHAKTVWGQYWAAHQRFFKYLCMAGKVQECVRITMDAITQHKCVVIGLQSTGEAKTNEMLEDYGGEVTEFVSCARGILQSFVERFFPTEE 1946
             Y++Y P+KL+ G  HP  VVE+SSLSSV  P+V Y  S+ +  I N  LS +QLEAV Y  Q+HE  LP G+RAG+LIGDGAGVGKGRT+A IIYENY+L RKRA+W SVSNDLK+DAERDL D+ A +I +H LNK +Y KI+S  NG+V+KGV+F+TY+SLIGE Q  +  KYKTR +Q++ W G D+DGVIVFDECHKAKNL P GS K TKT   VL+LQ  LPKAR+VYASATGASEPRNMAYM RLG+WG GTPF++F DF++ +E + VGAME+VA+DMK RGMYIARQLSF  VTF++ EV L+        ++ +YN++V LW    +   QA +     ++  K++WGQ+W+AHQRFFKYLC+A KV+  V++  + I   KCVVIGLQSTGEA+T E LE+ GGE+ +FVS A+G+LQS +E+ FP  +
Sbjct:  240 TYAEYMPIKLKIGLRHPDAVVETSSLSSVTPPDVWYKTSISEETIDNGWLSALQLEAVTYAAQQHETFLPNGDRAGFLIGDGAGVGKGRTIAGIIYENYLLSRKRALWFSVSNDLKYDAERDLRDIGAKNILVHSLNKFKYGKISSKHNGSVKKGVIFATYSSLIGESQ--SGGKYKTRLKQLLHWCGDDFDGVIVFDECHKAKNLCPVGSSKPTKTGLAVLELQNKLPKARVVYASATGASEPRNMAYMNRLGIWGEGTPFREFSDFIQAVERRGVGAMEIVAMDMKLRGMYIARQLSFTGVTFKIEEVLLS------QSYVKMYNKAVKLWVIARERFQQAADLIDAEQRMKKSMWGQFWSAHQRFFKYLCIASKVKRVVQLAREEIKNGKCVVIGLQSTGEARTLEALEEGGGELNDFVSTAKGVLQSLIEKHFPAPD 672          
BLAST of Protein strawberry notch homolog 1 vs. Ensembl Mouse
Match: Sbno1 (strawberry notch 1 [Source:MGI Symbol;Acc:MGI:2384298])

HSP 1 Score: 526.168 bits (1354), Expect = 5.583e-162
Identity = 260/440 (59.09%), Postives = 332/440 (75.45%), Query Frame = 3
Query:  630 YSQYQPLKLRKGKVHPYXXXXXXXXXXXXXXXXRYCLSLPDGIIQNALLSNVQLEAVIYGCQRHEEILPTGERAGYLIGDGAGVGKGRTLAAIIYENYILHRKRAVWISVSNDLKHDAERDLCDLDANHIKIHPLNKMRYAKINSPENGNVRKGVLFSTYASLIGECQNMTKSKYKTRFRQIVQWFGTDYDGVIVFDECHKAKNLMPQGSQKKTKTAEIVLKLQETLPKARIVYASATGASEPRNMAYMTRLGLWGPGTPFKKFEDFVEKLEDK-VGAMELVAVDMKQRGMYIARQLSFANVTFRVHEVQLTNVKIGEHYFMNVYNESVDLWTRIFDNMNQALNTRFIAKKHAKTVWGQYWAAHQRFFKYLCMAGKVQECVRITMDAITQHKCVVIGLQSTGEAKTNEMLEDYGGEVTEFVSCARGILQSFVERFFPTEE 1946
            Y++Y P+KL+ G  HP  VVE+SSLSSV  P+V Y  S+ +  I N  LS +QLEAV Y  Q+HE  LP G+RAG+LIGDGAGVGKGRT+A IIYENY+L RKRA+W SVSNDLK+DAERDL D+ A +I +H LNK +Y KI+S  NG+V+KGV+F+TY+SLIGE Q  +  KYKTR +Q++ W G D+DGVIVFDECHKAKNL P GS K TKT   VL+LQ  LPKAR+VYASATGASEPRNMAYM RLG+WG GTPF++F DF++ +E + VGAME+VA+DMK RGMYIARQLSF  VTF++ EV L+        ++ +YN++V LW    +   QA +     ++  K++WGQ+W+AHQRFFKYLC+A KV+  V++  + I   KCVVIGLQSTGEA+T E LE+ GGE+ +FVS A+G+LQS +E+ FP  +
Sbjct:  240 YAEYMPIKLKIGLRHPDAVVETSSLSSVTPPDVWYKTSISEETIDNGWLSALQLEAVTYAAQQHETFLPNGDRAGFLIGDGAGVGKGRTIAGIIYENYLLSRKRALWFSVSNDLKYDAERDLRDIGAKNILVHSLNKFKYGKISSKHNGSVKKGVIFATYSSLIGESQ--SGGKYKTRLKQLLHWCGDDFDGVIVFDECHKAKNLCPVGSSKPTKTGLAVLELQNKLPKARVVYASATGASEPRNMAYMNRLGIWGEGTPFREFSDFIQAVERRGVGAMEIVAMDMKLRGMYIARQLSFTGVTFKIEEVLLS------QSYVKMYNKAVKLWVIARERFQQAADLIDAEQRMKKSMWGQFWSAHQRFFKYLCIASKVKRVVQLAREEIKNGKCVVIGLQSTGEARTLEALEEGGGELNDFVSTAKGVLQSLIEKHFPAPD 671          

HSP 2 Score: 411.379 bits (1056), Expect = 1.735e-120
Identity = 221/520 (42.50%), Postives = 313/520 (60.19%), Query Frame = 3
Query: 2301 QRELLDSIDRLAPKLPINTLDDLIRELGGPDYVAEMSGRKGRMVMDVNTGDVSYQPRREDDVTLEQVNMVEKERFNTCQKLVAIISDAASTGISLHADKRYENSLQRVHITLELPWSADRAIQQFGRTHRSNQIYPPEYVFLISDLAGERRFASTVAKRLESLGALTHGDRRATETRDLSQFNIDNKFGRRALDSIFDTAFKSKSSLVPMPKGI------DLQAAFDSVGL-----------QPKDGKNVSKFLNRILGMRLEVQNGLFQYYTDTMDELIKQAKRNQEFDRGIIDLAKEDDNIFVEETQVFRMTFLGDDIKVQLHRVKNITGMSWRSALEVPRGGNNSLDGFYIT-KNETQRKIVLAVQKKDRHGTWFNVFSPNVGEQSNLIENKSLNEAFKKATLEEAERMWNDMYSVTENRCLHYFWYKHCNYSK---NCDTGCRSKIRYVLSGSIFYIWD-------IISAINKSPQLARVRLNDGSKIIGCIINPSHKERITEILANRESHPQQTI 3776
            +++LLD +++LA  LP NTLD+LI ELGGP+ VAEM+GRKGR+V + + G +SY+ R E DV +E +N+ EK+RF    K +AIIS+AAS+GISL AD+R +N  +RVH+TLELPWSADRAIQQFGRTHRSNQ+  PEYVFLIS+LAGE+RFAS VAKRLESLGALTHGDRRATE+RDLS+FN DNK+GR AL+ +  +     S +V  P         D++     VGL             KD  N+ KFLNRILGM +  QN LFQY+ DT+  +++ AK+N  +D GI+DL   D+ +   + + F          V+L+ +    GMSW  A ++        DGFY++ +    +K  + V++ +     F ++ PN G+Q  L     L + +KK   ++A   W D Y+ + + C H +W  +C  +     C+ G R +  YVL GS+  +W         +S  N   Q+ R+R  DG +I+G II  +    +  +L+  +   Q  +
Sbjct:  852 KKDLLDKLEKLAEDLPPNTLDELIDELGGPENVAEMTGRKGRVVSN-DDGSISYESRSELDVPVEILNITEKQRFMDGDKNIAIISEAASSGISLQADRRAKNQRRRVHMTLELPWSADRAIQQFGRTHRSNQVTAPEYVFLISELAGEQRFASIVAKRLESLGALTHGDRRATESRDLSRFNFDNKYGRNALEIVMKSIVNLDSPMVSPPPDYPGEFFKDVRQGLIGVGLINVEDRSGILTLDKDYNNIGKFLNRILGMEVHQQNALFQYFADTLTAVVQNAKKNGRYDMGILDLGSGDEKVRKSDVKKFLTPGYSTSGHVELYTISVERGMSWEEATKIWAELTGPDDGFYLSLQIRNNKKTAILVKEVNPKKKLFLIYRPNTGKQLKLEIYADLKKKYKKVVSDDALVHWLDQYNSSADTCTHAYWRGNCKKASLGLVCEIGLRCRTYYVLCGSVLSVWTKVEGVLASVSGTNVKMQIVRLRTEDGQRIVGLIIPANCVSPLVNLLSTSDQSQQLAV 1370          
BLAST of Protein strawberry notch homolog 1 vs. Ensembl Mouse
Match: Sbno1 (strawberry notch 1 [Source:MGI Symbol;Acc:MGI:2384298])

HSP 1 Score: 525.783 bits (1353), Expect = 6.443e-162
Identity = 260/440 (59.09%), Postives = 332/440 (75.45%), Query Frame = 3
Query:  630 YSQYQPLKLRKGKVHPYXXXXXXXXXXXXXXXXRYCLSLPDGIIQNALLSNVQLEAVIYGCQRHEEILPTGERAGYLIGDGAGVGKGRTLAAIIYENYILHRKRAVWISVSNDLKHDAERDLCDLDANHIKIHPLNKMRYAKINSPENGNVRKGVLFSTYASLIGECQNMTKSKYKTRFRQIVQWFGTDYDGVIVFDECHKAKNLMPQGSQKKTKTAEIVLKLQETLPKARIVYASATGASEPRNMAYMTRLGLWGPGTPFKKFEDFVEKLEDK-VGAMELVAVDMKQRGMYIARQLSFANVTFRVHEVQLTNVKIGEHYFMNVYNESVDLWTRIFDNMNQALNTRFIAKKHAKTVWGQYWAAHQRFFKYLCMAGKVQECVRITMDAITQHKCVVIGLQSTGEAKTNEMLEDYGGEVTEFVSCARGILQSFVERFFPTEE 1946
            Y++Y P+KL+ G  HP  VVE+SSLSSV  P+V Y  S+ +  I N  LS +QLEAV Y  Q+HE  LP G+RAG+LIGDGAGVGKGRT+A IIYENY+L RKRA+W SVSNDLK+DAERDL D+ A +I +H LNK +Y KI+S  NG+V+KGV+F+TY+SLIGE Q  +  KYKTR +Q++ W G D+DGVIVFDECHKAKNL P GS K TKT   VL+LQ  LPKAR+VYASATGASEPRNMAYM RLG+WG GTPF++F DF++ +E + VGAME+VA+DMK RGMYIARQLSF  VTF++ EV L+        ++ +YN++V LW    +   QA +     ++  K++WGQ+W+AHQRFFKYLC+A KV+  V++  + I   KCVVIGLQSTGEA+T E LE+ GGE+ +FVS A+G+LQS +E+ FP  +
Sbjct:  241 YAEYMPIKLKIGLRHPDAVVETSSLSSVTPPDVWYKTSISEETIDNGWLSALQLEAVTYAAQQHETFLPNGDRAGFLIGDGAGVGKGRTIAGIIYENYLLSRKRALWFSVSNDLKYDAERDLRDIGAKNILVHSLNKFKYGKISSKHNGSVKKGVIFATYSSLIGESQ--SGGKYKTRLKQLLHWCGDDFDGVIVFDECHKAKNLCPVGSSKPTKTGLAVLELQNKLPKARVVYASATGASEPRNMAYMNRLGIWGEGTPFREFSDFIQAVERRGVGAMEIVAMDMKLRGMYIARQLSFTGVTFKIEEVLLS------QSYVKMYNKAVKLWVIARERFQQAADLIDAEQRMKKSMWGQFWSAHQRFFKYLCIASKVKRVVQLAREEIKNGKCVVIGLQSTGEARTLEALEEGGGELNDFVSTAKGVLQSLIEKHFPAPD 672          

HSP 2 Score: 411.379 bits (1056), Expect = 1.903e-120
Identity = 221/520 (42.50%), Postives = 313/520 (60.19%), Query Frame = 3
Query: 2301 QRELLDSIDRLAPKLPINTLDDLIRELGGPDYVAEMSGRKGRMVMDVNTGDVSYQPRREDDVTLEQVNMVEKERFNTCQKLVAIISDAASTGISLHADKRYENSLQRVHITLELPWSADRAIQQFGRTHRSNQIYPPEYVFLISDLAGERRFASTVAKRLESLGALTHGDRRATETRDLSQFNIDNKFGRRALDSIFDTAFKSKSSLVPMPKGI------DLQAAFDSVGL-----------QPKDGKNVSKFLNRILGMRLEVQNGLFQYYTDTMDELIKQAKRNQEFDRGIIDLAKEDDNIFVEETQVFRMTFLGDDIKVQLHRVKNITGMSWRSALEVPRGGNNSLDGFYIT-KNETQRKIVLAVQKKDRHGTWFNVFSPNVGEQSNLIENKSLNEAFKKATLEEAERMWNDMYSVTENRCLHYFWYKHCNYSK---NCDTGCRSKIRYVLSGSIFYIWD-------IISAINKSPQLARVRLNDGSKIIGCIINPSHKERITEILANRESHPQQTI 3776
            +++LLD +++LA  LP NTLD+LI ELGGP+ VAEM+GRKGR+V + + G +SY+ R E DV +E +N+ EK+RF    K +AIIS+AAS+GISL AD+R +N  +RVH+TLELPWSADRAIQQFGRTHRSNQ+  PEYVFLIS+LAGE+RFAS VAKRLESLGALTHGDRRATE+RDLS+FN DNK+GR AL+ +  +     S +V  P         D++     VGL             KD  N+ KFLNRILGM +  QN LFQY+ DT+  +++ AK+N  +D GI+DL   D+ +   + + F          V+L+ +    GMSW  A ++        DGFY++ +    +K  + V++ +     F ++ PN G+Q  L     L + +KK   ++A   W D Y+ + + C H +W  +C  +     C+ G R +  YVL GS+  +W         +S  N   Q+ R+R  DG +I+G II  +    +  +L+  +   Q  +
Sbjct:  853 KKDLLDKLEKLAEDLPPNTLDELIDELGGPENVAEMTGRKGRVVSN-DDGSISYESRSELDVPVEILNITEKQRFMDGDKNIAIISEAASSGISLQADRRAKNQRRRVHMTLELPWSADRAIQQFGRTHRSNQVTAPEYVFLISELAGEQRFASIVAKRLESLGALTHGDRRATESRDLSRFNFDNKYGRNALEIVMKSIVNLDSPMVSPPPDYPGEFFKDVRQGLIGVGLINVEDRSGILTLDKDYNNIGKFLNRILGMEVHQQNALFQYFADTLTAVVQNAKKNGRYDMGILDLGSGDEKVRKSDVKKFLTPGYSTSGHVELYTISVERGMSWEEATKIWAELTGPDDGFYLSLQIRNNKKTAILVKEVNPKKKLFLIYRPNTGKQLKLEIYADLKKKYKKVVSDDALVHWLDQYNSSADTCTHAYWRGNCKKASLGLVCEIGLRCRTYYVLCGSVLSVWTKVEGVLASVSGTNVKMQIVRLRTEDGQRIVGLIIPANCVSPLVNLLSTSDQSQQLAV 1371          
BLAST of Protein strawberry notch homolog 1 vs. UniProt/SwissProt
Match: sp|Q5F371|SBNO1_CHICK (Protein strawberry notch homolog 1 OS=Gallus gallus OX=9031 GN=SBNO1 PE=2 SV=1)

HSP 1 Score: 526.939 bits (1356), Expect = 6.653e-163
Identity = 261/441 (59.18%), Postives = 333/441 (75.51%), Query Frame = 3
Query:  627 VYSQYQPLKLRKGKVHPYXXXXXXXXXXXXXXXXRYCLSLPDGIIQNALLSNVQLEAVIYGCQRHEEILPTGERAGYLIGDGAGVGKGRTLAAIIYENYILHRKRAVWISVSNDLKHDAERDLCDLDANHIKIHPLNKMRYAKINSPENGNVRKGVLFSTYASLIGECQNMTKSKYKTRFRQIVQWFGTDYDGVIVFDECHKAKNLMPQGSQKKTKTAEIVLKLQETLPKARIVYASATGASEPRNMAYMTRLGLWGPGTPFKKFEDFVEKLEDK-VGAMELVAVDMKQRGMYIARQLSFANVTFRVHEVQLTNVKIGEHYFMNVYNESVDLWTRIFDNMNQALNTRFIAKKHAKTVWGQYWAAHQRFFKYLCMAGKVQECVRITMDAITQHKCVVIGLQSTGEAKTNEMLEDYGGEVTEFVSCARGILQSFVERFFPTEE 1946
             Y++Y P+KL+ G  HP PVVE+SSLSSV  P+V Y  S+ +  I N  LS +QLEA+ Y  Q+HE  LP G+RAG+LIGDGAGVGKGRT+A IIYENY+L RKRAVW SVSNDLK+DAERDL D+ A +I +H LNK +Y KI+S  NG+V+KGV+F+TY+SLIGE Q  +  KYKTR +Q++ W G D+DGVIVFDECHKAKNL P GS K TKT   VL+LQ  LPKAR+VYASATGASEPRNMAYM RLG+WG GTPF++F DF++ +E + VGAME+VA+DMK RGMYIARQLSF+ VTF++ EV L+        ++ +YN+SV LW    +   QA +     ++  K++WGQ+W+AHQRFFKYLC+A KV+  V++  + I   KCVVIGLQSTGEA+T E LE+ GGE+ +FVS A+G+ QS +E+ FP  +
Sbjct:  238 TYAEYMPIKLKIGLRHPDPVVETSSLSSVTPPDVWYQTSISEETIDNGWLSALQLEAITYAAQQHETFLPNGDRAGFLIGDGAGVGKGRTIAGIIYENYLLGRKRAVWFSVSNDLKYDAERDLRDIGAKNILVHSLNKFKYGKISSKHNGSVKKGVIFATYSSLIGESQ--SGGKYKTRLKQLLHWCGEDFDGVIVFDECHKAKNLCPVGSSKPTKTGLAVLELQNKLPKARVVYASATGASEPRNMAYMNRLGIWGEGTPFREFSDFIQAVERRGVGAMEIVAMDMKLRGMYIARQLSFSGVTFKIDEVLLS------QEYVKMYNKSVKLWVSARERFQQAADLIDAEQRMKKSMWGQFWSAHQRFFKYLCIASKVKRVVQLAREEIKNGKCVVIGLQSTGEARTLEALEEGGGELNDFVSTAKGVFQSLIEKHFPAPD 670          

HSP 2 Score: 353.214 bits (905), Expect = 3.181e-100
Identity = 190/377 (50.40%), Postives = 248/377 (65.78%), Query Frame = 3
Query: 2241 SRSYENNSMKTGADVSCRITQ--RELLDSIDRLAPKLPINTLDDLIRELGGPDYVAEMSGRKGRMVMDVNTGDVSYQPRREDDVTLEQVNMVEKERFNTCQKLVAIISDAASTGISLHADKRYENSLQRVHITLELPWSADRAIQQFGRTHRSNQIYPPEYVFLISDLAGERRFASTVAKRLESLGALTHGDRRATETRDLSQFNIDNKFGRRALDSIFDTAFKSKSSLVPMPKGI------DLQAAFDSVGL-----------QPKDGKNVSKFLNRILGMRLEVQNGLFQYYTDTMDELIKQAKRNQEFDRGIIDLAKEDDNIFVEETQVFRMTFLGDDIKVQLHRVKNITGMSWRSALEVPRGGNNSLDGFYIT 3314
            + S  N+S  T  D   R  Q  +ELLD +++LA  LP NTLD+LI ELGGP+ VAEM+GRKGR+V + + G +SY+ R E DV +E +N+ EK+RF    K +AIIS+AAS+GISL AD+R +N  +RVH+TLELPWSADRAIQQFGRTHRSNQ+  PEYVFLIS+LAGE+RFAS VAKRLESLGALTHGDRRATETRDLS+FN DNK+GR AL+ +  +     S +V  P         D++     VGL             KD  N+ KFLNRILGM +  QN LFQY++DT++ +I+ AK+N  +D GI+DL   D+ +   + + F          V+L+ +    GMSW  A ++        DGFY++
Sbjct:  829 ANSNTNSSFVTSQDAVERAQQMKKELLDKLEKLAEDLPPNTLDELIDELGGPENVAEMTGRKGRVVSN-DDGSISYESRSELDVPVEILNITEKQRFMDGDKNIAIISEAASSGISLQADRRAKNQRRRVHMTLELPWSADRAIQQFGRTHRSNQVTAPEYVFLISELAGEQRFASIVAKRLESLGALTHGDRRATETRDLSRFNFDNKYGRNALEIVMKSIVNLDSPMVSPPPDFPGDFFKDVRQGLIGVGLINVEDRSGILTLDKDYNNIGKFLNRILGMEVHQQNALFQYFSDTLNAVIQNAKKNGRYDMGILDLGSGDEKVRKADVKKFLTPGYSTSGHVELYTISVERGMSWDEATKIWAEQTGPDDGFYLS 1204          
BLAST of Protein strawberry notch homolog 1 vs. UniProt/SwissProt
Match: sp|Q5BJL5|SBNO1_RAT (Protein strawberry notch homolog 1 OS=Rattus norvegicus OX=10116 GN=Sbno1 PE=1 SV=2)

HSP 1 Score: 525.398 bits (1352), Expect = 5.022e-162
Identity = 260/440 (59.09%), Postives = 332/440 (75.45%), Query Frame = 3
Query:  630 YSQYQPLKLRKGKVHPYXXXXXXXXXXXXXXXXRYCLSLPDGIIQNALLSNVQLEAVIYGCQRHEEILPTGERAGYLIGDGAGVGKGRTLAAIIYENYILHRKRAVWISVSNDLKHDAERDLCDLDANHIKIHPLNKMRYAKINSPENGNVRKGVLFSTYASLIGECQNMTKSKYKTRFRQIVQWFGTDYDGVIVFDECHKAKNLMPQGSQKKTKTAEIVLKLQETLPKARIVYASATGASEPRNMAYMTRLGLWGPGTPFKKFEDFVEKLEDK-VGAMELVAVDMKQRGMYIARQLSFANVTFRVHEVQLTNVKIGEHYFMNVYNESVDLWTRIFDNMNQALNTRFIAKKHAKTVWGQYWAAHQRFFKYLCMAGKVQECVRITMDAITQHKCVVIGLQSTGEAKTNEMLEDYGGEVTEFVSCARGILQSFVERFFPTEE 1946
            Y++Y P+KL+ G  HP  VVE+SSLSSV  P+V Y  S+ +  I N  LS +QLEAV Y  Q+HE  LP G+RAG+LIGDGAGVGKGRT+A IIYENY+L RKRA+W SVSNDLK+DAERDL D+ A +I +H LNK +Y KI+S  NG+V+KGV+F+TY+SLIGE Q  +  KYKTR +Q++ W G D+DGVIVFDECHKAKNL P GS K TKT   VL+LQ  LPKAR+VYASATGASEPRNMAYM RLG+WG GTPF++F DF++ +E + VGAME+VA+DMK RGMYIARQLSF  VTF++ EV L+        ++ +YN++V LW    +   QA +     ++  K++WGQ+W+AHQRFFKYLC+A KV+  V++  + I   KCVVIGLQSTGEA+T E LE+ GGE+ +FVS A+G+LQS +E+ FP  +
Sbjct:  206 YAEYMPIKLKIGLRHPDAVVETSSLSSVTPPDVWYKTSISEETIDNGWLSALQLEAVTYAAQQHETFLPNGDRAGFLIGDGAGVGKGRTIAGIIYENYLLSRKRALWFSVSNDLKYDAERDLRDIGAKNILVHSLNKFKYGKISSKHNGSVKKGVIFATYSSLIGESQ--SGGKYKTRLKQLLHWCGDDFDGVIVFDECHKAKNLCPVGSSKPTKTGLAVLELQNKLPKARVVYASATGASEPRNMAYMNRLGIWGEGTPFREFSDFIQAVERRGVGAMEIVAMDMKLRGMYIARQLSFTGVTFKIEEVLLS------QSYVKMYNKAVKLWVIARERFQQAADLIDAEQRMKKSMWGQFWSAHQRFFKYLCIASKVKRVVQLAREEIKNGKCVVIGLQSTGEARTLEALEEGGGELNDFVSTAKGVLQSLIEKHFPAPD 637          

HSP 2 Score: 414.075 bits (1063), Expect = 2.454e-121
Identity = 227/538 (42.19%), Postives = 321/538 (59.67%), Query Frame = 3
Query: 2253 ENNSMKTGADVSCRITQ--RELLDSIDRLAPKLPINTLDDLIRELGGPDYVAEMSGRKGRMVMDVNTGDVSYQPRREDDVTLEQVNMVEKERFNTCQKLVAIISDAASTGISLHADKRYENSLQRVHITLELPWSADRAIQQFGRTHRSNQIYPPEYVFLISDLAGERRFASTVAKRLESLGALTHGDRRATETRDLSQFNIDNKFGRRALDSIFDTAFKSKSSLVPMPKGI------DLQAAFDSVGL-----------QPKDGKNVSKFLNRILGMRLEVQNGLFQYYTDTMDELIKQAKRNQEFDRGIIDLAKEDDNIFVEETQVFRMTFLGDDIKVQLHRVKNITGMSWRSALEVPRGGNNSLDGFYIT-KNETQRKIVLAVQKKDRHGTWFNVFSPNVGEQSNLIENKSLNEAFKKATLEEAERMWNDMYSVTENRCLHYFWYKHCNYSK---NCDTGCRSKIRYVLSGSIFYIWD-------IISAINKSPQLARVRLNDGSKIIGCIINPSHKERITEILANRESHPQQTI 3776
            +N+S+ T  D   R  Q  ++LLD +++LA  LP NTLD+LI ELGGP+ VAEM+GRKGR+V + + G +SY+ R E DV +E +N+ EK+RF    K +AIIS+AAS+GISL AD+R +N  +RVH+TLELPWSADRAIQQFGRTHRSNQ+  PEYVFLIS+LAGE+RFAS VAKRLESLGALTHGDRRATE+RDLS+FN DNK+GR AL+ +  +     S +V  P         D++     VGL             KD  N+ KFLNRILGM +  QN LFQY+ DT+  +++ AK+N  +D GI+DL   D+ +   + + F          V+L+ +    GMSW  A ++        DGFY++ +    +K  + V++ +     F ++ PN G+Q  L     L + +KK   ++A   W D Y+ + + C H +W  +C  +     C+ G R +  YVL GS+  +W         +S  N   Q+ R+R  DG +I+G II  +    +  +L+  +   Q  +
Sbjct:  713 DNSSLITSQDAVERAQQMKKDLLDKLEKLAEDLPPNTLDELIDELGGPENVAEMTGRKGRVVSN-DDGSISYESRSELDVPVEILNITEKQRFMDGDKNIAIISEAASSGISLQADRRAKNQRRRVHMTLELPWSADRAIQQFGRTHRSNQVTAPEYVFLISELAGEQRFASIVAKRLESLGALTHGDRRATESRDLSRFNFDNKYGRNALEIVMKSIVNLDSPMVSPPPDYPGEFFKDVRQGLIGVGLINVEDRSGILTLDKDYNNIGKFLNRILGMEVHQQNALFQYFADTLTAVVQNAKKNGRYDMGILDLGSGDEKVRKSDVKKFLTPGYSTSGHVELYTISVERGMSWDEATKIWAELTGPDDGFYLSLQIRNNKKTAILVKEVNPKKKLFLIYRPNTGKQLKLEIYADLKKKYKKVVSDDALVHWLDQYNSSADTCTHAYWRGNCKKASLGLVCEIGLRCRTYYVLCGSVLSVWTKVEGVLASVSGTNVKMQIVRLRTEDGQRIVGLIIPANCVSPLVNLLSTSDQSQQLAV 1249          
BLAST of Protein strawberry notch homolog 1 vs. UniProt/SwissProt
Match: sp|Q689Z5|SBNO1_MOUSE (Protein strawberry notch homolog 1 OS=Mus musculus OX=10090 GN=Sbno1 PE=1 SV=2)

HSP 1 Score: 525.783 bits (1353), Expect = 4.695e-161
Identity = 260/440 (59.09%), Postives = 332/440 (75.45%), Query Frame = 3
Query:  630 YSQYQPLKLRKGKVHPYXXXXXXXXXXXXXXXXRYCLSLPDGIIQNALLSNVQLEAVIYGCQRHEEILPTGERAGYLIGDGAGVGKGRTLAAIIYENYILHRKRAVWISVSNDLKHDAERDLCDLDANHIKIHPLNKMRYAKINSPENGNVRKGVLFSTYASLIGECQNMTKSKYKTRFRQIVQWFGTDYDGVIVFDECHKAKNLMPQGSQKKTKTAEIVLKLQETLPKARIVYASATGASEPRNMAYMTRLGLWGPGTPFKKFEDFVEKLEDK-VGAMELVAVDMKQRGMYIARQLSFANVTFRVHEVQLTNVKIGEHYFMNVYNESVDLWTRIFDNMNQALNTRFIAKKHAKTVWGQYWAAHQRFFKYLCMAGKVQECVRITMDAITQHKCVVIGLQSTGEAKTNEMLEDYGGEVTEFVSCARGILQSFVERFFPTEE 1946
            Y++Y P+KL+ G  HP  VVE+SSLSSV  P+V Y  S+ +  I N  LS +QLEAV Y  Q+HE  LP G+RAG+LIGDGAGVGKGRT+A IIYENY+L RKRA+W SVSNDLK+DAERDL D+ A +I +H LNK +Y KI+S  NG+V+KGV+F+TY+SLIGE Q  +  KYKTR +Q++ W G D+DGVIVFDECHKAKNL P GS K TKT   VL+LQ  LPKAR+VYASATGASEPRNMAYM RLG+WG GTPF++F DF++ +E + VGAME+VA+DMK RGMYIARQLSF  VTF++ EV L+        ++ +YN++V LW    +   QA +     ++  K++WGQ+W+AHQRFFKYLC+A KV+  V++  + I   KCVVIGLQSTGEA+T E LE+ GGE+ +FVS A+G+LQS +E+ FP  +
Sbjct:  240 YAEYMPIKLKIGLRHPDAVVETSSLSSVTPPDVWYKTSISEETIDNGWLSALQLEAVTYAAQQHETFLPNGDRAGFLIGDGAGVGKGRTIAGIIYENYLLSRKRALWFSVSNDLKYDAERDLRDIGAKNILVHSLNKFKYGKISSKHNGSVKKGVIFATYSSLIGESQ--SGGKYKTRLKQLLHWCGDDFDGVIVFDECHKAKNLCPVGSSKPTKTGLAVLELQNKLPKARVVYASATGASEPRNMAYMNRLGIWGEGTPFREFSDFIQAVERRGVGAMEIVAMDMKLRGMYIARQLSFTGVTFKIEEVLLS------QSYVKMYNKAVKLWVIARERFQQAADLIDAEQRMKKSMWGQFWSAHQRFFKYLCIASKVKRVVQLAREEIKNGKCVVIGLQSTGEARTLEALEEGGGELNDFVSTAKGVLQSLIEKHFPAPD 671          

HSP 2 Score: 407.912 bits (1047), Expect = 2.437e-118
Identity = 219/520 (42.12%), Postives = 312/520 (60.00%), Query Frame = 3
Query: 2301 QRELLDSIDRLAPKLPINTLDDLIRELGGPDYVAEMSGRKGRMVMDVNTGDVSYQPRREDDVTLEQVNMVEKERFNTCQKLVAIISDAASTGISLHADKRYENSLQRVHITLELPWSADRAIQQFGRTHRSNQIYPPEYVFLISDLAGERRFASTVAKRLESLGALTHGDRRATETRDLSQFNIDNKFGRRALDSIFDTAFKSKSSLVPMPKGI------DLQAAFDSVGL-----------QPKDGKNVSKFLNRILGMRLEVQNGLFQYYTDTMDELIKQAKRNQEFDRGIIDLAKEDDNIFVEETQVFRMTFLGDDIKVQLHRVKNITGMSWRSALEVPRGGNNSLDGFYIT-KNETQRKIVLAVQKKDRHGTWFNVFSPNVGEQSNLIENKSLNEAFKKATLEEAERMWNDMYSVTENRCLHYFWYKHCNYSK---NCDTGCRSKIRYVLSGSIFYIWD-------IISAINKSPQLARVRLNDGSKIIGCIINPSHKERITEILANRESHPQQTI 3776
            +++LLD +++LA  LP NTLD+LI ELGGP+ VAEM+GRKGR+V + + G +SY+ R E DV +E +N+ EK+RF    K +AIIS+AAS+GISL AD+R +N  +RVH+TLELPWSADRAIQQFGRTHRSNQ+  PEYVFLIS+LAGE+RFAS VAKRLE LGALTHGDRRATE+RDLS+FN DNK+GR AL+ +  +     S +V  P         D++     VGL             KD  N+ KFLNRILGM +  QN LFQY+ DT+  +++ AK++  +D GI+DL   D+ +   + + F          V+L+ +    GMSW  A ++        DGFY++ +    +K  + V++ +     F ++ PN G+Q  L     L + +KK   ++A   W D Y+ + + C H +W  +C  +     C+ G R +  YVL GS+  +W         +S  N   Q+ R+R  DG +I+G II  +    +  +L+  +   Q  +
Sbjct:  852 KKDLLDKLEKLAEDLPPNTLDELIDELGGPENVAEMTGRKGRVVSN-DDGSISYESRSELDVPVEILNITEKQRFMDGDKNIAIISEAASSGISLQADRRAKNQRRRVHMTLELPWSADRAIQQFGRTHRSNQVTAPEYVFLISELAGEQRFASIVAKRLEGLGALTHGDRRATESRDLSRFNFDNKYGRNALEIVMKSIVNLDSPMVSPPPDYPGEFFKDVRQGLIGVGLINVEDRSGILTLDKDYNNIGKFLNRILGMEVHQQNALFQYFADTLTAVVQNAKKSGRYDMGILDLGSGDEKVRKSDVKKFLTPGYSTSGHVELYTISVERGMSWEEATKIWAELTGPDDGFYLSLQIRNNKKTAILVKEVNPKKKLFLIYRPNTGKQLKLEIYADLKKKYKKVVSDDALVHWLDQYNSSADTCTHAYWRGNCKKASLGLVCEIGLRCRTYYVLCGSVLSVWTKVEGVLASVSGTNVKMQIVRLRTEDGQRIVGLIIPANCVSPLVNLLSTSDQSQQLAV 1370          
BLAST of Protein strawberry notch homolog 1 vs. UniProt/SwissProt
Match: sp|A3KN83|SBNO1_HUMAN (Protein strawberry notch homolog 1 OS=Homo sapiens OX=9606 GN=SBNO1 PE=1 SV=1)

HSP 1 Score: 525.398 bits (1352), Expect = 6.856e-161
Identity = 259/441 (58.73%), Postives = 332/441 (75.28%), Query Frame = 3
Query:  627 VYSQYQPLKLRKGKVHPYXXXXXXXXXXXXXXXXRYCLSLPDGIIQNALLSNVQLEAVIYGCQRHEEILPTGERAGYLIGDGAGVGKGRTLAAIIYENYILHRKRAVWISVSNDLKHDAERDLCDLDANHIKIHPLNKMRYAKINSPENGNVRKGVLFSTYASLIGECQNMTKSKYKTRFRQIVQWFGTDYDGVIVFDECHKAKNLMPQGSQKKTKTAEIVLKLQETLPKARIVYASATGASEPRNMAYMTRLGLWGPGTPFKKFEDFVEKLEDK-VGAMELVAVDMKQRGMYIARQLSFANVTFRVHEVQLTNVKIGEHYFMNVYNESVDLWTRIFDNMNQALNTRFIAKKHAKTVWGQYWAAHQRFFKYLCMAGKVQECVRITMDAITQHKCVVIGLQSTGEAKTNEMLEDYGGEVTEFVSCARGILQSFVERFFPTEE 1946
             Y++Y P+KL+ G  HP  VVE+SSLSSV  P+V Y  S+ +  I N  LS +QLEA+ Y  Q+HE  LP G+RAG+LIGDGAGVGKGRT+A IIYENY+L RKRA+W SVSNDLK+DAERDL D+ A +I +H LNK +Y KI+S  NG+V+KGV+F+TY+SLIGE Q  +  KYKTR +Q++ W G D+DGVIVFDECHKAKNL P GS K TKT   VL+LQ  LPKAR+VYASATGASEPRNMAYM RLG+WG GTPF++F DF++ +E + VGAME+VA+DMK RGMYIARQLSF  VTF++ EV L+        ++ +YN++V LW    +   QA +     ++  K++WGQ+W+AHQRFFKYLC+A KV+  V++  + I   KCVVIGLQSTGEA+T E LE+ GGE+ +FVS A+G+LQS +E+ FP  +
Sbjct:  241 TYAEYMPIKLKIGLRHPDAVVETSSLSSVTPPDVWYKTSISEETIDNGWLSALQLEAITYAAQQHETFLPNGDRAGFLIGDGAGVGKGRTIAGIIYENYLLSRKRALWFSVSNDLKYDAERDLRDIGAKNILVHSLNKFKYGKISSKHNGSVKKGVIFATYSSLIGESQ--SGGKYKTRLKQLLHWCGDDFDGVIVFDECHKAKNLCPVGSSKPTKTGLAVLELQNKLPKARVVYASATGASEPRNMAYMNRLGIWGEGTPFREFSDFIQAVERRGVGAMEIVAMDMKLRGMYIARQLSFTGVTFKIEEVLLS------QSYVKMYNKAVKLWVIARERFQQAADLIDAEQRMKKSMWGQFWSAHQRFFKYLCIASKVKRVVQLAREEIKNGKCVVIGLQSTGEARTLEALEEGGGELNDFVSTAKGVLQSLIEKHFPAPD 673          

HSP 2 Score: 412.535 bits (1059), Expect = 6.080e-120
Identity = 222/520 (42.69%), Postives = 313/520 (60.19%), Query Frame = 3
Query: 2301 QRELLDSIDRLAPKLPINTLDDLIRELGGPDYVAEMSGRKGRMVMDVNTGDVSYQPRREDDVTLEQVNMVEKERFNTCQKLVAIISDAASTGISLHADKRYENSLQRVHITLELPWSADRAIQQFGRTHRSNQIYPPEYVFLISDLAGERRFASTVAKRLESLGALTHGDRRATETRDLSQFNIDNKFGRRALDSIFDTAFKSKSSLVPMPKGI------DLQAAFDSVGL-----------QPKDGKNVSKFLNRILGMRLEVQNGLFQYYTDTMDELIKQAKRNQEFDRGIIDLAKEDDNIFVEETQVFRMTFLGDDIKVQLHRVKNITGMSWRSALEVPRGGNNSLDGFYIT-KNETQRKIVLAVQKKDRHGTWFNVFSPNVGEQSNLIENKSLNEAFKKATLEEAERMWNDMYSVTENRCLHYFWYKHCNYSK---NCDTGCRSKIRYVLSGSIFYIWD-------IISAINKSPQLARVRLNDGSKIIGCIINPSHKERITEILANRESHPQQTI 3776
            +++LLD +++LA  LP NTLD+LI ELGGP+ VAEM+GRKGR+V + + G +SY+ R E DV +E +N+ EK+RF    K +AIIS+AAS+GISL AD+R +N  +RVH+TLELPWSADRAIQQFGRTHRSNQ+  PEYVFLIS+LAGE+RFAS VAKRLESLGALTHGDRRATE+RDLS+FN DNK+GR AL+ +  +     S +V  P         D++     VGL             KD  N+ KFLNRILGM +  QN LFQY+ DT+  +++ AK+N  +D GI+DL   D+ +   + + F          V+L+ +    GMSW  A ++        DGFY++ +    +K  + V++ +     F V+ PN G+Q  L     L + +KK   ++A   W D Y+ + + C H +W  +C  +     C+ G R +  YVL GS+  +W         +S  N   Q+ R+R  DG +I+G II  +    +  +L+  +   Q  +
Sbjct:  855 KKDLLDKLEKLAEDLPPNTLDELIDELGGPENVAEMTGRKGRVVSN-DDGSISYESRSELDVPVEILNITEKQRFMDGDKNIAIISEAASSGISLQADRRAKNQRRRVHMTLELPWSADRAIQQFGRTHRSNQVTAPEYVFLISELAGEQRFASIVAKRLESLGALTHGDRRATESRDLSRFNFDNKYGRNALEIVMKSIVNLDSPMVSPPPDYPGEFFKDVRQGLIGVGLINVEDRSGILTLDKDYNNIGKFLNRILGMEVHQQNALFQYFADTLTAVVQNAKKNGRYDMGILDLGSGDEKVRKSDVKKFLTPGYSTSGHVELYTISVERGMSWEEATKIWAELTGPDDGFYLSLQIRNNKKTAILVKEVNPKKKLFLVYRPNTGKQLKLEIYADLKKKYKKVVSDDALMHWLDQYNSSADTCTHAYWRGNCKKASLGLVCEIGLRCRTYYVLCGSVLSVWTKVEGVLASVSGTNVKMQIVRLRTEDGQRIVGLIIPANCVSPLVNLLSTSDQSQQLAV 1373          
BLAST of Protein strawberry notch homolog 1 vs. UniProt/SwissProt
Match: sp|O01737|SBNO_CAEEL (Protein strawberry notch homolog OS=Caenorhabditis elegans OX=6239 GN=let-765 PE=1 SV=3)

HSP 1 Score: 521.546 bits (1342), Expect = 3.926e-156
Identity = 255/451 (56.54%), Postives = 334/451 (74.06%), Query Frame = 3
Query:  627 VYSQYQPLKLRKGKVHPYXXXXXXXXXXXXXXXXRYCLSLPDGIIQNALLSNVQLEAVIYGCQRHEEILPTGERAGYLIGDGAGVGKGRTLAAIIYENYILHRKRAVWISVSNDLKHDAERDLCDLDANHIKIHPLNKMRYAKINSPENGNVRKGVLFSTYASLIGECQNMTKSKYKTRFRQIVQWFGTDYDGVIVFDECHKAKNLMPQGSQKKTKTAEIVLKLQETLPKARIVYASATGASEPRNMAYMTRLGLWGPGTPFKKFEDFVEKLEDK-VGAMELVAVDMKQRGMYIARQLSFANVTFRVHEVQLTNVKIGEHYFMNVYNESVDLWT---RIFDNMNQALNTRFIAKKHAKTVWGQYWAAHQRFFKYLCMAGKVQECVRITMDAITQHKCVVIGLQSTGEAKTNEMLEDYGGEVTEFVSCARGILQSFVERFFPTEENINQMDK 1967
             YS+Y P KLR G  HP  VVES+SLSSV  P+V+Y +S+P+ +I    +S +QLEAVIY CQ HE  +P+GER GYLIGDGAGVGKGRT+A II+ENY+  RKRA+W+SVS+DLK DAERDL D  A +I ++ LNKM+YAKI+  ENG+++KGV+F+TY SLIGEC+     KY++R  Q++QWFG DYDGVI+ DECH+AKNL+P    K TKT  +VL+LQ+ LP AR+VYASATGA+EPRNMAYMTRLGLWG    F +F DF+  +E + VGAME+VA+DMKQRG+Y+ARQLSF  V+F V EVQL++       F+ +Y+ +V LW    R F  + + ++     +   KTVWGQ+WA HQRFFKYLC+A KV  CV+++ +AI   KCVVIGLQSTGE+ T E LE+ GGE+ EFVS A+ +L   +++ FPT+ + +  D+
Sbjct:  615 TYSEYTPAKLRSGMAHPDSVVESASLSSVSPPDVKYQISIPEYLIDMGHISALQLEAVIYACQMHERRMPSGERYGYLIGDGAGVGKGRTVACIIFENYLQGRKRAIWLSVSSDLKFDAERDLRDCGAPNIPVYALNKMKYAKISGKENGSIKKGVMFATYTSLIGECRGAKSRKYRSRISQLIQWFGQDYDGVIILDECHRAKNLVPTAGAKPTKTGRMVLELQKALPNARVVYASATGATEPRNMAYMTRLGLWGERQAFPEFHDFISAVERRGVGAMEIVAMDMKQRGLYLARQLSFRGVSFAVQEVQLSS------EFVKMYDAAVKLWMEARRQFQTVIETMDEE--ERSTCKTVWGQFWACHQRFFKYLCIAAKVDTCVQLSREAIKAKKCVVIGLQSTGESATLETLEEMGGELNEFVSTAKTVLYGLIDKHFPTDASFSMGDR 1057          

HSP 2 Score: 432.95 bits (1112), Expect = 5.170e-125
Identity = 234/533 (43.90%), Postives = 327/533 (61.35%), Query Frame = 3
Query: 2280 DVSCRITQRELLDSIDRLAPKLPINTLDDLIRELGGPDYVAEMSGRKGRMVMDVNTGDVSYQPRRED-DVTLEQVNMVEKERFNTCQKLVAIISDAASTGISLHADKRYENSLQRVHITLELPWSADRAIQQFGRTHRSNQIYPPEYVFLISDLAGERRFASTVAKRLESLGALTHGDRRATETRDLSQFNIDNKFGRRALDSIFDTAF-KSKSSLVPMPKGI-------DLQAAFDSVGLQP----------KDGKNVSKFLNRILGMRLEVQNGLFQYYTDTMDELIKQAKRNQEFDRGIIDLAKEDDNIFVEETQVFRMTFLGDDIKVQLHRVKNITGMSWRSALEVPRGGNNSLDGFYIT----KNETQRKIVLAVQ------KKDRHGTWFNVFSPNVGEQSNLIENKSLNEAFKKATLEEAERMWNDMYSVTENRCLHYFWYKHCNYSKN---CDTGCRSKIRYVLSGSIFYIWDIISAI-------NKSPQLARVRLNDGSKIIGCIINPSHKERITEILANRESH 3761
            D++  + + ELL +++RLAP LP NTLD LI E+GGP+YVAEM+GR+G MV    TGDV YQ R  + +V+LE +NM EKE+F   +KL+AIIS+AAS+GISL +D+R  N  +RVHITLELPWSAD+AIQQFGRTHRSNQ+  PEYVFLIS+LAGE+RFAS VAKRLESLGALTHGDRRATETRDLSQFN+DNK+GR ALD++  T   ++ + L+  PK         D++   + VGL            K+   + KFLNRILG+ +  QN LF Y+++ + ELI Q+K +  +D GI+DL   DD +   ET+VF         +V++H++    G+SW  A+E+ +  +N  DGFYI      N    K V A+       + D     + +  P+ G    L+    L++ F K +++EA+ +W   Y    N C H + Y  C    N   C+ G R++  +VLSGS+  +W I+  +       +   Q+ RVR     KI+G ++ P+H   + + L   E+H
Sbjct: 1328 DINPMLIKTELLAAVERLAPSLPANTLDQLIDEMGGPEYVAEMTGRRGHMVTS-ETGDVMYQRRNANAEVSLELINMEEKEKFMRGEKLIAIISEAASSGISLQSDRRAINKRRRVHITLELPWSADKAIQQFGRTHRSNQVSGPEYVFLISELAGEKRFASIVAKRLESLGALTHGDRRATETRDLSQFNMDNKYGRVALDTLLKTVIGQAGTPLIDPPKDYKAGEFFEDMRLYMEGVGLLAKNKTGQYTIEKEAATIPKFLNRILGLPVHAQNSLFHYFSEIVAELIAQSKHDGTYDTGIMDLGTGDDQVRKLETRVFTGRVDNGSFRVEIHKIGVERGVSWEEAMELHKEHSNDDDGFYICHPGGANTANTKKVAALVYGIGKIRMDNGARLYAITRPSTGRSPKLMTMADLSKRFHKVSIDEAKEVWKQQYDSAANMCQHNYVYGKCRTESNGTYCEVGRRTRTYFVLSGSVLSVWPIVEEVLAGSDRKSSRMQVIRVRTEQDQKIVGLLVLPTHVRHLVQQL---ETH 1856          
BLAST of Protein strawberry notch homolog 1 vs. TrEMBL
Match: Q9V453 (Uncharacterized protein OS=Drosophila melanogaster OX=7227 GN=BG:DS03323.1 PE=4 SV=1)

HSP 1 Score: 831.632 bits (2147), Expect = 0.000e+0
Identity = 487/1081 (45.05%), Postives = 645/1081 (59.67%), Query Frame = 3
Query:  627 VYSQYQPLKLRKGKVHPYXXXXXXXXXXXXXXXXRYCLSLPDGIIQNALLSNVQLEAVIYGCQRHEEILPTGERAGYLIGDGAGVGKGRTLAAIIYENYILHRKRAVWISVSNDLKHDAERDLCDLDANH-IKIHPLNKMRYAKINSPENGNVRKGVLFSTYASLIGECQNMTKSKYKTRFRQIVQWFGTDYDGVIVFDECHKAKNLMPQGSQKKTKTAEIVLKLQETLPKARIVYASATGASEPRNMAYMTRLGLWGPGTPFKKFEDFVEKLEDK-VGAMELVAVDMKQRGMYIARQLSFANVTFRVHEVQLTNVKIGEHYFMNVYNESVDLWTRIFDNMNQALNTRFIAKKHAKTVWGQYWAAHQRFFKYLCMAGKVQECVRITMDAITQHKCVVIGLQSTGEAKTNEMLEDYGGEVTEFVSCARGILQSFVERFFPTEENINQMDKREDKTKTQNSKTNRKKGSSKKPISLQDALGKDFLEKVTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIM------MEDFSRSYENNSMKTGADVSCRITQRE----------LLDSIDRLAPKLPINTLDDLIRELGGPDYVAEMSGRKGRMVMDVNTGDVSYQPRREDDVTLEQVNMVEKERFNTCQKLVAIISDAASTGISLHADKRYENSLQRVHITLELPWSADRAIQQFGRTHRSNQIYPPEYVFLISDLAGERRFASTVAKRLESLGALTHGDRRATETRDLSQFNIDNKFGRRALDSIFDTAFKSKS---SLVPMP-KG---IDLQAAFDSVGL-------------QPKDGKNVSKFLNRILGMRLEVQNGLFQYYTDTMDELIKQAKRNQEFDRGIIDLAKEDDNIFVEETQVFRMTFLGDDIKVQLHRVKNITGMSWRSALEVPRG-GNNSLDGFYITKNETQRK--IVLAVQKKDRHGTWFN------VFSPNVGEQSNLIENKSLNEAFKKATLEEAERMWNDMYSVTENRCLHYFWYKHCNYSKNCDTGCRSKIRYVLSGSIFYIWDIISAI----NKSPQLARVRLNDGSKIIGCIINPS 3716
             ++ Y P KL+ G+ HP PVVE+++LSSVE+PN+ Y L+LP    +   LS +QLEAV+Y CQ HE+ILP+G+RAG+L+GDGAGVGKGRT+A II++NY+  RKRA+W+SVS+DLK DAERDL D+ A+  I++  +NK +Y+ I+S EN N ++GV+F TY +LIGE    T SKYKTRFRQ+  W G  ++GVIVFDECHKAKNL      K TKT   VL LQ+ LP AR+VYASATGASEPRNMAYM RLGLWGPGT + +F +FV  +E + +GAME+VA+DMK RG YIARQLSF +V+FR+ EV ++        F   YN S +LW  I     +A     +  +  K +  Q+W AHQRFFK LC+A KV   V++T  A    K VVIGLQSTGE++T E LE + G++  FVS A+ I+QSFVE+ FP         KR+      N+     +  S+ P   +  +  D++E   +  A       +  S  +     +   +++    K +  +       I+      M +     E+ +      V   IT+R+          LL+ ID L  KLP NTLD LI ELGG + VAEM+GR+GR+V     G   Y+PR E+D T++ VN  EK+RF    K VAIIS+AAS+GISL +DKR  N  +R+HITLELPWSADRAIQQFGRTHRSNQ+  PEYVF+I+DLAGERRFASTVAKRLESLGALT GDRRAT+ RDLSQFNIDN  GR AL+++      +K    S VP   KG    D   A   VG+               KD  N+SKFLNRILG R+EVQN LF+++ D M  LI Q KR   FD GI+DL     ++   +   F           +LH V    GMS+ +AL   R  G    +GFYI +   Q K   +L +Q         N      ++ PN G Q  L  + S++  + K + EEA+  W   Y +  N C H +W + C     C+ G R +  +VLSG +  IWD I  I        Q+ R++ +   KI+G ++ P+
Sbjct:  720 TFAAYWPSKLKFGRAHPDPVVETATLSSVELPNINYQLALPSKTTE--CLSALQLEAVVYACQAHEQILPSGDRAGFLLGDGAGVGKGRTIAGIIFDNYLKGRKRALWVSVSSDLKFDAERDLADIGAHEKIRVATINKFKYSPIDSEENENFKRGVIFCTYTALIGESMT-TNSKYKTRFRQLTNWLGKKFEGVIVFDECHKAKNLSLMNVGKSTKTGTTVLDLQKLLPNARVVYASATGASEPRNMAYMVRLGLWGPGTAYPEFYEFVNAVEKRGIGAMEIVAMDMKLRGTYIARQLSFKDVSFRIEEVNMSK------EFRKSYNLSAELWADIHKKFQKACRLMCVENRVQKIITCQFWCAHQRFFKNLCIASKVNHVVKMTRQATRMGKAVVIGLQSTGESRTLEHLERHHGKLNSFVSTAKMIIQSFVEKHFPAP-------KRDSFHHLLNTGEFEPEARSRPPKQKKSKMNTDWVEDDMDAEAGESDIEMYERSCTAAVEKIKSGQKRRGRPPKADKVEKITMQERILEHLCNNMREQDNEDESTNTSDNTKVKVNITERDVERCINMREMLLEKIDVLGRKLPPNTLDKLISELGGTNLVAEMTGRRGRVVRTEYDG-YKYEPRCENDSTMDLVNYREKQRFMDGSKHVAIISEAASSGISLQSDKRVSNQRRRLHITLELPWSADRAIQQFGRTHRSNQVNAPEYVFVITDLAGERRFASTVAKRLESLGALTQGDRRATDARDLSQFNIDNSIGRSALENVMQQLTSNKPLDRSQVPQSYKGNFIYDCCVAMAGVGMINVREENKVKVFTVEKDSNNISKFLNRILGCRVEVQNALFKFFLDKMYSLIMQMKRTGRFDLGILDLDAHGASVKSIKLMRFIRKHATGTAATELHTVTVERGMSFETALAKYRKEGQYEHEGFYILQKRRQNKNSAILCLQAPSNSSDVSNGKINLQIYRPNTGPQVRLETHASISSRYVKVSPEEAQTYWVQQYELCLNMCSHLYWNRTCPMPTGCEVGLRMRTYHVLSGLMLPIWDRIELIIVNSGHKIQIIRMKTDANKKIVGTVVPPA 1783          
BLAST of Protein strawberry notch homolog 1 vs. TrEMBL
Match: Q8MSP6 (AT03687p OS=Drosophila melanogaster OX=7227 GN=BG:DS03323.1 PE=2 SV=1)

HSP 1 Score: 828.55 bits (2139), Expect = 0.000e+0
Identity = 487/1081 (45.05%), Postives = 645/1081 (59.67%), Query Frame = 3
Query:  627 VYSQYQPLKLRKGKVHPYXXXXXXXXXXXXXXXXRYCLSLPDGIIQNALLSNVQLEAVIYGCQRHEEILPTGERAGYLIGDGAGVGKGRTLAAIIYENYILHRKRAVWISVSNDLKHDAERDLCDLDANH-IKIHPLNKMRYAKINSPENGNVRKGVLFSTYASLIGECQNMTKSKYKTRFRQIVQWFGTDYDGVIVFDECHKAKNLMPQGSQKKTKTAEIVLKLQETLPKARIVYASATGASEPRNMAYMTRLGLWGPGTPFKKFEDFVEKLEDK-VGAMELVAVDMKQRGMYIARQLSFANVTFRVHEVQLTNVKIGEHYFMNVYNESVDLWTRIFDNMNQALNTRFIAKKHAKTVWGQYWAAHQRFFKYLCMAGKVQECVRITMDAITQHKCVVIGLQSTGEAKTNEMLEDYGGEVTEFVSCARGILQSFVERFFPTEENINQMDKREDKTKTQNSKTNRKKGSSKKPISLQDALGKDFLEKVTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIM------MEDFSRSYENNSMKTGADVSCRITQRE----------LLDSIDRLAPKLPINTLDDLIRELGGPDYVAEMSGRKGRMVMDVNTGDVSYQPRREDDVTLEQVNMVEKERFNTCQKLVAIISDAASTGISLHADKRYENSLQRVHITLELPWSADRAIQQFGRTHRSNQIYPPEYVFLISDLAGERRFASTVAKRLESLGALTHGDRRATETRDLSQFNIDNKFGRRALDSIFDTAFKSKS---SLVPMP-KG---IDLQAAFDSVGL-------------QPKDGKNVSKFLNRILGMRLEVQNGLFQYYTDTMDELIKQAKRNQEFDRGIIDLAKEDDNIFVEETQVFRMTFLGDDIKVQLHRVKNITGMSWRSALEVPRG-GNNSLDGFYITKNETQRK--IVLAVQKKDRHGTWFN------VFSPNVGEQSNLIENKSLNEAFKKATLEEAERMWNDMYSVTENRCLHYFWYKHCNYSKNCDTGCRSKIRYVLSGSIFYIWDIISAI----NKSPQLARVRLNDGSKIIGCIINPS 3716
             ++ Y P KL+ G+ HP PVVE+++LSSVE+PN+ Y L+LP    +   LS +QLEAV+Y CQ HE+ILP+G+RAG+L+GDGAGVGKGRT+A II++NY+  RKRA+W+SVS+DLK DAERDL D+ A+  I++  +NK +Y+ I+S EN N ++GV+F TY +LIGE    T SKYKTRFRQ+  W G  ++GVIVFDECHKAKNL      K TKT   VL LQ+ LP AR+VYASATGASEPRNMAYM RLGLWGPGT + +F +FV  +E + +GAME+VA+DMK RG YIARQLSF +V+FR+ EV ++        F   YN S +LW  I     +A     +  +  K +  Q+W AHQRFFK LC+A KV   V++T  A    K VVIGLQSTGE++T E LE + G++  FVS A+ I+QSFVE+ FP         KR+      N+     +  S+ P   +  +  D++E   +  A       +  S  +     +   +++    K +  +       I+      M +     E+ +      V   IT+R+          LL+ ID L  KLP NTLD LI ELGG + VAEM+GR+GR+V     G   Y+PR E+D T++ VN  EK+RF    K VAIIS+AAS+GISL +DKR  N  +R+HITLELPWSADRAIQQFGRTHRSNQ+  PEYVF+I+DLAGERRFASTVAKRLESLGALT GDRRAT+ RDLSQFNIDN  GR AL+++      +K    S VP   KG    D   A   VG+               KD  N+SKFLNRILG R+EVQN LF+++ D M  LI Q KR   FD GI+DL     ++   +   F           +LH V    GMS+ +AL   R  G    +GFYI +   Q K   +L +Q         N      ++ PN G Q  L  + S++  + K + EEA+  W   Y +  N C H +W + C     C+ G R +  +VLSG +  IWD I  I        Q+ R++ +   KI+G ++ P+
Sbjct:  355 TFAAYWPSKLKFGRAHPDPVVETATLSSVELPNINYQLALPSKTTE--CLSALQLEAVVYACQAHEQILPSGDRAGFLLGDGAGVGKGRTIAGIIFDNYLKGRKRALWVSVSSDLKFDAERDLADIGAHEKIRVATINKFKYSPIDSEENENFKRGVIFCTYTALIGESMT-TNSKYKTRFRQLTNWLGKKFEGVIVFDECHKAKNLSLMNVGKSTKTGTTVLDLQKLLPNARVVYASATGASEPRNMAYMVRLGLWGPGTAYPEFYEFVNAVEKRGIGAMEIVAMDMKLRGTYIARQLSFKDVSFRIEEVNMSK------EFRKSYNLSAELWADIHKKFQKACRLMCVENRVQKIITCQFWCAHQRFFKNLCIASKVNHVVKMTRQATRMGKAVVIGLQSTGESRTLEHLERHHGKLNSFVSTAKMIIQSFVEKHFPAP-------KRDSFHHLLNTGEFEPEARSRPPKQKKSKMNTDWVEDDMDAEAGESDIEMYERSCTAAVEKIKSGQKRRGRPPKADKVEKITMQERILEHLCNNMREQDNEDESTNTSDNTKVKVNITERDVERCINMREMLLEKIDVLGRKLPPNTLDKLISELGGTNLVAEMTGRRGRVVRTEYDG-YKYEPRCENDSTMDLVNYREKQRFMDGSKHVAIISEAASSGISLQSDKRVSNQRRRLHITLELPWSADRAIQQFGRTHRSNQVNAPEYVFVITDLAGERRFASTVAKRLESLGALTQGDRRATDARDLSQFNIDNSIGRSALENVMQQLTSNKPLDRSQVPQSYKGNFIYDCCVAMAGVGMINVREENKVKVFTVEKDSNNISKFLNRILGCRVEVQNALFKFFLDKMYSLIMQMKRTGRFDLGILDLDAHGASVKSIKLMRFIRKHATGTAATELHTVTVERGMSFETALAKYRKEGQYEHEGFYILQKRRQNKNSAILCLQAPSNSSDVSNGKINLQIYRPNTGPQVRLETHASISSRYVKVSPEEAQTYWVQQYELCLNMCSHLYWNRTCPMPTGCEVGLRMRTYHVLSGLMLPIWDRIELIIVNSGHKIQIIRMKTDANKKIVGTVVPPA 1418          
BLAST of Protein strawberry notch homolog 1 vs. TrEMBL
Match: A0A5K4F5D8 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 578.556 bits (1490), Expect = 6.561e-176
Identity = 290/494 (58.70%), Postives = 361/494 (73.08%), Query Frame = 3
Query:  627 VYSQYQPLKLRKGKVHPYXXXXXXXXXXXXXXXXRYCLSLPDGIIQNALLSNVQLEAVIYGCQRHEEILPTGERAGYLIGDGAGVGKGRTLAAIIYENYILHRKRAVWISVSNDLKHDAERDLCDLDANHIKIHPLNKMRYAKINSPENGNVRKGVLFSTYASLIGECQNMTKSKYKTRFRQIVQWFGTDYDGVIVFDECHKAKNLMPQGSQKKTKTAEIVLKLQETLPKARIVYASATGASEPRNMAYMTRLGLWGPGTPFKKFEDFVEKLEDK-VGAMELVAVDMKQRGMYIARQLSFANVTFRVHEVQLTNVKIGEHYFMNVYNESVDLWTRIFDNMNQALNTRFIAKKHAKTVWGQYWAAHQRFFKYLCMAGKVQECVRITMDAITQHKCVVIGLQSTGEAKTNEMLEDYGGEVTEFVSCARGILQSFVERFFPTEENINQMDKREDKT-----KTQNSKTNRK----KGSSKKPISLQDALGKDFLEKV 2078
             Y++Y P KL  G+ HP PVVESSSLSSV  P++ Y L LPD +I  A LS +QLEAV+Y CQRHE ILP G+RAG+LIGDGAGVGKGRT+A I+YENY+ HRK+A+W+SVSNDLK DAERDL D+    IK+H LNK +YA+I+   NG V+KGV+FSTY+SLIGE Q   K+KYKTR +Q+V W G  +DGVIVFDECH+AKNL P GSQK TKT   VL+LQ  LP ARIVYASATGA+EPRNMAYMTRLGLWG GTPFK F  F++ LE + VGAMELVA+DMK RGMYIARQLSF  V F ++EV + NVK+G   F+ VYN+S DLW   +   ++A     ++ ++ KT+WGQ+W+AHQRFFKYLC+A KV+ CV I   A+ + KCVVIGLQSTGEAKT E +E+YG E+ EFVS A+G+ Q  VE++FPT  N++    R DK      ++ N+  NR            + L+D LG+  L K+
Sbjct:  165 TYAEYIPSKLNYGQKHPDPVVESSSLSSVSPPDIHYRLILPDEVIDRAYLSALQLEAVVYACQRHECILPNGQRAGFLIGDGAGVGKGRTIAGILYENYLRHRKKAIWLSVSNDLKVDAERDLRDVGLGKIKVHSLNKFKYARISGKTNGRVKKGVIFSTYSSLIGESQGSAKAKYKTRLKQLVHWCGKKFDGVIVFDECHRAKNLTPSGSQKPTKTGLTVLELQNKLPNARIVYASATGATEPRNMAYMTRLGLWGDGTPFKTFNSFIQTLERRGVGAMELVAMDMKLRGMYIARQLSFHGVNFSINEVLIENVKLGHESFIQVYNQSTDLWVYAYRFFSEASRLLDLSDRYRKTMWGQFWSAHQRFFKYLCIAAKVETCVEIAKTAVDEGKCVVIGLQSTGEAKTLEQVEEYGLELGEFVSTAKGVFQCLVEKYFPTPTNVDNFSLRGDKLASAGDRSSNTTLNRAGRAIAAGQGSGLGLKDILGEKMLAKL 658          

HSP 2 Score: 427.172 bits (1097), Expect = 2.441e-121
Identity = 238/550 (43.27%), Postives = 332/550 (60.36%), Query Frame = 3
Query: 2256 NNSMKTG---ADVSCRITQRELLDSIDRLAPKLPINTLDDLIRELGGPDYVAEMSGRKGRMVMDVNTGDVSYQPRREDDVTLEQVNMVEKERFNTCQKLVAIISDAASTGISLHADKRYENSLQRVHITLELPWSADRAIQQFGRTHRSNQIYPPEYVFLISDLAGERRFASTVAKRLESLGALTHGDRRATETRDLSQFNIDNKFGRRALDSIFDTAFKSKSSLVPMPKGI----------------------DLQAAFDSVGL-----QPKDGKNVSKFLNRILGMRLEVQNGLFQYYTDTMDELIKQAKRNQEFDRGIIDLAKEDDNIFVEETQVFRMTFLGDDIKVQLHRVKNITGMSWRSALEVPRGGNNSLDGFYITKNETQRKI---VLAVQKKDRHG--------TWFNVFSPNVGEQSNLIENKSLNEAFKKAT-LEEAERMWNDMYSVTENRCLHYFWYKHCNYSKN----CDTGCRSKIRYVLSGSIFYIWDII-------SAINKSPQLARVRLNDGSKIIGCIINPSHKERITEILA 3746
            NN +K     A   C   Q  LL  I++L PKLP ++LD+LI +LGGP  VAEM+GRKGRMVM  + G VSY+ RRE DV LE +N+ EK+RF   +KL+AIIS+AAS+GISL AD+R  N  +RVHITLELPWSADRA+QQFGRTHRSNQ+  P+Y+FLIS+LAGE+RFASTVAKRLESLGALTHGDRRATETRDLSQFN+D K GR AL+ +          +V  P                         D++A+   VGL     + KD   +SKFLNRILG+R+ +QN LFQY+++T++E+ ++AKR+   D GI+DL     N+ +  T+ F   FL +  +V LH+V    G+ W +A+E+    +   DGFY+    +  KI   VLAV  K R            + ++ PN G Q+  IE + L E + + +   + +  W+ ++  +  RC+H   +  C+ +      C+ G R++  YVLSGS+  +W  I       S  ++  Q+ R++  DG +IIG +I    +E + ++LA
Sbjct:  846 NNELKVSPEEAKRQCIEMQSLLLRFIEKLGPKLPPSSLDELIDKLGGPSRVAEMTGRKGRMVMG-DDGRVSYESRRESDVNLELLNLTEKQRFMNGEKLIAIISEAASSGISLQADRRAANQRRRVHITLELPWSADRAVQQFGRTHRSNQVSAPKYIFLISNLAGEQRFASTVAKRLESLGALTHGDRRATETRDLSQFNLDTKLGREALELVLRACIWGDEGIVDPPNDYITDTSLDVTVDRDNLNAQSFFNDVKASLQGVGLSTGRCREKDSNQMSKFLNRILGIRVHIQNALFQYFSETLEEVTRRAKRDNRLDLGILDLGTSGQNLEIAWTKSFDTWFLSESTQVHLHKVTAERGLPWSAAMEIYTQHDGVNDGFYLPSAVSNNKIVIPVLAVYVKTRTMRSTNKPDLKLYRIYRPNTGMQARPIELEKLQERYTRVSNPSDCQEPWSRIFKESARRCIHMLLHGFCSSTMQSRTLCEVGLRTRNYYVLSGSVLNVWARIEPFLQMRSNSSRCMQVVRLKSKDGKRIIGSLI---PQECVQDVLA 1391          
BLAST of Protein strawberry notch homolog 1 vs. TrEMBL
Match: A0A5K4F4Y8 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 578.941 bits (1491), Expect = 3.225e-175
Identity = 290/494 (58.70%), Postives = 361/494 (73.08%), Query Frame = 3
Query:  627 VYSQYQPLKLRKGKVHPYXXXXXXXXXXXXXXXXRYCLSLPDGIIQNALLSNVQLEAVIYGCQRHEEILPTGERAGYLIGDGAGVGKGRTLAAIIYENYILHRKRAVWISVSNDLKHDAERDLCDLDANHIKIHPLNKMRYAKINSPENGNVRKGVLFSTYASLIGECQNMTKSKYKTRFRQIVQWFGTDYDGVIVFDECHKAKNLMPQGSQKKTKTAEIVLKLQETLPKARIVYASATGASEPRNMAYMTRLGLWGPGTPFKKFEDFVEKLEDK-VGAMELVAVDMKQRGMYIARQLSFANVTFRVHEVQLTNVKIGEHYFMNVYNESVDLWTRIFDNMNQALNTRFIAKKHAKTVWGQYWAAHQRFFKYLCMAGKVQECVRITMDAITQHKCVVIGLQSTGEAKTNEMLEDYGGEVTEFVSCARGILQSFVERFFPTEENINQMDKREDK-----TKTQNSKTNRK----KGSSKKPISLQDALGKDFLEKV 2078
             Y++Y P KL  G+ HP PVVESSSLSSV  P++ Y L LPD +I  A LS +QLEAV+Y CQRHE ILP G+RAG+LIGDGAGVGKGRT+A I+YENY+ HRK+A+W+SVSNDLK DAERDL D+    IK+H LNK +YA+I+   NG V+KGV+FSTY+SLIGE Q   K+KYKTR +Q+V W G  +DGVIVFDECH+AKNL P GSQK TKT   VL+LQ  LP ARIVYASATGA+EPRNMAYMTRLGLWG GTPFK F  F++ LE + VGAMELVA+DMK RGMYIARQLSF  V F ++EV + NVK+G   F+ VYN+S DLW   +   ++A     ++ ++ KT+WGQ+W+AHQRFFKYLC+A KV+ CV I   A+ + KCVVIGLQSTGEAKT E +E+YG E+ EFVS A+G+ Q  VE++FPT  N++    R DK      ++ N+  NR            + L+D LG+  L K+
Sbjct:  272 TYAEYIPSKLNYGQKHPDPVVESSSLSSVSPPDIHYRLILPDEVIDRAYLSALQLEAVVYACQRHECILPNGQRAGFLIGDGAGVGKGRTIAGILYENYLRHRKKAIWLSVSNDLKVDAERDLRDVGLGKIKVHSLNKFKYARISGKTNGRVKKGVIFSTYSSLIGESQGSAKAKYKTRLKQLVHWCGKKFDGVIVFDECHRAKNLTPSGSQKPTKTGLTVLELQNKLPNARIVYASATGATEPRNMAYMTRLGLWGDGTPFKTFNSFIQTLERRGVGAMELVAMDMKLRGMYIARQLSFHGVNFSINEVLIENVKLGHESFIQVYNQSTDLWVYAYRFFSEASRLLDLSDRYRKTMWGQFWSAHQRFFKYLCIAAKVETCVEIAKTAVDEGKCVVIGLQSTGEAKTLEQVEEYGLELGEFVSTAKGVFQCLVEKYFPTPTNVDNFSLRGDKLASAGDRSSNTTLNRAGRAIAAGQGSGLGLKDILGEKMLAKL 765          

HSP 2 Score: 427.172 bits (1097), Expect = 6.560e-121
Identity = 238/550 (43.27%), Postives = 332/550 (60.36%), Query Frame = 3
Query: 2256 NNSMKTG---ADVSCRITQRELLDSIDRLAPKLPINTLDDLIRELGGPDYVAEMSGRKGRMVMDVNTGDVSYQPRREDDVTLEQVNMVEKERFNTCQKLVAIISDAASTGISLHADKRYENSLQRVHITLELPWSADRAIQQFGRTHRSNQIYPPEYVFLISDLAGERRFASTVAKRLESLGALTHGDRRATETRDLSQFNIDNKFGRRALDSIFDTAFKSKSSLVPMPKGI----------------------DLQAAFDSVGL-----QPKDGKNVSKFLNRILGMRLEVQNGLFQYYTDTMDELIKQAKRNQEFDRGIIDLAKEDDNIFVEETQVFRMTFLGDDIKVQLHRVKNITGMSWRSALEVPRGGNNSLDGFYITKNETQRKI---VLAVQKKDRHG--------TWFNVFSPNVGEQSNLIENKSLNEAFKKAT-LEEAERMWNDMYSVTENRCLHYFWYKHCNYSKN----CDTGCRSKIRYVLSGSIFYIWDII-------SAINKSPQLARVRLNDGSKIIGCIINPSHKERITEILA 3746
            NN +K     A   C   Q  LL  I++L PKLP ++LD+LI +LGGP  VAEM+GRKGRMVM  + G VSY+ RRE DV LE +N+ EK+RF   +KL+AIIS+AAS+GISL AD+R  N  +RVHITLELPWSADRA+QQFGRTHRSNQ+  P+Y+FLIS+LAGE+RFASTVAKRLESLGALTHGDRRATETRDLSQFN+D K GR AL+ +          +V  P                         D++A+   VGL     + KD   +SKFLNRILG+R+ +QN LFQY+++T++E+ ++AKR+   D GI+DL     N+ +  T+ F   FL +  +V LH+V    G+ W +A+E+    +   DGFY+    +  KI   VLAV  K R            + ++ PN G Q+  IE + L E + + +   + +  W+ ++  +  RC+H   +  C+ +      C+ G R++  YVLSGS+  +W  I       S  ++  Q+ R++  DG +IIG +I    +E + ++LA
Sbjct:  953 NNELKVSPEEAKRQCIEMQSLLLRFIEKLGPKLPPSSLDELIDKLGGPSRVAEMTGRKGRMVMG-DDGRVSYESRRESDVNLELLNLTEKQRFMNGEKLIAIISEAASSGISLQADRRAANQRRRVHITLELPWSADRAVQQFGRTHRSNQVSAPKYIFLISNLAGEQRFASTVAKRLESLGALTHGDRRATETRDLSQFNLDTKLGREALELVLRACIWGDEGIVDPPNDYITDTSLDVTVDRDNLNAQSFFNDVKASLQGVGLSTGRCREKDSNQMSKFLNRILGIRVHIQNALFQYFSETLEEVTRRAKRDNRLDLGILDLGTSGQNLEIAWTKSFDTWFLSESTQVHLHKVTAERGLPWSAAMEIYTQHDGVNDGFYLPSAVSNNKIVIPVLAVYVKTRTMRSTNKPDLKLYRIYRPNTGMQARPIELEKLQERYTRVSNPSDCQEPWSRIFKESARRCIHMLLHGFCSSTMQSRTLCEVGLRTRNYYVLSGSVLNVWARIEPFLQMRSNSSRCMQVVRLKSKDGKRIIGSLI---PQECVQDVLA 1498          
BLAST of Protein strawberry notch homolog 1 vs. TrEMBL
Match: A0A095A055 (Protein strawberry notch 1 OS=Schistosoma haematobium OX=6185 GN=MS3_07229 PE=4 SV=1)

HSP 1 Score: 578.556 bits (1490), Expect = 7.649e-175
Identity = 289/494 (58.50%), Postives = 363/494 (73.48%), Query Frame = 3
Query:  627 VYSQYQPLKLRKGKVHPYXXXXXXXXXXXXXXXXRYCLSLPDGIIQNALLSNVQLEAVIYGCQRHEEILPTGERAGYLIGDGAGVGKGRTLAAIIYENYILHRKRAVWISVSNDLKHDAERDLCDLDANHIKIHPLNKMRYAKINSPENGNVRKGVLFSTYASLIGECQNMTKSKYKTRFRQIVQWFGTDYDGVIVFDECHKAKNLMPQGSQKKTKTAEIVLKLQETLPKARIVYASATGASEPRNMAYMTRLGLWGPGTPFKKFEDFVEKLEDK-VGAMELVAVDMKQRGMYIARQLSFANVTFRVHEVQLTNVKIGEHYFMNVYNESVDLWTRIFDNMNQALNTRFIAKKHAKTVWGQYWAAHQRFFKYLCMAGKVQECVRITMDAITQHKCVVIGLQSTGEAKTNEMLEDYGGEVTEFVSCARGILQSFVERFFPTEENINQMDKREDK-----TKTQNSKTNRK----KGSSKKPISLQDALGKDFLEKV 2078
             Y+ Y P KL  G+ HP PVVESSSLSSV  P++ Y L LPD +I+ A LS +QLEAV+Y CQRHE ILP G+RAG+LIGDGAGVGKGRT+A I+YENY+ HRK+A+W+SVSNDLK DAERDL D+    IK+H LNK +YA+I+   NG V+KGV+FSTY+SLIGE Q   K+KYKTR +Q+V W G  +DGVIVFDECH+AKNL P GSQK TKT   VL+LQ  LP ARIVYASATGA+EPRNMAYMTRLGLWG GTPFK F  F++ LE + VGAMELVA+DMK RGMYIARQLSF  V F ++EV + NVK+G   F++VYN+S DLW   +   ++A     ++ ++ KT+WGQ+W+AHQRFFKYLC+A KV++CV I   A+ + KCVVIGLQSTGEAKT E +E+YG ++ EFVS A+G+ Q  VE++FPT  N++    R DK      ++ N+  NR            + L+D LG+  L K+
Sbjct:  294 TYADYIPSKLNYGQKHPDPVVESSSLSSVSPPDIHYRLILPDEVIERAYLSALQLEAVVYACQRHECILPNGQRAGFLIGDGAGVGKGRTIAGILYENYLRHRKKAIWLSVSNDLKVDAERDLRDVGLGKIKVHSLNKFKYARISGKTNGRVKKGVIFSTYSSLIGESQGSAKAKYKTRLKQLVHWCGKKFDGVIVFDECHRAKNLTPSGSQKPTKTGLTVLELQNKLPNARIVYASATGATEPRNMAYMTRLGLWGDGTPFKTFNSFIQTLERRGVGAMELVAMDMKLRGMYIARQLSFHGVNFSINEVLIENVKLGHESFIHVYNQSTDLWVYAYRFFSEASRLLDLSDRYRKTMWGQFWSAHQRFFKYLCIAAKVEKCVEIAKTAVDEGKCVVIGLQSTGEAKTLEQVEEYGLDLGEFVSTAKGVFQCLVEKYFPTPTNVDNFSLRGDKLASAGDRSSNTTLNRAGRAIAAGQGSGLGLKDILGEKMLAKL 787          

HSP 2 Score: 431.795 bits (1109), Expect = 2.584e-122
Identity = 275/740 (37.16%), Postives = 401/740 (54.19%), Query Frame = 3
Query: 2256 NNSMKTG---ADVSCRITQRELLDSIDRLAPKLPINTLDDLIRELGGPDYVAEMSGRKGRMVMDVNTGDVSYQPRREDDVTLEQVNMVEKERFNTCQKLVAIISDAASTGISLHADKRYENSLQRVHITLELPWSADRAIQQFGRTHRSNQIYPPEYVFLISDLAGERRFASTVAKRLESLGALTHGDRRATETRDLSQFNIDNKFGRRALDSIFDTAFKSKSSLVPMPKGI----------------------DLQAAFDSVGL-----QPKDGKNVSKFLNRILGMRLEVQNGLFQYYTDTMDELIKQAKRNQEFDRGIIDLAKEDDNIFVEETQVFRMTFLGDDIKVQLHRVKNITGMSWRSALEVPRGGNNSLDGFYITKNETQRKI---VLAVQKKDRH--------GTWFNVFSPNVGEQSNLIENKSLNEAFKKAT-LEEAERMWNDMYSVTENRCLHYFWYKHCNYSKN----CDTGCRSKIRYVLSGSIFYIWDII-------SAINKSPQLARVRLNDGSKIIGCIINPSHKERITEILANRESHPQQTIPVSTAGRAQQQVQLQKDRPMLQRPVRLVQQPKLS------------------TQDHQFYAGQNMKGFIQRPRMATIVSSPALRYPQTPQRKMFSFSS------GIIPTQQTPNIRLVPILNKSIMSSSVPNLRFASHSSPIRLLQSPQLTQTIIHPSSSSSQLFNSVARTATKPAAVELP 4244
            NN +K     A   C   Q  LL  I++L PKLP ++LD+LI +LGGP  VAEM+GRKGRMVM  + G VSY+ RRE DV LE +N+ EK+RF   +KL+AIIS+AAS+GISL AD+R  N  +RVHITLELPWSADRA+QQFGRTHRSNQ+  P+Y+FLIS+LAGE+RFASTVAKRLESLGALTHGDRRATETRDLSQFN+D K GR AL+ +          +V  P                         D++A+   VGL     + KD   +SKFLNRILG+R+ +QN LFQY++DT++E+ ++AKR+   D GI+DL     N+ +  T+ F   FL +  +V LH+V    G+ W  A+E+    +   DGFY+    +  KI   VLAV  K R+           + ++ PN G Q+  IE + L E + + +   + +  W+ ++  +  RC+H   +  C+ +      C+ G R++  YVLSGS+  +W  I       S   +  Q+ R++  DG +IIG +I    +E + ++LA   S P +T   S++    ++  L    P ++    +     LS                  TQ  + Y+G+      QRP        P      T +  +F+ SS      G +    T ++  +P  +   +S+++     ++ S  +    SP  + T IH +  S++L ++    +   AA+ LP
Sbjct:  978 NNELKVSPEEAKRQCTEMQSLLLRFIEKLGPKLPPSSLDELIDKLGGPSRVAEMTGRKGRMVMG-DDGRVSYESRRESDVNLELLNLTEKQRFMNGEKLIAIISEAASSGISLQADRRASNQRRRVHITLELPWSADRAVQQFGRTHRSNQVSAPKYIFLISNLAGEQRFASTVAKRLESLGALTHGDRRATETRDLSQFNLDTKLGREALELVLRACIWGDEGIVDPPNDYITDTPFDVTVDRDNLNAQSFFNDVKASLQGVGLATGRCREKDSNQMSKFLNRILGIRVHIQNALFQYFSDTLEEVTRRAKRDNRLDLGILDLGTSGQNLEITWTKSFDTWFLSESTQVHLHKVTAERGLPWSGAMEIYTQHDGVNDGFYLPSVISNNKIVIPVLAVYVKTRNTRSTSKSDSKLYRIYRPNTGMQARPIELEKLQERYTRVSNPSDCQEPWSRIFKESARRCIHMLLHGFCSSTIQSRTLCEVGLRTRNYYVLSGSVLNVWARIEPFLQLRSNSTRCMQVVRLKSKDGKRIIGSLI---PQECVQDVLACL-SLPPETEHTSSSDNLDKKCGL----PHMEESSGISNNFNLSPHIPNVPWPRGQTFSVNPTQQSRLYSGRPPSFINQRPSNIIRKKIPPHNPGNTYRGSLFTQSSSEQRRFGTLRETLTTDLNYIPSHSNGYLSTTLSQSHVSNSSKGV----SPMYSNTSIH-NFGSTRLNSNTKMGSRLNAALSLP 1703          
BLAST of Protein strawberry notch homolog 1 vs. Ensembl Cavefish
Match: sbno1 (strawberry notch homolog 1 (Drosophila) [Source:ZFIN;Acc:ZDB-GENE-080522-2])

HSP 1 Score: 528.865 bits (1361), Expect = 3.638e-163
Identity = 268/483 (55.49%), Postives = 351/483 (72.67%), Query Frame = 3
Query:  630 YSQYQPLKLRKGKVHPYXXXXXXXXXXXXXXXXRYCLSLPDGIIQNALLSNVQLEAVIYGCQRHEEILPTGERAGYLIGDGAGVGKGRTLAAIIYENYILHRKRAVWISVSNDLKHDAERDLCDLDANHIKIHPLNKMRYAKINSPENGNVRKGVLFSTYASLIGECQNMTKSKYKTRFRQIVQWFGTDYDGVIVFDECHKAKNLMPQGSQKKTKTAEIVLKLQETLPKARIVYASATGASEPRNMAYMTRLGLWGPGTPFKKFEDFVEKLEDK-VGAMELVAVDMKQRGMYIARQLSFANVTFRVHEVQLTNVKIGEHYFMNVYNESVDLWTRIFDNMNQALNTRFIAKKHAKTVWGQYWAAHQRFFKYLCMAGKVQECVRITMDAITQHKCVVIGLQSTGEAKTNEMLEDYGGEVTEFVSCARGILQSFVERFFPTEE-----NINQMDKREDKTKTQNSKTNRKKGSSKKPISLQDALGK 2060
            Y++Y P+KL+ G+ HP PVVE+SSLSSV  PNV Y LS+P+  I    LS +QLEA+ Y  Q+HE  LP G+RA YLIGDGAGVGKGRT+A IIYENY+L RKR++W SVSNDLK+DAERDL D+ A +I++H LNK +Y KI+S  NG+V+KGV+F+TY+SLIGE Q  +  KYKTRF+Q++ W G D+DGVIVFDECHKAKN+ P GS K TKT   VL+LQ  LPKAR+VYASATGASEPRNMAYM RLG+WG GTPFK+F +F++ +E + VGAME+VA+DMK RGMYIARQLSF  VTF++ EV L         ++ +YN+SV LW    +    A N     ++  K++WGQ+W+AHQRFFKYLC+A KV+  V++  + +   KCVVIGLQSTGEA+T E LE+ GGE+ +FVS A+G+LQS +E+ FP  +     ++  +D    KT +       +KG  +K + ++  + K
Sbjct:  240 YAEYMPMKLKIGERHPDPVVETSSLSSVNPPNVWYRLSIPEETIDRGWLSALQLEAITYASQQHETFLPNGDRAAYLIGDGAGVGKGRTIAGIIYENYLLGRKRSLWFSVSNDLKYDAERDLRDIGAKNIQVHSLNKFKYGKISSKHNGSVKKGVIFATYSSLIGESQ--SGGKYKTRFKQLLHWCGDDFDGVIVFDECHKAKNVCPIGSSKPTKTGLAVLELQNKLPKARVVYASATGASEPRNMAYMNRLGIWGDGTPFKEFTNFIQAVERRGVGAMEIVAMDMKLRGMYIARQLSFQGVTFKIEEVPLA------QNYIKMYNKSVRLWVSAREKFQHAANLMDAEQRMKKSMWGQFWSAHQRFFKYLCIASKVRRVVQLAREEVKNGKCVVIGLQSTGEARTLEALEEGGGELNDFVSTAKGVLQSLIEKHFPAPDRQKLFSLLGIDMSAKKTPSPAETATEQKGKKRKGLEVKKEVKK 714          

HSP 2 Score: 422.165 bits (1084), Expect = 2.612e-124
Identity = 235/534 (44.01%), Postives = 326/534 (61.05%), Query Frame = 3
Query: 2244 RSY-ENNSMKTGADV--SCRITQRELLDSIDRLAPKLPINTLDDLIRELGGPDYVAEMSGRKGRMVMDVNTGDVSYQPRREDDVTLEQVNMVEKERFNTCQKLVAIISDAASTGISLHADKRYENSLQRVHITLELPWSADRAIQQFGRTHRSNQIYPPEYVFLISDLAGERRFASTVAKRLESLGALTHGDRRATETRDLSQFNIDNKFGRRALDSIFDTAFKSKSSLVPMPKGID------LQAAFDSVGL-----------QPKDGKNVSKFLNRILGMRLEVQNGLFQYYTDTMDELIKQAKRNQEFDRGIIDLAKEDDNIFVEETQVFRMTFLGDDIKVQLHRVKNITGMSWRSALEVPRGGNNSLDGFYITKNETQRKIVLAVQKKDRHGTWFNVFSPNVGEQSNLIENKSLNEAFKKATLEEAERMWNDMYSVTENRCLHYFWYKHCNYSK---NCDTGCRSKIRYVLSGSIFYIWDIISAI-------NKSPQLARVRLNDGSKIIGCIINPSHKERITEILANRE 3755
            RS+ +N+S  T  D     +  +RELL+ +++LA  LP NTLD+LI ELGGP+ VAEM+GRKGR+V + + G +SY+ R E DV +E +N+ EK+RF   +K +AIIS+AAS+GISL AD+R +N  +RVH+TLELPWSADRAIQQFGRTHRSNQ+  PEYVFLIS+LAGE+RFAS VAKRLESLGALTHGDRRATETRDLS+FN DNK+GR AL+ +  +     S LV  P   D      ++     VGL             KD  N+ KFLNRILGM ++ QN LFQY++DT+  +++ AK+N  +D GI+DL   D+ +   + + F          V+L+ V    GMSW  A  V    +   DGFY+ +    +KI + V++ +     F V+ PN G+Q  L     + +  KK   +EA++ W D Y  +   C H +W  +C  +     C+ G R +  YVL GS+  +W  +  +       N   Q+ R+R  DG +I+G II P+    +T IL++ +
Sbjct:  831 RSFCQNSSCVTSHDAVEDAQQMKRELLEQLEKLAESLPPNTLDELIDELGGPENVAEMTGRKGRVVSN-DDGSISYESRSELDVPVEILNLTEKQRFMDGEKNIAIISEAASSGISLQADRRVKNQRRRVHMTLELPWSADRAIQQFGRTHRSNQVTAPEYVFLISELAGEQRFASIVAKRLESLGALTHGDRRATETRDLSRFNFDNKYGRNALEIVMKSIVNLDSPLVSPPCDFDGDFFKEIRNGLIGVGLINVEDRSGVLSLDKDYNNIGKFLNRILGMEVQQQNALFQYFSDTLSAVVQNAKKNGRYDMGILDLGSGDEKVKKFDVKKFLTPGYSTSGHVELYTVSVERGMSWEDATHVWAEQDGPDDGFYV-QVRNNKKIAIMVKEVNTKKRLFMVYRPNTGKQLKLEAYADIRKRCKKVLSDEAKQHWIDQYQSSAEICSHAYWRGNCKKASVGLQCEIGLRCRTYYVLCGSVLSVWTKVEGVLASVSGSNVKMQIVRLRTEDGQRIVGLIIPPNCVAPLTNILSSSD 1362          
BLAST of Protein strawberry notch homolog 1 vs. Ensembl Cavefish
Match: sbno2a (strawberry notch homolog 2 [Source:NCBI gene;Acc:103025838])

HSP 1 Score: 458.373 bits (1178), Expect = 6.928e-141
Identity = 242/463 (52.27%), Postives = 318/463 (68.68%), Query Frame = 3
Query:  627 VYSQYQPLKLRKGKVHPYXXXXXXXXXXXXXXXXRYCLSLPDGIIQNALLSNVQLEAVIYGCQRHEEILPTGERAGYLIGDGAGVGKGRTLAAIIYENYILHRKRAVWISVSNDLKHDAERDLCDLDANHIKIHPLNKMRYAKINSPENGNVRKGVLFSTYASLIGECQNMTKSKYKTRFRQIVQWFGTDYDGVIVFDECHKAKNLMPQGSQKKTKTAEIVLKLQETLPKARIVYASATGASEPRNMAYMTRLGLWGPGTPFKKFEDFVEKLEDK-VGAMELVAVDMKQRGMYIARQLSFANVTFRVHEVQLTNVKIGEHYFMNVYNESVDLWTRIFDNMNQALNTRFIAKKHAKTVWGQYWAAHQRFFKYLCMAGKVQECVRITMDAITQHKCVVIGLQSTGEAKTNEMLEDYGGEVTEFVSCARGILQSFVERFFPTEENINQMDKREDKTKTQNSKTNRK 2012
             Y++Y+P K   G  HP  VVE+S+LSSV  P+V Y LS+PD  IQN LLS +QLEA+IY CQ+HE IL   +RAG+LIGDGAGVGKGRT+A II ENY+  RKRA+W SVSNDLK+DAERDL D++A +I +  LNK++Y    + E      GVLF+TY++LIGE Q     +++TR +QI+ W   ++DGVIVFDECHKAKN         TK  + VL LQ  LP AR+VYASATGASEP+NM YM+RLG+WG GTPFK FEDF+  +E + VGAME+VA+DMK  GMYIARQLSF+ V+FR+ E+ L      +  F  VYN++  LW    +   +A +   +A +  K++WGQ+W++HQRFFKYLC+A KV+  V +    + + KC+VIGLQSTGEA+T E+L++  G +  FVS A G+ QS V++ FP E        +  K KT  +K  RK
Sbjct:  168 TYAEYKPSKSTIGISHPDIVVETSTLSSVPPPDVTYTLSIPDSTIQNGLLSALQLEAIIYACQQHEVILQNNQRAGFLIGDGAGVGKGRTVAGIILENYLKGRKRALWFSVSNDLKYDAERDLRDIEAPNIPVFALNKIKYGDTATSE------GVLFATYSALIGESQ--AGGQHRTRLKQILDWCKPEFDGVIVFDECHKAKN------ATSTKMGKAVLDLQNKLPLARVVYASATGASEPKNMIYMSRLGIWGEGTPFKTFEDFLHAIEKRGVGAMEIVAMDMKVSGMYIARQLSFSGVSFRIEEITL------DEEFKVVYNKAARLWAEALELFTRAADLLALASR--KSLWGQFWSSHQRFFKYLCIAAKVRRLVELAQAEMERGKCIVIGLQSTGEARTREVLDENDGHLDRFVSAAEGVFQSLVQKHFPLE--------KPKKEKTAGNKRKRK 600          

HSP 2 Score: 332.413 bits (851), Expect = 1.725e-95
Identity = 175/325 (53.85%), Postives = 226/325 (69.54%), Query Frame = 3
Query: 2310 LLDSIDRLAPKLPINTLDDLIRELGGPDYVAEMSGRKGRMVMDVNTGDVSYQPRREDDVTLEQVNMVEKERFNTCQKLVAIISDAASTGISLHADKRYENSLQRVHITLELPWSADRAIQQFGRTHRSNQIYPPEYVFLISDLAGERRFASTVAKRLESLGALTHGDRRATETRDLSQFNIDNKFGRRALDSIFDTAFKSKSSLVPMPKG---------IDLQAAFDSVGL---QPKDGKN------VSKFLNRILGMRLEVQNGLFQYYTDTMDELIKQAKRNQEFDRGIIDLAKEDDNIFVEETQVFRMTFLGDDIKVQLHRV 3230
            LL  I  L  +LP+NTLD+LI   GGP+ V+EM+GRKGR+V   + G V Y+ R E  +T++ VN+ EKERF   +KLVAIIS+AAS+GISL ADKR +N  +RVH+TLELPWSADRAIQQFGRTHRSNQ+  PEY+FLIS+LAGERRFAS VAKRLESLGALTHGDRRATE+RDLS++N +NK+G +ALD I         + VP PKG          D++     VG+   +P+ G N      ++KFLNRILG+ +  QN LFQY+TD  D LI + K+   +D GI+DLA  +D I+ EE +V+       + +V L++V
Sbjct:  669 LLSKIAELGKELPLNTLDELIDRFGGPERVSEMTGRKGRVVRRPD-GRVQYESRAEQGLTIDHVNVKEKERFMVGEKLVAIISEAASSGISLQADKRVQNQRRRVHMTLELPWSADRAIQQFGRTHRSNQVTAPEYIFLISELAGERRFASIVAKRLESLGALTHGDRRATESRDLSKYNFENKYGTKALDKITKAILGHIENKVPAPKGYPGGEARFFADMKKGMIDVGIFCREPRFGLNTEKDCTITKFLNRILGLEVHQQNSLFQYFTDNFDYLIDKDKKEGRYDMGILDLAPGNDEIYEEEQEVYLTPGNPQEGQVTLYKV 992          
BLAST of Protein strawberry notch homolog 1 vs. Ensembl Cavefish
Match: si:ch73-63e15.2 (protein strawberry notch homolog 2-like [Source:NCBI gene;Acc:103045466])

HSP 1 Score: 456.833 bits (1174), Expect = 5.569e-137
Identity = 239/478 (50.00%), Postives = 326/478 (68.20%), Query Frame = 3
Query:  627 VYSQYQPLKLRKGKVHPYXXXXXXXXXXXXXXXXRYCLSLPDGIIQNALLSNVQLEAVIYGCQRHEEILPTGERAGYLIGDGAGVGKGRTLAAIIYENYILHRKRAVWISVSNDLKHDAERDLCDLDANHIKIHPLNKMRYAKINSPENGNVRKGVLFSTYASLIGECQNMTKSKYKTRFRQIVQWFGTDYDGVIVFDECHKAKNLMPQGSQKKTKTAEIVLKLQETLPKARIVYASATGASEPRNMAYMTRLGLWGPGTPFKKFEDFVEKLEDK-VGAMELVAVDMKQRGMYIARQLSFANVTFRVHEVQLTNVKIGEHYFMNVYNESVDLWTRIFDNMNQALNTRFIAKKHAKTVWGQYWAAHQRFFKYLCMAGKVQECVRITMDAITQHKCVVIGLQSTGEAKTNEMLEDYGGEVTEFVSCARGILQSFVERFFPTEENINQMD---KREDKTKTQNSKTNRKKGSSKKPISLQD 2048
             Y++Y+P K   G  HP  VVE+S+LSSV  P++ Y LS+P+ II + LLS +QLEA+IY CQ+HE IL   +RAG+LIGDGAGVGKGRT+A II ENY+  RK+A+W SVSNDLK+DAERDL D+ A ++ +H LNK++Y    + E      GVLF+TY++LIGE Q     +++TR  QI+ W G+D+DGVI+FDECHKAKN         TK  + VL LQ  LP AR+VYASATGASEP+NM YM+RLG+WG GTPFK F+DF+  +E + VGAME+VA+DMK  GMYIARQLSF+ V+FR+ E+ L      +  F  VYN++  LW        QA +   +     K++WGQ+W++HQRFFKYLC+A KV+  V +    +   KCVVIGLQSTGEA+T E+L++  G + +FVS A G+ QS V++ FP+E+   +     KR+ K + +N K  ++    +  I++ +
Sbjct:  124 TYAEYKPSKSTIGNSHPDRVVETSTLSSVPPPDITYTLSIPENIINDRLLSALQLEAIIYACQQHEVILQNNQRAGFLIGDGAGVGKGRTVAGIILENYLKGRKKALWFSVSNDLKYDAERDLQDIGAPNVLVHALNKIKYGDTATSE------GVLFATYSALIGESQ--AGGQHRTRLNQILDWCGSDFDGVIIFDECHKAKNAT------STKMGKAVLDLQSKLPLARVVYASATGASEPKNMIYMSRLGIWGEGTPFKTFDDFLHAVEKRGVGAMEIVAMDMKVSGMYIARQLSFSGVSFRIVEIGL------DDDFKVVYNKAAKLWAEALVVFTQAAD--LLGMVSTKSLWGQFWSSHQRFFKYLCIAAKVRRLVELANRELEAGKCVVIGLQSTGEARTREVLDENDGHLDKFVSAAEGVFQSLVQKHFPSEKERREKGPGTKRKRKPRGRNPKYPKQTADGRVVINISE 579          

HSP 2 Score: 392.504 bits (1007), Expect = 4.119e-114
Identity = 218/495 (44.04%), Postives = 300/495 (60.61%), Query Frame = 3
Query: 2283 VSCRITQRE-----LLDSIDRLAPKLPINTLDDLIRELGGPDYVAEMSGRKGRMVMDVNTGDVSYQPRREDDVTLEQVNMVEKERFNTCQKLVAIISDAASTGISLHADKRYENSLQRVHITLELPWSADRAIQQFGRTHRSNQIYPPEYVFLISDLAGERRFASTVAKRLESLGALTHGDRRATETRDLSQFNIDNKFGRRALDSIFDTAFKSKSSLVPMPKGI---------DLQAAFDSVGL---QPKDGKN------VSKFLNRILGMRLEVQNGLFQYYTDTMDELIKQAKRNQEFDRGIIDLAKEDDNIFVEETQVFRMTFLGDDIKVQLHRVKNITGMSWRSALEVPRGGNNSLDGFYIT-KNETQRKIVLAVQKKDRHGTWFNVFSPNVGEQSNLIENKSLNEAFKKATLEEAERMWNDMYSVTENRCLHYFWYKHC---NYSKNCDTGCRSKIRYVLSGSIFYIW----DIISAINKSPQLARVRL 3674
             +C   Q E     LL+ I  L  +LP+NTLD+LI + GGP+ VAEM+GRKGR+V   + G V Y+ R E   T++ +N+ EK+RF    KLVAIIS+AAS+GISL AD+R  N  +RVH+TLELPWSADRAIQQFGRTHRSNQ+  PEY+FLIS+LAGERRFAS VAKRLESLGALTHGDRRATE+RDLS++N +NK+G +ALD I         S VP PK           D++     VG+   +P+ G N      ++KFLNRILG+ +  QN LFQY+TD  D LI++ K+  ++D GI+DLA  +D I+ E   +F       + +V L+++    GM W  AL   +  +N  DGFY++ K       VL  ++   H     V+ PNVG+Q      +++ + ++K T EEA+  W   Y  +  +C H  W   C   +  + C  G R +  +VL G++  +W    D+++ +  S  L  VRL
Sbjct:  612 TNCHAAQLEEKKQGLLNKISELGKELPLNTLDELIDKFGGPERVAEMTGRKGRVVRQPD-GSVRYESRAEQGHTIDHINIKEKDRFMNGDKLVAIISEAASSGISLQADRRVNNQCRRVHMTLELPWSADRAIQQFGRTHRSNQVTAPEYIFLISELAGERRFASIVAKRLESLGALTHGDRRATESRDLSKYNFENKYGTKALDKITKAILGQIESKVPPPKEYPGGDAMFFRDMKQGMMDVGIFCKEPRFGINTEKDCSITKFLNRILGLEVHKQNSLFQYFTDNFDYLIEKDKKEGKYDMGILDLAPGNDEIYNETQDMFLTPGNPQEGQVILYKISVDRGMPWEEALNKSQTLSNPDDGFYLSHKVRGSHPCVLLAEQGRGHN--LVVYKPNVGKQKQTENLENIQKKYRKVTAEEAKESWESQYKFSFKKCSHAVWTGRCKKVDEGQECLQGMRLRQYHVLCGALLCVWKRVADVVADVTSSSILQIVRL 1103          
BLAST of Protein strawberry notch homolog 1 vs. Ensembl Cavefish
Match: si:ch73-63e15.2 (protein strawberry notch homolog 2-like [Source:NCBI gene;Acc:103045466])

HSP 1 Score: 456.833 bits (1174), Expect = 1.025e-136
Identity = 239/478 (50.00%), Postives = 326/478 (68.20%), Query Frame = 3
Query:  627 VYSQYQPLKLRKGKVHPYXXXXXXXXXXXXXXXXRYCLSLPDGIIQNALLSNVQLEAVIYGCQRHEEILPTGERAGYLIGDGAGVGKGRTLAAIIYENYILHRKRAVWISVSNDLKHDAERDLCDLDANHIKIHPLNKMRYAKINSPENGNVRKGVLFSTYASLIGECQNMTKSKYKTRFRQIVQWFGTDYDGVIVFDECHKAKNLMPQGSQKKTKTAEIVLKLQETLPKARIVYASATGASEPRNMAYMTRLGLWGPGTPFKKFEDFVEKLEDK-VGAMELVAVDMKQRGMYIARQLSFANVTFRVHEVQLTNVKIGEHYFMNVYNESVDLWTRIFDNMNQALNTRFIAKKHAKTVWGQYWAAHQRFFKYLCMAGKVQECVRITMDAITQHKCVVIGLQSTGEAKTNEMLEDYGGEVTEFVSCARGILQSFVERFFPTEENINQMD---KREDKTKTQNSKTNRKKGSSKKPISLQD 2048
             Y++Y+P K   G  HP  VVE+S+LSSV  P++ Y LS+P+ II + LLS +QLEA+IY CQ+HE IL   +RAG+LIGDGAGVGKGRT+A II ENY+  RK+A+W SVSNDLK+DAERDL D+ A ++ +H LNK++Y    + E      GVLF+TY++LIGE Q     +++TR  QI+ W G+D+DGVI+FDECHKAKN         TK  + VL LQ  LP AR+VYASATGASEP+NM YM+RLG+WG GTPFK F+DF+  +E + VGAME+VA+DMK  GMYIARQLSF+ V+FR+ E+ L      +  F  VYN++  LW        QA +   +     K++WGQ+W++HQRFFKYLC+A KV+  V +    +   KCVVIGLQSTGEA+T E+L++  G + +FVS A G+ QS V++ FP+E+   +     KR+ K + +N K  ++    +  I++ +
Sbjct:  156 TYAEYKPSKSTIGNSHPDRVVETSTLSSVPPPDITYTLSIPENIINDRLLSALQLEAIIYACQQHEVILQNNQRAGFLIGDGAGVGKGRTVAGIILENYLKGRKKALWFSVSNDLKYDAERDLQDIGAPNVLVHALNKIKYGDTATSE------GVLFATYSALIGESQ--AGGQHRTRLNQILDWCGSDFDGVIIFDECHKAKN------ATSTKMGKAVLDLQSKLPLARVVYASATGASEPKNMIYMSRLGIWGEGTPFKTFDDFLHAVEKRGVGAMEIVAMDMKVSGMYIARQLSFSGVSFRIVEIGL------DDDFKVVYNKAAKLWAEALVVFTQAAD--LLGMVSTKSLWGQFWSSHQRFFKYLCIAAKVRRLVELANRELEAGKCVVIGLQSTGEARTREVLDENDGHLDKFVSAAEGVFQSLVQKHFPSEKERREKGPGTKRKRKPRGRNPKYPKQTADGRVVINISE 611          

HSP 2 Score: 392.504 bits (1007), Expect = 6.696e-114
Identity = 218/495 (44.04%), Postives = 300/495 (60.61%), Query Frame = 3
Query: 2283 VSCRITQRE-----LLDSIDRLAPKLPINTLDDLIRELGGPDYVAEMSGRKGRMVMDVNTGDVSYQPRREDDVTLEQVNMVEKERFNTCQKLVAIISDAASTGISLHADKRYENSLQRVHITLELPWSADRAIQQFGRTHRSNQIYPPEYVFLISDLAGERRFASTVAKRLESLGALTHGDRRATETRDLSQFNIDNKFGRRALDSIFDTAFKSKSSLVPMPKGI---------DLQAAFDSVGL---QPKDGKN------VSKFLNRILGMRLEVQNGLFQYYTDTMDELIKQAKRNQEFDRGIIDLAKEDDNIFVEETQVFRMTFLGDDIKVQLHRVKNITGMSWRSALEVPRGGNNSLDGFYIT-KNETQRKIVLAVQKKDRHGTWFNVFSPNVGEQSNLIENKSLNEAFKKATLEEAERMWNDMYSVTENRCLHYFWYKHC---NYSKNCDTGCRSKIRYVLSGSIFYIW----DIISAINKSPQLARVRL 3674
             +C   Q E     LL+ I  L  +LP+NTLD+LI + GGP+ VAEM+GRKGR+V   + G V Y+ R E   T++ +N+ EK+RF    KLVAIIS+AAS+GISL AD+R  N  +RVH+TLELPWSADRAIQQFGRTHRSNQ+  PEY+FLIS+LAGERRFAS VAKRLESLGALTHGDRRATE+RDLS++N +NK+G +ALD I         S VP PK           D++     VG+   +P+ G N      ++KFLNRILG+ +  QN LFQY+TD  D LI++ K+  ++D GI+DLA  +D I+ E   +F       + +V L+++    GM W  AL   +  +N  DGFY++ K       VL  ++   H     V+ PNVG+Q      +++ + ++K T EEA+  W   Y  +  +C H  W   C   +  + C  G R +  +VL G++  +W    D+++ +  S  L  VRL
Sbjct:  644 TNCHAAQLEEKKQGLLNKISELGKELPLNTLDELIDKFGGPERVAEMTGRKGRVVRQPD-GSVRYESRAEQGHTIDHINIKEKDRFMNGDKLVAIISEAASSGISLQADRRVNNQCRRVHMTLELPWSADRAIQQFGRTHRSNQVTAPEYIFLISELAGERRFASIVAKRLESLGALTHGDRRATESRDLSKYNFENKYGTKALDKITKAILGQIESKVPPPKEYPGGDAMFFRDMKQGMMDVGIFCKEPRFGINTEKDCSITKFLNRILGLEVHKQNSLFQYFTDNFDYLIEKDKKEGKYDMGILDLAPGNDEIYNETQDMFLTPGNPQEGQVILYKISVDRGMPWEEALNKSQTLSNPDDGFYLSHKVRGSHPCVLLAEQGRGHN--LVVYKPNVGKQKQTENLENIQKKYRKVTAEEAKESWESQYKFSFKKCSHAVWTGRCKKVDEGQECLQGMRLRQYHVLCGALLCVWKRVADVVADVTSSSILQIVRL 1135          
BLAST of Protein strawberry notch homolog 1 vs. Ensembl Cavefish
Match: sbno2a (strawberry notch homolog 2 [Source:NCBI gene;Acc:103025838])

HSP 1 Score: 459.914 bits (1182), Expect = 2.330e-136
Identity = 242/463 (52.27%), Postives = 318/463 (68.68%), Query Frame = 3
Query:  627 VYSQYQPLKLRKGKVHPYXXXXXXXXXXXXXXXXRYCLSLPDGIIQNALLSNVQLEAVIYGCQRHEEILPTGERAGYLIGDGAGVGKGRTLAAIIYENYILHRKRAVWISVSNDLKHDAERDLCDLDANHIKIHPLNKMRYAKINSPENGNVRKGVLFSTYASLIGECQNMTKSKYKTRFRQIVQWFGTDYDGVIVFDECHKAKNLMPQGSQKKTKTAEIVLKLQETLPKARIVYASATGASEPRNMAYMTRLGLWGPGTPFKKFEDFVEKLEDK-VGAMELVAVDMKQRGMYIARQLSFANVTFRVHEVQLTNVKIGEHYFMNVYNESVDLWTRIFDNMNQALNTRFIAKKHAKTVWGQYWAAHQRFFKYLCMAGKVQECVRITMDAITQHKCVVIGLQSTGEAKTNEMLEDYGGEVTEFVSCARGILQSFVERFFPTEENINQMDKREDKTKTQNSKTNRK 2012
             Y++Y+P K   G  HP  VVE+S+LSSV  P+V Y LS+PD  IQN LLS +QLEA+IY CQ+HE IL   +RAG+LIGDGAGVGKGRT+A II ENY+  RKRA+W SVSNDLK+DAERDL D++A +I +  LNK++Y    + E      GVLF+TY++LIGE Q     +++TR +QI+ W   ++DGVIVFDECHKAKN         TK  + VL LQ  LP AR+VYASATGASEP+NM YM+RLG+WG GTPFK FEDF+  +E + VGAME+VA+DMK  GMYIARQLSF+ V+FR+ E+ L      +  F  VYN++  LW    +   +A +   +A +  K++WGQ+W++HQRFFKYLC+A KV+  V +    + + KC+VIGLQSTGEA+T E+L++  G +  FVS A G+ QS V++ FP E        +  K KT  +K  RK
Sbjct:  186 TYAEYKPSKSTIGISHPDIVVETSTLSSVPPPDVTYTLSIPDSTIQNGLLSALQLEAIIYACQQHEVILQNNQRAGFLIGDGAGVGKGRTVAGIILENYLKGRKRALWFSVSNDLKYDAERDLRDIEAPNIPVFALNKIKYGDTATSE------GVLFATYSALIGESQ--AGGQHRTRLKQILDWCKPEFDGVIVFDECHKAKNAT------STKMGKAVLDLQNKLPLARVVYASATGASEPKNMIYMSRLGIWGEGTPFKTFEDFLHAIEKRGVGAMEIVAMDMKVSGMYIARQLSFSGVSFRIEEITL------DEEFKVVYNKAARLWAEALELFTRAADLLALASR--KSLWGQFWSSHQRFFKYLCIAAKVRRLVELAQAEMERGKCIVIGLQSTGEARTREVLDENDGHLDRFVSAAEGVFQSLVQKHFPLE--------KPKKEKTAGNKRKRK 618          

HSP 2 Score: 399.438 bits (1025), Expect = 3.397e-115
Identity = 228/544 (41.91%), Postives = 326/544 (59.93%), Query Frame = 3
Query: 2310 LLDSIDRLAPKLPINTLDDLIRELGGPDYVAEMSGRKGRMVMDVNTGDVSYQPRREDDVTLEQVNMVEKERFNTCQKLVAIISDAASTGISLHADKRYENSLQRVHITLELPWSADRAIQQFGRTHRSNQIYPPEYVFLISDLAGERRFASTVAKRLESLGALTHGDRRATETRDLSQFNIDNKFGRRALDSIFDTAFKSKSSLVPMPKG---------IDLQAAFDSVGL---QPKDGKN------VSKFLNRILGMRLEVQNGLFQYYTDTMDELIKQAKRNQEFDRGIIDLAKEDDNIFVEETQVFRMTFLGDDIKVQLHRVKNITGMSWRSALEVPRGGNNSLDGFYITKN--ETQRKIVLAVQKKDRHGTWFNVFSPNVGEQSNLIENKSLNEAFKKATLEEAERMWNDMYSVTENRCLHYFWYKHC---NYSKNCDTGCRSKIRYVLSGSIFYIW----DIISAINKSP--QLARVRLNDGSKIIGCIINPSHKERITEILANRESHPQQTIPVSTAGRAQQQVQLQKDRPMLQRPVR 3854
            LL  I  L  +LP+NTLD+LI   GGP+ V+EM+GRKGR+V   + G V Y+ R E  +T++ VN+ EKERF   +KLVAIIS+AAS+GISL ADKR +N  +RVH+TLELPWSADRAIQQFGRTHRSNQ+  PEY+FLIS+LAGERRFAS VAKRLESLGALTHGDRRATE+RDLS++N +NK+G +ALD I         + VP PKG          D++     VG+   +P+ G N      ++KFLNRILG+ +  QN LFQY+TD  D LI + K+   +D GI+DLA  +D I+ EE +V+       + +V L+++    GM W  A +         +GFY++     +Q  ++LA Q + R+     V+ PN+G Q++     +L   ++K T EEA+  W + +  +  +C H  W   C      + C  G R +  ++L G++  +W    D+IS +  S   Q+ R++    SK +G  I  +  ER+   L+  +S            RA+++ QL K++ + ++  R
Sbjct:  687 LLSKIAELGKELPLNTLDELIDRFGGPERVSEMTGRKGRVVRRPD-GRVQYESRAEQGLTIDHVNVKEKERFMVGEKLVAIISEAASSGISLQADKRVQNQRRRVHMTLELPWSADRAIQQFGRTHRSNQVTAPEYIFLISELAGERRFASIVAKRLESLGALTHGDRRATESRDLSKYNFENKYGTKALDKITKAILGHIENKVPAPKGYPGGEARFFADMKKGMIDVGIFCREPRFGLNTEKDCTITKFLNRILGLEVHQQNSLFQYFTDNFDYLIDKDKKEGRYDMGILDLAPGNDEIYEEEQEVYLTPGNPQEGQVTLYKISVDRGMPWDEACKKAETLTKEHEGFYLSHKLRGSQPCVLLAEQGRGRN---LIVYKPNIGRQAHPENLDNLQMRYRKVTPEEAKDTWENQFVFSFKKCSHANWKGKCKQVEQGQECWLGMRLRQYHMLCGALLRVWKRVADVISDVTNSSILQIVRLKTKQNSKQVGIKIPENCVERVRSELSQMDSE---------VKRARKEKQLAKEKRIQEQRAR 1217          
BLAST of Protein strawberry notch homolog 1 vs. Ensembl Sea Lamprey
Match: sbno1 (strawberry notch homolog 1 (Drosophila) [Source:ZFIN;Acc:ZDB-GENE-080522-2])

HSP 1 Score: 378.637 bits (971), Expect = 3.085e-118
Identity = 212/499 (42.48%), Postives = 299/499 (59.92%), Query Frame = 3
Query: 2364 DLIRELGGPDYVAEMSGRKGRMVMDVNTGDVSYQPRREDDVTLEQVNMVEKERFNTCQKLVAIISDAASTGISLHADKRYENSLQRVHITLELPWSADRAIQQFGRTHRSNQIYPPEYVFLISDLAGERRFASTVAKRLESLGALTHGDRRATETRDLSQFNIDNKFGRRALDSIFDTAFKSKSSLVPMPK---------------GIDLQAAFDSVGLQP--KDGKNVSKFLNRILGMRLEVQNGLFQYYTDTMDELIKQAKRNQEFDRGIIDLAKEDDNIFVEETQVFRMTFLGDDIKVQLHRVKNITGMSWRSALEVPRGGNNSLDGFYITKN--ETQRKIVLAVQKKDRHGTWFNVFSPNVGEQSNLIENKSLNEAFKKATLEEAERMWNDMYSVTENRCLHYFWYKHCNYSK---NCDTGCRSKIRYVLSGSIFYIWDIISAINKSP-------QLARVRLNDGSKIIGCIINPSHKERITEILANRESHPQQT 3773
            +LI ELGG D VAEM+GRKGR+V + + G ++Y+ R E DV +E +N+ EK+RF    K +AIIS+AAS+GISL AD+R +N  +RVH+TLELPWSADRAIQQFGRTHRSNQ+  PEY+FLIS+LAGE+RFAS VAKRLESLGALTHGDRRATE+RDLS++N DNK+GR+AL+ +  +     + LVP P                G+ +    + +GL    KD  N+ KFLNRILGM +  QN LFQY++DT+  +I  AKR   +D GI+DL   ++ +   E + F          V+++ V    GMSW  A EV    +   DGFY++      +R  VLA +   R    F ++ PN G+Q        L + +KK + ++A   W + ++ +++ C H +W  +C  +     C+ G R +  +VL GS+  +W  +  +  S        Q+ R+R  DG +I+G II  S    +  +LA+ E   QQ 
Sbjct:    1 ELIDELGGTDNVAEMTGRKGRVVSN-DDGSIAYESRSELDVPVEILNVTEKKRFMDGDKNIAIISEAASSGISLQADRRAKNQRRRVHMTLELPWSADRAIQQFGRTHRSNQVNAPEYLFLISELAGEQRFASIVAKRLESLGALTHGDRRATESRDLSRYNFDNKYGRQALEMVMKSIVGLDAPLVPPPSDYCGDFFRDILKGLVGVGMVNIDERMGLPTLDKDYNNIGKFLNRILGMEVAQQNSLFQYFSDTLQAVIVNAKRAGRYDMGILDLGSGEERVKKLEVKRFNTRGHSGAGHVEMYTVLVERGMSWEEATEVWADQSGPDDGFYLSLQVRNGKRTAVLAREVSTRK-RLFLIYRPNTGKQLRHEMYADLKKKYKKVSSDDAMPHWEEQFNTSKDTCTHAYWRGNCKKAALGMVCEVGLRCRTYHVLCGSVLSVWSRVEGVMTSVSGSHLKMQIVRLRTEDGQRIVGLIIPQSCVPLLACVLASVEQQQQQA 497          
BLAST of Protein strawberry notch homolog 1 vs. Ensembl Sea Lamprey
Match: si:ch73-63e15.2 (strawberry notch homolog 2a [Source:ZFIN;Acc:ZDB-GENE-100629-3])

HSP 1 Score: 382.104 bits (980), Expect = 1.025e-112
Identity = 213/489 (43.56%), Postives = 294/489 (60.12%), Query Frame = 3
Query: 2301 QRELLDSIDRLAPKLPINTLDDLIRELGGPDYVAEMSGRKGRMVMDVNTGDVSYQPRREDDVTLEQVNMVEKERFNTCQKLVAIISDAASTGISLHADKRYENSLQRVHITLELPWSADRAIQQFGRTHRSNQIYPPEYVFLISDLAGERRFASTVAKRLESLGALTHGDRRATETRDLSQFNIDNKFGRRALDSIFDTAFKSKS--SLVPMPKGI------DLQAAFDSVGLQPKDGK----------NVSKFLNRILGMRLEVQNGLFQYYTDTMDELIKQAKRNQEFDRGIIDLAKEDDNIFVEETQVFRMTFLGDDIKVQLHRVKNITGMSWRSALEVPRGGNNSLDGFYITK-NETQRKIVLAVQKKDRHGTWFNVFSPNVGEQSNLIENKSLNEAFKKATLEEAERMWNDMYSVTENRCLHYFWYKHCNYSK---NCDTGCRSKIRYVLSGSIFYIW----DIISAINKSPQLARVRLNDGSK 3689
            +++LL  ++ L   LP+NTLD+LI +LGGP  VAEM+GRKGR+V   + G V+Y+ R E  V ++ VN+ EK+RF T +K VAIIS+AAS+GISL AD+R EN  +RVH+TLELPWSADRAIQQFGRTHRSNQ+  PEY+FLIS+LAGERRFAS VAKRLESLGALTHGDRRATE+RD+S+FN DNK+GR A++ +  +         +VP P         D++     VGL  KD K           ++KFLNRILGM +  QN +FQY+ DT +  I  AK+  ++D GI+DLA   + I  E+   F++       +V L+ VK   G+SW  ALE  +      DGFY+ K   + R++ +  ++ D+    F ++ PN G+Q +  E + L+  + K     A    +  Y  + + C H FW   C       +C  G R  + +VL G++  +W    D I  +  S  +  VRL    K
Sbjct:  632 KQDLLRKVEELTKDLPLNTLDELIEKLGGPSIVAEMTGRKGRIVQKAD-GKVAYESRAEPGVHIDIVNIKEKQRFMTGEKHVAIISEAASSGISLQADRRAENKRRRVHMTLELPWSADRAIQQFGRTHRSNQVSAPEYLFLISELAGERRFASIVAKRLESLGALTHGDRRATESRDMSRFNFDNKYGREAMEKVLKSLINQIDFHYMVPPPASYEGDFFEDMRQGLVGVGLITKDYKGNYSIEKAELGLAKFLNRILGMEVTKQNAIFQYFIDTFEVTIDAAKKEGKYDMGILDLAPGVEEINEEKKHTFKIPSSMGSGQVVLYTVKVDRGISWDHALERRKKMTGLNDGFYVMKLMRSGRQMAILAEEFDKEKKLFVIYRPNTGKQRHQEELRDLSRKYDKVAARPAGVHLSTQYDWSFDSCSHAFWSGRCRNVAALGSCSHGGRLCLHHVLCGTLLSVWRGVEDAIQQVTNSTSMQIVRLQTKDK 1119          

HSP 2 Score: 301.212 bits (770), Expect = 8.103e-85
Identity = 184/446 (41.26%), Postives = 264/446 (59.19%), Query Frame = 3
Query:  627 VYSQYQPLKLRKGKVHPYXXXXXXXXXXXXXXXXRYCLSLPDGIIQNALLSNVQLEAVIYGCQRHEEILP---TGERAGYLIGDGAG---VGKGRTLAAIIYENYILHRKRAVW-ISVSNDLKHDAERDLCDLDANHIKIHPLNKMRYAKINSPENGNVRKGVLFSTYASLIGECQNMTKSKYKTRFRQIVQWFGTDYDGVIVFDECHKAKNLMPQGSQKKTKTAEIVLKLQETLPKARIVYASATGASEPRNMAYMTRLGLWGPGTPFKKFEDFVEKLEDK-VGAMELVAVDMKQRGMYIARQLSFANVTFRVHEVQLTNVKIGEHYFMNVYNESVDLWTRIFDNMNQALNTRFIAKKHAKTVWGQYWAAHQRFFKYLCMAGKVQECVRITMDAITQHKCVVIGLQSTGEAKTNEMLEDYGGEVTEFVSCARGILQSFVERFFPT 1940
             Y+ Y P KL  G+ HP  VVE+S+LSSV +P++ Y L +PD  I +  LS +QLEA+ Y CQ+    LP       AG ++    G     K  +    I    +LH     W   V +  K+D   +  +   ++ ++    +++Y   +      +R+GVLF+TY++LIGE  +      +TR +Q++ W G ++DGV+VFDECHKAKNL P G+ K TKT + VL LQ  LP AR+VYASATG    +NM  +T L     G P+      ++    + VG ME+VA+DMK  GMYIARQLSF  VTFRV E+ L         F NVY+ +V LW  + D  ++A +         K++WGQ+W++HQRFFKY+C+AGKVQ+ V +  +A+ Q KCVVIGLQSTGEA+T E LE   G + +FVS A G+L++ +++ FP+
Sbjct:   23 TYADYTPAKLSIGRNHPDRVVETSTLSSVPLPDITYHLHMPDYAISSGKLSALQLEAITYSCQQFTPNLPDLYPRSSAGLMLRGSCGWQCSEKTLSFGTCI----LLH-----WCFPVLHQTKYDLNNNNKNPKLSNTQVKLTTQIKYGSTDR----RMREGVLFATYSALIGE--SFATGTMRTRIKQVLDWCGPEFDGVVVFDECHKAKNLCPVGAAKPTKTGKAVLDLQNKLPHARVVYASATGNDRGQNMFKLTHL----IGPPYFSLSHTIQSGRVRGVGGMEIVAMDMKLSGMYIARQLSFHGVTFRVVEIPLPE------QFRNVYDRAVKLWLEMMDKFDRAASV--CPDVSRKSLWGQFWSSHQRFFKYMCIAGKVQQAVTLAHEALKQGKCVVIGLQSTGEARTREELELGNGTIDKFVSAAGGVLKALIKKNFPS 441          
BLAST of Protein strawberry notch homolog 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008028.1 (pep scaffold:Pmarinus_7.0:GL481209:3:7423:-1 gene:ENSPMAG00000007246.1 transcript:ENSPMAT00000008028.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 266.929 bits (681), Expect = 1.434e-78
Identity = 138/225 (61.33%), Postives = 172/225 (76.44%), Query Frame = 3
Query:  627 VYSQYQPLKLRKGKVHPYXXXXXXXXXXXXXXXXRYCLSLPDGIIQNALLSNVQLEAVIYGCQRHEEILPTGERAGYLIGDGAGVGKGRTLAAIIYENYILHRKRAVWISVSNDLKHDAERDLCDLDANHIKIHPLNKMRYAKINSPENGNVRKGVLFSTYASLIGECQNMTKSKYKTRFRQIVQWFGTDYDGVIVFDECHKAKNLMPQGSQKKTKTAEIVLKLQ 1301
             Y++Y PLKLR G  HP  VVE+SSLSSV  P++ Y LS+P+  + +  LS +QLEA+ YGCQ+ E  L  GERAG+LIGDGAGVGKGRT+A IIYENY+L RKRAVW SVSNDLK+DAERDL D+ A +I +H L+K +Y KI S ENG V+KGV+F+TY++LIGE Q  +  KY+TR +Q++ W   D+DGVI+FDECHKAKNL P GS K TKT   VL+LQ
Sbjct:  246 TYAEYMPLKLRIGLRHPDAVVETSSLSSVTPPDIWYRLSIPEETVDSGWLSALQLEAITYGCQQQETYLTNGERAGFLIGDGAGVGKGRTIAGIIYENYLLGRKRAVWFSVSNDLKYDAERDLKDIGAKNITVHSLSKFKYGKITSKENGAVKKGVVFATYSALIGESQ--SGGKYRTRIKQLLHWCSDDFDGVIIFDECHKAKNLCPVGSSKPTKTGLAVLELQ 468          
BLAST of Protein strawberry notch homolog 1 vs. Ensembl Nematostella
Match: EDO43448 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYE6])

HSP 1 Score: 163.31 bits (412), Expect = 4.955e-44
Identity = 86/153 (56.21%), Postives = 112/153 (73.20%), Query Frame = 3
Query: 2343 LPINTLDDLIRELGGPDYVAEMSGRKGRMVMDVNTGDVSYQPRREDDVTLEQVNMVEKERFNTCQKLVAIISDAASTGISLHADKRYENSLQRVHITLELPWSADRAIQQFGRTHRSNQIYPPEYVFLISDLAGERRFASTVAKRLESLGALT 2801
            LPI+ LDDLI ++GGPD VAEM+GR+GR+V      +  Y+ R  D   ++ +N+ E+  F +  KLVAIISDAASTGISLHAD R  N  +RVH+T+ELPWSAD+A+QQ GR+HRSNQ   P Y  + ++L GERRFA+ VA+RL+SLG  T
Sbjct:  187 LPISPLDDLIDKMGGPDCVAEMTGRRGRVVRTAQDREPHYEARESDSSHVDSLNIQERNSFMSGSKLVAIISDAASTGISLHADLRAANQRRRVHVTIELPWSADKAVQQLGRSHRSNQSSGPIYKLVTTNLGGERRFAAAVARRLQSLGTYT 339          

HSP 2 Score: 119.013 bits (297), Expect = 7.681e-29
Identity = 72/223 (32.29%), Postives = 101/223 (45.29%), Query Frame = 3
Query: 1308 LPKARIVYASATGASEPRNMAYMTRLGLWGPGTPFKKFEDFVEKLEDKVGAMELVAVDMKQRGMYIARQLSFANVTFRVHEVQLTNVKIGEHYFMNVYNESVDLWTRIFDNMNQALNTRFIAKKHAKTVWGQYWAAHQRFFKYLCMAGKVQECVRITMDAITQHKCVVIGLQSTGEAKTNEMLEDYGGEVTEFVSCARGILQSFVERFFPTEENINQMDKRED 1976
            LP AR+VY SATG ++ +NMA+M RLGLWG GT FK FE F+E               + +RG+                      +K    Y +   N +               NTR         +W  +W++HQRFFK LCM+ KV   V+    A+     VVIGLQ+TGEA     L   GG +  F+S    I+  F+ ++FP +      + +ED
Sbjct:    2 LPLARVVYCSATGVTDVKNMAFMERLGLWGEGTAFKSFESFLE--------------SITKRGL------------------GTKEIKTSLEYALARTNTT---------------NTR---------IWSLFWSSHQRFFKQLCMSMKVPLIVKEAKAALNDGYSVVIGLQTTGEASLESELNRNGGRINRFISICEEIMTRFITQYFPVKIQSTSGEAKED 168          
BLAST of Protein strawberry notch homolog 1 vs. Ensembl Nematostella
Match: EDO43449 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYE7])

HSP 1 Score: 112.464 bits (280), Expect = 1.540e-25
Identity = 83/295 (28.14%), Postives = 136/295 (46.10%), Query Frame = 3
Query: 2973 LQPKDGKNVSKFLNRILGMRLEVQNGLFQYYTDTMDELIKQAKRNQEFDRGIIDLAKEDDNIFVEETQVFRMTFLGDDIKVQLHRVKNITGMSWRSALE-VPRGGNNSLDGFYITKNET--QRKIVLAVQKKDRHGTWFNVFSPNVGEQSNLIENKSLNEAFKKATLEEAERMWNDMYSVTENRCLHYFWYKHCNYSKNCDTGCRSKIRYVLSGSIFYI-----WDI--------ISAINKSPQLARVRLNDGSKIIGCIINPSHKERITEILANRESHPQQTIPVSTAGRAQQQ 3809
            ++ K+  +VS+FLNRILG+ +E QN +F Y+++ ++  I+ AKR  +++ G+ DL      +      VF  T +   +  Q   +    G+ W +A++          DGFY +K E   QR  +LA+QK++     FN+  PN G+     E   L   + K + +EAE+ W   Y  T + C H      C     C  GCR    ++L G I  I     W +        +S  ++  ++ RV L+DG +++G                    +P+Q IPV TA   +QQ
Sbjct:   41 VKEKEAGDVSRFLNRILGLSVEKQNLIFSYFSECLNATIETAKREGKYNEGVTDLTASSITMVGPPCPVF--TEVKGIMPTQHVTLSVDRGIEWPAAMKRYENSAQGKHDGFYWSKREQRYQRFYLLAIQKENST-HLFNIIRPNTGQSPFEEEKTDLLHKYTKISPDEAEKGWKMQYDKTRDHCFH---GPGCKTGPLCRVGCRISRVHLLCGGIVPILSTLEWAVSRHAEKAGLSREDRMLRVIRVELDDGQRLVGL------------------RYPEQLIPVVTALLKEQQ 311          
BLAST of Protein strawberry notch homolog 1 vs. Ensembl Nematostella
Match: EDO25714 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8DVP5])

HSP 1 Score: 106.301 bits (264), Expect = 3.251e-24
Identity = 75/192 (39.06%), Postives = 110/192 (57.29%), Query Frame = 3
Query: 2316 DSIDRLA--PKLPINTLDDLIRELGGPDYVAEMSGRKGRMVMDVNTGDVSYQPRREDDVTLEQVNMVEKERFNTCQKLVAIISDAASTGISLHADKRYENSLQRVHITLELPWSADRAIQQFGRTHRSNQIYPPEYVFLISDLAGERRFASTVAKRLESLGALTHGDRRATETRDL--SQFNIDNKFGRRAL 2879
            D ++R+A  P +P   LD L+ E  G D VAE++GR  R+V+           RR            E + F + +K + + SDA  TG S HAD   +N  +R H  +E  W AD AIQ  GR+HR++Q  PP +  + +D+ GE+RF ST+A+RL+SLGALT G+RR T    L  ++ N+++ + RRAL
Sbjct:  209 DLVERMALLPSVP-GVLDALL-ETFGTDAVAEITGRARRVVVRDGR---RLVERRGASAARS-----ETDAFMSGRKRILVFSDAGGTGRSYHADLSAQNQQRRSHYLVEPGWRADTAIQGLGRSHRTHQASPPVFRPVTTDIHGEKRFTSTIARRLDSLGALTRGERR-TAGAGLFRAEDNLESPWARRAL 389          
BLAST of Protein strawberry notch homolog 1 vs. Ensembl Nematostella
Match: EDO43447 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYE5])

HSP 1 Score: 86.6557 bits (213), Expect = 6.506e-20
Identity = 50/129 (38.76%), Postives = 74/129 (57.36%), Query Frame = 3
Query:  987 RDLCDLDANHIKIHPLNKM-RYAKINSPENGNVRKGVLFSTYASLIGECQNMTKSKYKTRFRQIVQWFGTD-YDGVIVFDECHKAKNLMPQGSQKKTKTAEIVLKLQETLPKARIVYASATGASEPRNM 1367
            RDL D+D     I     + +  K+     G  ++GV+FSTYA+L+   Q       +TR +Q++ W G + +DG ++FDE HKAK+ +P   +  TK A  V  LQ  LP AR+VY SATG ++ +NM
Sbjct:    1 RDLHDIDCYVKVIEGCQHLDKETKVFGLPPG-CKEGVVFSTYATLVSSVQK--GGSRQTRLQQLMDWCGGETFDGCLIFDESHKAKHFIPGKEENSTKIALAVTTLQRMLPLARVVYCSATGVTDVKNM 126          
BLAST of Protein strawberry notch homolog 1 vs. Ensembl Medaka
Match: sbno1 (strawberry notch homolog 1 [Source:NCBI gene;Acc:101170031])

HSP 1 Score: 523.087 bits (1346), Expect = 2.829e-161
Identity = 267/475 (56.21%), Postives = 352/475 (74.11%), Query Frame = 3
Query:  630 YSQYQPLKLRKGKVHPYXXXXXXXXXXXXXXXXRYCLSLPDGIIQNALLSNVQLEAVIYGCQRHEEILPTGERAGYLIGDGAGVGKGRTLAAIIYENYILHRKRAVWISVSNDLKHDAERDLCDLDANHIKIHPLNKMRYAKINSPENGNVRKGVLFSTYASLIGECQNMTKSKYKTRFRQIVQWFGTDYDGVIVFDECHKAKNLMPQGSQKKTKTAEIVLKLQETLPKARIVYASATGASEPRNMAYMTRLGLWGPGTPFKKFEDFVEKLEDK-VGAMELVAVDMKQRGMYIARQLSFANVTFRVHEVQLTNVKIGEHYFMNVYNESVDLWTRIFDNMNQALNTRFIAKKHAKTVWGQYWAAHQRFFKYLCMAGKVQECVRITMDAITQHKCVVIGLQSTGEAKTNEMLEDYGGEVTEFVSCARGILQSFVERFFPTEE-----NINQMDKREDKTKTQNSKT--NRKKGSSKK 2030
            Y++Y P+KL+ G  HP PVVE+SSLSSV  P+V Y LS+P+ +I    LS +QLEA+ Y  Q+HE  LP+G+RA YLIGDGAGVGKGRT+A IIYENY+L RKR++W SVSNDLK+DAERDL D+ A +I++H LNK +Y KI+S  NG+V+KGV+F+TY+SLIGE Q  +  KYKTRF+Q++ W G D+DGVIV+DECHKAKN+ P GS K TKT   VL+LQ  LPKAR+VYASATGASEPRNMAYM RLG+WG  TPF++F +F++ +E + VGAME+VA+DMK RGMYIARQLSF  VTF++ EV L+        ++++YN+SV LW    +   QA +     ++  K++WGQ+W+AHQRFFKYLC+A KV+  V++T + +   KCVVIGLQSTGEA+T E LE+ GGE+ +FVS A+G+LQS VE+ FP  +     ++  +D    KT + +  T    KKG  +K
Sbjct:  254 YAEYMPMKLKIGLRHPDPVVETSSLSSVNPPDVWYRLSIPEEVIDRGWLSALQLEAITYAAQQHETFLPSGDRAAYLIGDGAGVGKGRTIAGIIYENYLLGRKRSLWFSVSNDLKYDAERDLRDIGAKNIQVHSLNKFKYGKISSKHNGSVKKGVIFATYSSLIGESQ--SGGKYKTRFQQLLHWCGEDFDGVIVYDECHKAKNVCPIGSSKPTKTGLAVLELQNKLPKARVVYASATGASEPRNMAYMNRLGIWGHKTPFREFSNFIQAVERRGVGAMEIVAMDMKLRGMYIARQLSFTGVTFKIEEVPLS------QRYIDMYNKSVRLWVHARERFQQAASLMDAEQRMKKSMWGQFWSAHQRFFKYLCIASKVRRVVQLTREEVHNGKCVVIGLQSTGEARTLEALEEGGGELNDFVSTAKGVLQSLVEKHFPAPDRQKLYSLLGIDLSAKKTPSPSDATVEPEKKGQKRK 720          

HSP 2 Score: 416.772 bits (1070), Expect = 1.463e-122
Identity = 220/485 (45.36%), Postives = 300/485 (61.86%), Query Frame = 3
Query: 2346 PINTLDDLIRELGGPDYVAEMSGRKGRMVMDVNTGDVSYQPRREDDVTLEQVNMVEKERFNTCQKLVAIISDAASTGISLHADKRYENSLQRVHITLELPWSADRAIQQFGRTHRSNQIYPPEYVFLISDLAGERRFASTVAKRLESLGALTHGDRRATETRDLSQFNIDNKFGRRALDSIFDTAFKSKSSLVPMPKGI------DLQAAFDSVGL-----------QPKDGKNVSKFLNRILGMRLEVQNGLFQYYTDTMDELIKQAKRNQEFDRGIIDLAKEDDNIFVEETQVFRMTFLGDDIKVQLHRVKNITGMSWRSALEVPRGGNNSLDGFYITKNETQRKIVLAVQKKDRHGTWFNVFSPNVGEQSNLIENKSLNEAFKKATLEEAERMWNDMYSVTENRCLHYFWYKHCNYSK---NCDTGCRSKIRYVLSGSIFYIWD-------IISAINKSPQLARVRLNDGSKIIGCIINPSH 3719
            P NTLD+LI ELGGP+ VAEM+GRKGR+V +   G ++Y+ R E DV +E +N+ EK+RF   +K +AIIS+AAS+GISL AD+R +N  +RVH+TLELPWSADRAIQQFGRTHRSNQ+  PEYVFLIS+LAGE+RFAS VAKRLESLGALTHGDRRATETRDLS+FN DNK+GR AL+ +  +  K  ++LVP P         ++Q+    VGL             KD  N+ KFLNRILGM +  QN LFQY++DT+  +I++AK+N  +D GI+DL   D+ +   + + F          V+LH V    GMSW  A       N S DGFY+     ++  +L V++ +     F V+ PN G Q  L     + + FKK   E+A++ W D Y+++   C H +W  +C  +     C+ G R +  YVL GS+  +W+        +   N   Q+ R+R +DG +I+ C +   H
Sbjct:  881 PPNTLDELIDELGGPENVAEMTGRKGRVVSN-GDGSITYESRSELDVPVEILNLTEKQRFMDGEKNIAIISEAASSGISLQADRRVKNQRRRVHMTLELPWSADRAIQQFGRTHRSNQVTAPEYVFLISELAGEQRFASIVAKRLESLGALTHGDRRATETRDLSRFNFDNKYGRNALEIVMKSIVKLDAALVPPPADFKGDFFKEIQSGLIGVGLISVEDRSGALSLDKDYNNIGKFLNRILGMEVHQQNALFQYFSDTLAAVIQEAKKNGRYDMGILDLGSGDEKVKKIDCRKFLTPGYTASGHVELHTVSVERGMSWEEATHAWAEQNGSDDGFYVQMRNNKKTAIL-VKEVNPKKRLFLVYRPNTGRQLKLETYVDIKKKFKKVLSEDAKQHWTDQYTLSAKICSHAYWRGNCKKASVGLQCEVGLRCRSYYVLCGSVLSVWNELEEVLTPVGGTNVKVQIVRLRTDDGQRIVECFLKIVH 1363          
BLAST of Protein strawberry notch homolog 1 vs. Ensembl Medaka
Match: sbno1 (strawberry notch homolog 1 [Source:NCBI gene;Acc:101170031])

HSP 1 Score: 524.242 bits (1349), Expect = 2.918e-161
Identity = 259/440 (58.86%), Postives = 338/440 (76.82%), Query Frame = 3
Query:  630 YSQYQPLKLRKGKVHPYXXXXXXXXXXXXXXXXRYCLSLPDGIIQNALLSNVQLEAVIYGCQRHEEILPTGERAGYLIGDGAGVGKGRTLAAIIYENYILHRKRAVWISVSNDLKHDAERDLCDLDANHIKIHPLNKMRYAKINSPENGNVRKGVLFSTYASLIGECQNMTKSKYKTRFRQIVQWFGTDYDGVIVFDECHKAKNLMPQGSQKKTKTAEIVLKLQETLPKARIVYASATGASEPRNMAYMTRLGLWGPGTPFKKFEDFVEKLEDK-VGAMELVAVDMKQRGMYIARQLSFANVTFRVHEVQLTNVKIGEHYFMNVYNESVDLWTRIFDNMNQALNTRFIAKKHAKTVWGQYWAAHQRFFKYLCMAGKVQECVRITMDAITQHKCVVIGLQSTGEAKTNEMLEDYGGEVTEFVSCARGILQSFVERFFPTEE 1946
            Y++Y P+KL+ G  HP PVVE+SSLSSV  P+V Y LS+P+ +I    LS +QLEA+ Y  Q+HE  LP+G+RA YLIGDGAGVGKGRT+A IIYENY+L RKR++W SVSNDLK+DAERDL D+ A +I++H LNK +Y KI+S  NG+V+KGV+F+TY+SLIGE Q  +  KYKTRF+Q++ W G D+DGVIV+DECHKAKN+ P GS K TKT   VL+LQ  LPKAR+VYASATGASEPRNMAYM RLG+WG  TPF++F +F++ +E + VGAME+VA+DMK RGMYIARQLSF  VTF++ EV L+        ++++YN+SV LW    +   QA +     ++  K++WGQ+W+AHQRFFKYLC+A KV+  V++T + +   KCVVIGLQSTGEA+T E LE+ GGE+ +FVS A+G+LQS VE+ FP  +
Sbjct:  254 YAEYMPMKLKIGLRHPDPVVETSSLSSVNPPDVWYRLSIPEEVIDRGWLSALQLEAITYAAQQHETFLPSGDRAAYLIGDGAGVGKGRTIAGIIYENYLLGRKRSLWFSVSNDLKYDAERDLRDIGAKNIQVHSLNKFKYGKISSKHNGSVKKGVIFATYSSLIGESQ--SGGKYKTRFQQLLHWCGEDFDGVIVYDECHKAKNVCPIGSSKPTKTGLAVLELQNKLPKARVVYASATGASEPRNMAYMNRLGIWGHKTPFREFSNFIQAVERRGVGAMEIVAMDMKLRGMYIARQLSFTGVTFKIEEVPLS------QRYIDMYNKSVRLWVHARERFQQAASLMDAEQRMKKSMWGQFWSAHQRFFKYLCIASKVRRVVQLTREEVHNGKCVVIGLQSTGEARTLEALEEGGGELNDFVSTAKGVLQSLVEKHFPAPD 685          

HSP 2 Score: 418.313 bits (1074), Expect = 6.536e-123
Identity = 221/481 (45.95%), Postives = 300/481 (62.37%), Query Frame = 3
Query: 2346 PINTLDDLIRELGGPDYVAEMSGRKGRMVMDVNTGDVSYQPRREDDVTLEQVNMVEKERFNTCQKLVAIISDAASTGISLHADKRYENSLQRVHITLELPWSADRAIQQFGRTHRSNQIYPPEYVFLISDLAGERRFASTVAKRLESLGALTHGDRRATETRDLSQFNIDNKFGRRALDSIFDTAFKSKSSLVPMPKGI------DLQAAFDSVGL-----------QPKDGKNVSKFLNRILGMRLEVQNGLFQYYTDTMDELIKQAKRNQEFDRGIIDLAKEDDNIFVEETQVFRMTFLGDDIKVQLHRVKNITGMSWRSALEVPRGGNNSLDGFYITKNETQRKIVLAVQKKDRHGTWFNVFSPNVGEQSNLIENKSLNEAFKKATLEEAERMWNDMYSVTENRCLHYFWYKHCNYSK---NCDTGCRSKIRYVLSGSIFYIWD-------IISAINKSPQLARVRLNDGSKIIGCII 3707
            P NTLD+LI ELGGP+ VAEM+GRKGR+V +   G ++Y+ R E DV +E +N+ EK+RF   +K +AIIS+AAS+GISL AD+R +N  +RVH+TLELPWSADRAIQQFGRTHRSNQ+  PEYVFLIS+LAGE+RFAS VAKRLESLGALTHGDRRATETRDLS+FN DNK+GR AL+ +  +  K  ++LVP P         ++Q+    VGL             KD  N+ KFLNRILGM +  QN LFQY++DT+  +I++AK+N  +D GI+DL   D+ +   + + F          V+LH V    GMSW  A       N S DGFY+     ++  +L V++ +     F V+ PN G Q  L     + + FKK   E+A++ W D Y+++   C H +W  +C  +     C+ G R +  YVL GS+  +W+        +   N   Q+ R+R +DG +I+G II
Sbjct:  881 PPNTLDELIDELGGPENVAEMTGRKGRVVSN-GDGSITYESRSELDVPVEILNLTEKQRFMDGEKNIAIISEAASSGISLQADRRVKNQRRRVHMTLELPWSADRAIQQFGRTHRSNQVTAPEYVFLISELAGEQRFASIVAKRLESLGALTHGDRRATETRDLSRFNFDNKYGRNALEIVMKSIVKLDAALVPPPADFKGDFFKEIQSGLIGVGLISVEDRSGALSLDKDYNNIGKFLNRILGMEVHQQNALFQYFSDTLAAVIQEAKKNGRYDMGILDLGSGDEKVKKIDCRKFLTPGYTASGHVELHTVSVERGMSWEEATHAWAEQNGSDDGFYVQMRNNKKTAIL-VKEVNPKKRLFLVYRPNTGRQLKLETYVDIKKKFKKVLSEDAKQHWTDQYTLSAKICSHAYWRGNCKKASVGLQCEVGLRCRSYYVLCGSVLSVWNELEEVLTPVGGTNVKVQIVRLRTDDGQRIVGLII 1359          
BLAST of Protein strawberry notch homolog 1 vs. Ensembl Medaka
Match: si:ch73-63e15.2 (strawberry notch homolog 2 [Source:NCBI gene;Acc:101164046])

HSP 1 Score: 455.677 bits (1171), Expect = 6.827e-136
Identity = 237/483 (49.07%), Postives = 322/483 (66.67%), Query Frame = 3
Query:  627 VYSQYQPLKLRKGKVHPYXXXXXXXXXXXXXXXXRYCLSLPDGIIQNALLSNVQLEAVIYGCQRHEEILPTGERAGYLIGDGAGVGKGRTLAAIIYENYILHRKRAVWISVSNDLKHDAERDLCDLDANHIKIHPLNKMRYAKINSPENGNVRKGVLFSTYASLIGECQNMTKSKYKTRFRQIVQWFGTDYDGVIVFDECHKAKNLMPQGSQKKTKTAEIVLKLQETLPKARIVYASATGASEPRNMAYMTRLGLWGPGTPFKKFEDFVEKLEDK-VGAMELVAVDMKQRGMYIARQLSFANVTFRVHEVQLTNVKIGEHYFMNVYNESVDLWTRIFDNMNQALNTRFIAKKHAKTVWGQYWAAHQRFFKYLCMAGKVQECVRITMDAITQHKCVVIGLQSTGEAKTNEMLEDYGGEVTEFVSCARGILQSFVERFFPTEENINQMDKREDKTKTQNSKTNRKKGSSKKPISLQDALGKDFLE 2072
             Y++Y+P K   G  HP  VVE+++LSSV  P++ Y LS+P+  I + LLS +QLEA+IY CQ+HE IL   +RAG+LIGDGAGVGKGRT+A II ENY+  RK+A+W S+SNDLK DAERDL D+DA +I +H LNK++Y    + E      GVLF+TY++LIGE Q     +++TR +QI+ W   D+DGVI+FDECHKAKN         TK  + VL LQ  LP+AR+VYASATGASEP+NM YM+RLG+WG GTPF+ FEDF+  +E + VGAME+VA+DMK  GMYIARQLSF+ V+FR+ E+ L      +  F  VYN++  LW        +A +   +  +  K++WGQ+W+AHQRFFKYLC+A KV+  V +    +   KC+VIGLQSTGE++T E+L++  G +  FVS A G+ QS V + FP+E+      +R +K      K +     S KP   Q  + K  ++
Sbjct:  102 TYAEYKPSKSTIGISHPDIVVETNTLSSVPPPDIAYTLSIPESTINSGLLSALQLEAIIYACQQHEVILQNNQRAGFLIGDGAGVGKGRTVAGIILENYLKGRKKALWFSISNDLKFDAERDLKDIDAPNIPVHALNKIKYGDTATSE------GVLFATYSALIGESQ--AGGQHRTRIKQILDWCRPDFDGVIIFDECHKAKN------ATSTKMGKAVLDLQNKLPRARVVYASATGASEPKNMIYMSRLGIWGEGTPFRTFEDFLHAIEKRGVGAMEIVAMDMKVSGMYIARQLSFSGVSFRIEEIGL------DSDFKQVYNKAAKLWAEALQTFMRAADELGLVSR--KSLWGQFWSAHQRFFKYLCIAAKVRCLVELARKELEAGKCIVIGLQSTGESRTKEVLDENDGHLDRFVSAAEGVFQSLVTKHFPSEK------QRREKAPGNKRKLSCLVNQSGKPRGRQPKMAKPLVD 556          

HSP 2 Score: 390.578 bits (1002), Expect = 5.504e-113
Identity = 224/517 (43.33%), Postives = 317/517 (61.32%), Query Frame = 3
Query: 2286 SCRITQREL--LDSIDRLAPKLPINTLDDLIRELGGPDYVAEMSGRKGRMVMDVNTGDVSYQPRREDDVTLEQVNMVEKERFNTCQKLVAIISDAASTGISLHADKRYENSLQRVHITLELPWSADRAIQQFGRTHRSNQIYPPEYVFLISDLAGERRFASTVAKRLESLGALTHGDRRATETRDLSQFNIDNKFGRRALDSIFDTAFKSKSSLVPMPKGI---------DLQAAFDSVGL---QPKDGKN------VSKFLNRILGMRLEVQNGLFQYYTDTMDELIKQAKRNQEFDRGIIDLAKEDDNIFVEETQVFRMTFLGDDIKVQLHRVKNITGMSWRSALEVPRGGNNSLDGFYITKN--ETQRKIVLAVQKKDRHGTWFNVFSPNVGEQSNLIENKSLNEAFKKATLEEAERMWNDMYSVTENRCLHYFWYKHCNY---SKNCDTGCRSKIRYVLSGSIFYIW----DIISAINKSP--QLARVRLNDGSKIIGCIINPSHKERITEIL 3743
            S RI + +L  L+ I  L  +LP+NTLD LI + GGPD V+EM+GRKGR+V   + G V Y+ R E   T++ +N+ EK+RF + +KLVAIIS+AAS+GISL ADKR +N  +RVH+TLELPWSADRAIQQFGRTHRSNQ+  PEY+FLIS+LAGERRFAS VAKRLESLGALTHGDRRATE+RDLS++N +NK+G +ALD I         + VP PKG          D++     VG+   +P+ G N      ++KFLNRILG+ +  QN LFQY+TD  D LI++ K+  ++D GI+DLA  +D I+ E  + F       D +V L+++    GM W  A       + S +GFY++     +Q  ++LA Q +   G  F V+ PN+G+Q++    + L + ++K T +EA   W   +  +  +C H  W   C      + C  G R +  ++L G++  +W    D++S I KS   Q+ R++    +K +G  I  +   R+ E L
Sbjct:  601 SARIEEMKLNLLNKIAELGKELPLNTLDVLIDKFGGPDKVSEMTGRKGRVVRRPD-GIVRYESRAEQGSTIDHINIKEKDRFMSGEKLVAIISEAASSGISLQADKRVKNQRRRVHMTLELPWSADRAIQQFGRTHRSNQVTAPEYIFLISELAGERRFASIVAKRLESLGALTHGDRRATESRDLSKYNFENKYGTKALDKITKAILGYIDNKVPPPKGYPEGDAMFFRDMKVGMMDVGIFCKEPRFGINTEKDCSITKFLNRILGLEVHKQNYLFQYFTDNFDYLIEKDKKEGKYDMGILDLAPGNDEIYEELQETFLTPGNPQDGQVVLYKISVDRGMPWEEAYSKSLNLSGSDEGFYLSLKLRGSQPCVLLAEQGR---GKNFIVYKPNIGKQAHPESLEKLMQRYRKVTADEAMDSWKSQFDFSFKKCSHANWNGKCKKIEEGQECLQGMRLRQYHMLCGALLRVWKRVSDVVSDITKSSILQIVRLKTKQHNKQVGIKIPETCVSRVREEL 1113          
BLAST of Protein strawberry notch homolog 1 vs. Ensembl Medaka
Match: si:ch73-63e15.2 (strawberry notch homolog 2 [Source:NCBI gene;Acc:101164046])

HSP 1 Score: 455.292 bits (1170), Expect = 1.196e-135
Identity = 237/483 (49.07%), Postives = 322/483 (66.67%), Query Frame = 3
Query:  627 VYSQYQPLKLRKGKVHPYXXXXXXXXXXXXXXXXRYCLSLPDGIIQNALLSNVQLEAVIYGCQRHEEILPTGERAGYLIGDGAGVGKGRTLAAIIYENYILHRKRAVWISVSNDLKHDAERDLCDLDANHIKIHPLNKMRYAKINSPENGNVRKGVLFSTYASLIGECQNMTKSKYKTRFRQIVQWFGTDYDGVIVFDECHKAKNLMPQGSQKKTKTAEIVLKLQETLPKARIVYASATGASEPRNMAYMTRLGLWGPGTPFKKFEDFVEKLEDK-VGAMELVAVDMKQRGMYIARQLSFANVTFRVHEVQLTNVKIGEHYFMNVYNESVDLWTRIFDNMNQALNTRFIAKKHAKTVWGQYWAAHQRFFKYLCMAGKVQECVRITMDAITQHKCVVIGLQSTGEAKTNEMLEDYGGEVTEFVSCARGILQSFVERFFPTEENINQMDKREDKTKTQNSKTNRKKGSSKKPISLQDALGKDFLE 2072
             Y++Y+P K   G  HP  VVE+++LSSV  P++ Y LS+P+  I + LLS +QLEA+IY CQ+HE IL   +RAG+LIGDGAGVGKGRT+A II ENY+  RK+A+W S+SNDLK DAERDL D+DA +I +H LNK++Y    + E      GVLF+TY++LIGE Q     +++TR +QI+ W   D+DGVI+FDECHKAKN         TK  + VL LQ  LP+AR+VYASATGASEP+NM YM+RLG+WG GTPF+ FEDF+  +E + VGAME+VA+DMK  GMYIARQLSF+ V+FR+ E+ L      +  F  VYN++  LW        +A +   +  +  K++WGQ+W+AHQRFFKYLC+A KV+  V +    +   KC+VIGLQSTGE++T E+L++  G +  FVS A G+ QS V + FP+E+      +R +K      K +     S KP   Q  + K  ++
Sbjct:  129 TYAEYKPSKSTIGISHPDIVVETNTLSSVPPPDIAYTLSIPESTINSGLLSALQLEAIIYACQQHEVILQNNQRAGFLIGDGAGVGKGRTVAGIILENYLKGRKKALWFSISNDLKFDAERDLKDIDAPNIPVHALNKIKYGDTATSE------GVLFATYSALIGESQ--AGGQHRTRIKQILDWCRPDFDGVIIFDECHKAKN------ATSTKMGKAVLDLQNKLPRARVVYASATGASEPKNMIYMSRLGIWGEGTPFRTFEDFLHAIEKRGVGAMEIVAMDMKVSGMYIARQLSFSGVSFRIEEIGL------DSDFKQVYNKAAKLWAEALQTFMRAADELGLVSR--KSLWGQFWSAHQRFFKYLCIAAKVRCLVELARKELEAGKCIVIGLQSTGESRTKEVLDENDGHLDRFVSAAEGVFQSLVTKHFPSEK------QRREKAPGNKRKLSCLVNQSGKPRGRQPKMAKPLVD 583          

HSP 2 Score: 390.578 bits (1002), Expect = 8.532e-113
Identity = 224/517 (43.33%), Postives = 317/517 (61.32%), Query Frame = 3
Query: 2286 SCRITQREL--LDSIDRLAPKLPINTLDDLIRELGGPDYVAEMSGRKGRMVMDVNTGDVSYQPRREDDVTLEQVNMVEKERFNTCQKLVAIISDAASTGISLHADKRYENSLQRVHITLELPWSADRAIQQFGRTHRSNQIYPPEYVFLISDLAGERRFASTVAKRLESLGALTHGDRRATETRDLSQFNIDNKFGRRALDSIFDTAFKSKSSLVPMPKGI---------DLQAAFDSVGL---QPKDGKN------VSKFLNRILGMRLEVQNGLFQYYTDTMDELIKQAKRNQEFDRGIIDLAKEDDNIFVEETQVFRMTFLGDDIKVQLHRVKNITGMSWRSALEVPRGGNNSLDGFYITKN--ETQRKIVLAVQKKDRHGTWFNVFSPNVGEQSNLIENKSLNEAFKKATLEEAERMWNDMYSVTENRCLHYFWYKHCNY---SKNCDTGCRSKIRYVLSGSIFYIW----DIISAINKSP--QLARVRLNDGSKIIGCIINPSHKERITEIL 3743
            S RI + +L  L+ I  L  +LP+NTLD LI + GGPD V+EM+GRKGR+V   + G V Y+ R E   T++ +N+ EK+RF + +KLVAIIS+AAS+GISL ADKR +N  +RVH+TLELPWSADRAIQQFGRTHRSNQ+  PEY+FLIS+LAGERRFAS VAKRLESLGALTHGDRRATE+RDLS++N +NK+G +ALD I         + VP PKG          D++     VG+   +P+ G N      ++KFLNRILG+ +  QN LFQY+TD  D LI++ K+  ++D GI+DLA  +D I+ E  + F       D +V L+++    GM W  A       + S +GFY++     +Q  ++LA Q +   G  F V+ PN+G+Q++    + L + ++K T +EA   W   +  +  +C H  W   C      + C  G R +  ++L G++  +W    D++S I KS   Q+ R++    +K +G  I  +   R+ E L
Sbjct:  628 SARIEEMKLNLLNKIAELGKELPLNTLDVLIDKFGGPDKVSEMTGRKGRVVRRPD-GIVRYESRAEQGSTIDHINIKEKDRFMSGEKLVAIISEAASSGISLQADKRVKNQRRRVHMTLELPWSADRAIQQFGRTHRSNQVTAPEYIFLISELAGERRFASIVAKRLESLGALTHGDRRATESRDLSKYNFENKYGTKALDKITKAILGYIDNKVPPPKGYPEGDAMFFRDMKVGMMDVGIFCKEPRFGINTEKDCSITKFLNRILGLEVHKQNYLFQYFTDNFDYLIEKDKKEGKYDMGILDLAPGNDEIYEELQETFLTPGNPQDGQVVLYKISVDRGMPWEEAYSKSLNLSGSDEGFYLSLKLRGSQPCVLLAEQGR---GKNFIVYKPNIGKQAHPESLEKLMQRYRKVTADEAMDSWKSQFDFSFKKCSHANWNGKCKKIEEGQECLQGMRLRQYHMLCGALLRVWKRVSDVVSDITKSSILQIVRLKTKQHNKQVGIKIPETCVSRVREEL 1140          
BLAST of Protein strawberry notch homolog 1 vs. Ensembl Medaka
Match: si:ch73-63e15.2 (strawberry notch homolog 2 [Source:NCBI gene;Acc:101164046])

HSP 1 Score: 456.447 bits (1173), Expect = 1.357e-135
Identity = 237/483 (49.07%), Postives = 322/483 (66.67%), Query Frame = 3
Query:  627 VYSQYQPLKLRKGKVHPYXXXXXXXXXXXXXXXXRYCLSLPDGIIQNALLSNVQLEAVIYGCQRHEEILPTGERAGYLIGDGAGVGKGRTLAAIIYENYILHRKRAVWISVSNDLKHDAERDLCDLDANHIKIHPLNKMRYAKINSPENGNVRKGVLFSTYASLIGECQNMTKSKYKTRFRQIVQWFGTDYDGVIVFDECHKAKNLMPQGSQKKTKTAEIVLKLQETLPKARIVYASATGASEPRNMAYMTRLGLWGPGTPFKKFEDFVEKLEDK-VGAMELVAVDMKQRGMYIARQLSFANVTFRVHEVQLTNVKIGEHYFMNVYNESVDLWTRIFDNMNQALNTRFIAKKHAKTVWGQYWAAHQRFFKYLCMAGKVQECVRITMDAITQHKCVVIGLQSTGEAKTNEMLEDYGGEVTEFVSCARGILQSFVERFFPTEENINQMDKREDKTKTQNSKTNRKKGSSKKPISLQDALGKDFLE 2072
             Y++Y+P K   G  HP  VVE+++LSSV  P++ Y LS+P+  I + LLS +QLEA+IY CQ+HE IL   +RAG+LIGDGAGVGKGRT+A II ENY+  RK+A+W S+SNDLK DAERDL D+DA +I +H LNK++Y    + E      GVLF+TY++LIGE Q     +++TR +QI+ W   D+DGVI+FDECHKAKN         TK  + VL LQ  LP+AR+VYASATGASEP+NM YM+RLG+WG GTPF+ FEDF+  +E + VGAME+VA+DMK  GMYIARQLSF+ V+FR+ E+ L      +  F  VYN++  LW        +A +   +  +  K++WGQ+W+AHQRFFKYLC+A KV+  V +    +   KC+VIGLQSTGE++T E+L++  G +  FVS A G+ QS V + FP+E+      +R +K      K +     S KP   Q  + K  ++
Sbjct:  203 TYAEYKPSKSTIGISHPDIVVETNTLSSVPPPDIAYTLSIPESTINSGLLSALQLEAIIYACQQHEVILQNNQRAGFLIGDGAGVGKGRTVAGIILENYLKGRKKALWFSISNDLKFDAERDLKDIDAPNIPVHALNKIKYGDTATSE------GVLFATYSALIGESQ--AGGQHRTRIKQILDWCRPDFDGVIIFDECHKAKNAT------STKMGKAVLDLQNKLPRARVVYASATGASEPKNMIYMSRLGIWGEGTPFRTFEDFLHAIEKRGVGAMEIVAMDMKVSGMYIARQLSFSGVSFRIEEIGL------DSDFKQVYNKAAKLWAEALQTFMRAADELGLVSR--KSLWGQFWSAHQRFFKYLCIAAKVRCLVELARKELEAGKCIVIGLQSTGESRTKEVLDENDGHLDRFVSAAEGVFQSLVTKHFPSEK------QRREKAPGNKRKLSCLVNQSGKPRGRQPKMAKPLVD 657          

HSP 2 Score: 390.578 bits (1002), Expect = 1.462e-112
Identity = 224/517 (43.33%), Postives = 317/517 (61.32%), Query Frame = 3
Query: 2286 SCRITQREL--LDSIDRLAPKLPINTLDDLIRELGGPDYVAEMSGRKGRMVMDVNTGDVSYQPRREDDVTLEQVNMVEKERFNTCQKLVAIISDAASTGISLHADKRYENSLQRVHITLELPWSADRAIQQFGRTHRSNQIYPPEYVFLISDLAGERRFASTVAKRLESLGALTHGDRRATETRDLSQFNIDNKFGRRALDSIFDTAFKSKSSLVPMPKGI---------DLQAAFDSVGL---QPKDGKN------VSKFLNRILGMRLEVQNGLFQYYTDTMDELIKQAKRNQEFDRGIIDLAKEDDNIFVEETQVFRMTFLGDDIKVQLHRVKNITGMSWRSALEVPRGGNNSLDGFYITKN--ETQRKIVLAVQKKDRHGTWFNVFSPNVGEQSNLIENKSLNEAFKKATLEEAERMWNDMYSVTENRCLHYFWYKHC---NYSKNCDTGCRSKIRYVLSGSIFYIW----DIISAINKSP--QLARVRLNDGSKIIGCIINPSHKERITEIL 3743
            S RI + +L  L+ I  L  +LP+NTLD LI + GGPD V+EM+GRKGR+V   + G V Y+ R E   T++ +N+ EK+RF + +KLVAIIS+AAS+GISL ADKR +N  +RVH+TLELPWSADRAIQQFGRTHRSNQ+  PEY+FLIS+LAGERRFAS VAKRLESLGALTHGDRRATE+RDLS++N +NK+G +ALD I         + VP PKG          D++     VG+   +P+ G N      ++KFLNRILG+ +  QN LFQY+TD  D LI++ K+  ++D GI+DLA  +D I+ E  + F       D +V L+++    GM W  A       + S +GFY++     +Q  ++LA Q +   G  F V+ PN+G+Q++    + L + ++K T +EA   W   +  +  +C H  W   C      + C  G R +  ++L G++  +W    D++S I KS   Q+ R++    +K +G  I  +   R+ E L
Sbjct:  702 SARIEEMKLNLLNKIAELGKELPLNTLDVLIDKFGGPDKVSEMTGRKGRVVRRPD-GIVRYESRAEQGSTIDHINIKEKDRFMSGEKLVAIISEAASSGISLQADKRVKNQRRRVHMTLELPWSADRAIQQFGRTHRSNQVTAPEYIFLISELAGERRFASIVAKRLESLGALTHGDRRATESRDLSKYNFENKYGTKALDKITKAILGYIDNKVPPPKGYPEGDAMFFRDMKVGMMDVGIFCKEPRFGINTEKDCSITKFLNRILGLEVHKQNYLFQYFTDNFDYLIEKDKKEGKYDMGILDLAPGNDEIYEELQETFLTPGNPQDGQVVLYKISVDRGMPWEEAYSKSLNLSGSDEGFYLSLKLRGSQPCVLLAEQGR---GKNFIVYKPNIGKQAHPESLEKLMQRYRKVTADEAMDSWKSQFDFSFKKCSHANWNGKCKKIEEGQECLQGMRLRQYHMLCGALLRVWKRVSDVVSDITKSSILQIVRLKTKQHNKQVGIKIPETCVSRVREEL 1214          
BLAST of Protein strawberry notch homolog 1 vs. Planmine SMEST
Match: SMESG000003813.1 (SMESG000003813.1)

HSP 1 Score: 2647.46 bits (6861), Expect = 0.000e+0
Identity = 1389/1389 (100.00%), Postives = 1389/1389 (100.00%), Query Frame = 3
Query:  102 MSEDFFDSILPPVKTNMEPPKDIDSVQSVSVAKPSGTDIEKLWEEIYTSDDTFNHANMXXXXXXXXXXXXXXXVXXXXXXXXXXXXXXXXXKSMMQQSPNLNNGKVLILAGKRKSQYINEPPSKEMRITAGNESRRIFQAALQNRNLNPMPPQPIMLMXXXXXXXXXXXXXXXXXVYSQYQPLKLRKGKVHPYXXXXXXXXXXXXXXXXRYCLSLPDGIIQNALLSNVQLEAVIYGCQRHEEILPTGERAGYLIGDGAGVGKGRTLAAIIYENYILHRKRAVWISVSNDLKHDAERDLCDLDANHIKIHPLNKMRYAKINSPENGNVRKGVLFSTYASLIGECQNMTKSKYKTRFRQIVQWFGTDYDGVIVFDECHKAKNLMPQGSQKKTKTAEIVLKLQETLPKARIVYASATGASEPRNMAYMTRLGLWGPGTPFKKFEDFVEKLEDKVGAMELVAVDMKQRGMYIARQLSFANVTFRVHEVQLTNVKIGEHYFMNVYNESVDLWTRIFDNMNQALNTRFIAKKHAKTVWGQYWAAHQRFFKYLCMAGKVQECVRITMDAITQHKCVVIGLQSTGEAKTNEMLEDYGGEVTEFVSCARGILQSFVERFFPTEENINQMDKREDKTKTQNSKTNRKKGSSKKPISLQDALGKDFLEKVTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIMMEDFSRSYENNSMKTGADVSCRITQRELLDSIDRLAPKLPINTLDDLIRELGGPDYVAEMSGRKGRMVMDVNTGDVSYQPRREDDVTLEQVNMVEKERFNTCQKLVAIISDAASTGISLHADKRYENSLQRVHITLELPWSADRAIQQFGRTHRSNQIYPPEYVFLISDLAGERRFASTVAKRLESLGALTHGDRRATETRDLSQFNIDNKFGRRALDSIFDTAFKSKSSLVPMPKGIDLQAAFDSVGLQPKDGKNVSKFLNRILGMRLEVQNGLFQYYTDTMDELIKQAKRNQEFDRGIIDLAKEDDNIFVEETQVFRMTFLGDDIKVQLHRVKNITGMSWRSALEVPRGGNNSLDGFYITKNETQRKIVLAVQKKDRHGTWFNVFSPNVGEQSNLIENKSLNEAFKKATLEEAERMWNDMYSVTENRCLHYFWYKHCNYSKNCDTGCRSKIRYVLSGSIFYIWDIISAINKSPQLARVRLNDGSKIIGCIINPSHKERITEILANRESHPQQTIPVSTAGRAQQQVQLQKDRPMLQRPVRLVQQPKLSTQDHQFYAGQNMKGFIQRPRMATIVSSPALRYPQTPQRKMFSFSSGIIPTQQTPNIRLVPILNKSIMSSSVPNLRFASHSSPIRLLQSPQLTQTIIHPSSSSSQLFNSVARTATKPAAVELPNSYIEFTD 4268
            MSEDFFDSILPPVKTNMEPPKDIDSVQSVSVAKPSGTDIEKLWEEIYTSDDTFNHANMNTTSIIHSNSPIINNVQLSNLQNIQNANIIALNKSMMQQSPNLNNGKVLILAGKRKSQYINEPPSKEMRITAGNESRRIFQAALQNRNLNPMPPQPIMLMENHGEEEAEEEPEAHTEVYSQYQPLKLRKGKVHPYPVVESSSLSSVEVPNVRYCLSLPDGIIQNALLSNVQLEAVIYGCQRHEEILPTGERAGYLIGDGAGVGKGRTLAAIIYENYILHRKRAVWISVSNDLKHDAERDLCDLDANHIKIHPLNKMRYAKINSPENGNVRKGVLFSTYASLIGECQNMTKSKYKTRFRQIVQWFGTDYDGVIVFDECHKAKNLMPQGSQKKTKTAEIVLKLQETLPKARIVYASATGASEPRNMAYMTRLGLWGPGTPFKKFEDFVEKLEDKVGAMELVAVDMKQRGMYIARQLSFANVTFRVHEVQLTNVKIGEHYFMNVYNESVDLWTRIFDNMNQALNTRFIAKKHAKTVWGQYWAAHQRFFKYLCMAGKVQECVRITMDAITQHKCVVIGLQSTGEAKTNEMLEDYGGEVTEFVSCARGILQSFVERFFPTEENINQMDKREDKTKTQNSKTNRKKGSSKKPISLQDALGKDFLEKVTEEAASSDASSRFSDSEDSDASLSEKSVRKKKVKSKDEDTDLDEDDVEIMMEDFSRSYENNSMKTGADVSCRITQRELLDSIDRLAPKLPINTLDDLIRELGGPDYVAEMSGRKGRMVMDVNTGDVSYQPRREDDVTLEQVNMVEKERFNTCQKLVAIISDAASTGISLHADKRYENSLQRVHITLELPWSADRAIQQFGRTHRSNQIYPPEYVFLISDLAGERRFASTVAKRLESLGALTHGDRRATETRDLSQFNIDNKFGRRALDSIFDTAFKSKSSLVPMPKGIDLQAAFDSVGLQPKDGKNVSKFLNRILGMRLEVQNGLFQYYTDTMDELIKQAKRNQEFDRGIIDLAKEDDNIFVEETQVFRMTFLGDDIKVQLHRVKNITGMSWRSALEVPRGGNNSLDGFYITKNETQRKIVLAVQKKDRHGTWFNVFSPNVGEQSNLIENKSLNEAFKKATLEEAERMWNDMYSVTENRCLHYFWYKHCNYSKNCDTGCRSKIRYVLSGSIFYIWDIISAINKSPQLARVRLNDGSKIIGCIINPSHKERITEILANRESHPQQTIPVSTAGRAQQQVQLQKDRPMLQRPVRLVQQPKLSTQDHQFYAGQNMKGFIQRPRMATIVSSPALRYPQTPQRKMFSFSSGIIPTQQTPNIRLVPILNKSIMSSSVPNLRFASHSSPIRLLQSPQLTQTIIHPSSSSSQLFNSVARTATKPAAVELPNSYIEFTD
Sbjct:    1 MSEDFFDSILPPVKTNMEPPKDIDSVQSVSVAKPSGTDIEKLWEEIYTSDDTFNHANMNTTSIIHSNSPIINNVQLSNLQNIQNANIIALNKSMMQQSPNLNNGKVLILAGKRKSQYINEPPSKEMRITAGNESRRIFQAALQNRNLNPMPPQPIMLMENHGEEEAEEEPEAHTEVYSQYQPLKLRKGKVHPYPVVESSSLSSVEVPNVRYCLSLPDGIIQNALLSNVQLEAVIYGCQRHEEILPTGERAGYLIGDGAGVGKGRTLAAIIYENYILHRKRAVWISVSNDLKHDAERDLCDLDANHIKIHPLNKMRYAKINSPENGNVRKGVLFSTYASLIGECQNMTKSKYKTRFRQIVQWFGTDYDGVIVFDECHKAKNLMPQGSQKKTKTAEIVLKLQETLPKARIVYASATGASEPRNMAYMTRLGLWGPGTPFKKFEDFVEKLEDKVGAMELVAVDMKQRGMYIARQLSFANVTFRVHEVQLTNVKIGEHYFMNVYNESVDLWTRIFDNMNQALNTRFIAKKHAKTVWGQYWAAHQRFFKYLCMAGKVQECVRITMDAITQHKCVVIGLQSTGEAKTNEMLEDYGGEVTEFVSCARGILQSFVERFFPTEENINQMDKREDKTKTQNSKTNRKKGSSKKPISLQDALGKDFLEKVTEEAASSDASSRFSDSEDSDASLSEKSVRKKKVKSKDEDTDLDEDDVEIMMEDFSRSYENNSMKTGADVSCRITQRELLDSIDRLAPKLPINTLDDLIRELGGPDYVAEMSGRKGRMVMDVNTGDVSYQPRREDDVTLEQVNMVEKERFNTCQKLVAIISDAASTGISLHADKRYENSLQRVHITLELPWSADRAIQQFGRTHRSNQIYPPEYVFLISDLAGERRFASTVAKRLESLGALTHGDRRATETRDLSQFNIDNKFGRRALDSIFDTAFKSKSSLVPMPKGIDLQAAFDSVGLQPKDGKNVSKFLNRILGMRLEVQNGLFQYYTDTMDELIKQAKRNQEFDRGIIDLAKEDDNIFVEETQVFRMTFLGDDIKVQLHRVKNITGMSWRSALEVPRGGNNSLDGFYITKNETQRKIVLAVQKKDRHGTWFNVFSPNVGEQSNLIENKSLNEAFKKATLEEAERMWNDMYSVTENRCLHYFWYKHCNYSKNCDTGCRSKIRYVLSGSIFYIWDIISAINKSPQLARVRLNDGSKIIGCIINPSHKERITEILANRESHPQQTIPVSTAGRAQQQVQLQKDRPMLQRPVRLVQQPKLSTQDHQFYAGQNMKGFIQRPRMATIVSSPALRYPQTPQRKMFSFSSGIIPTQQTPNIRLVPILNKSIMSSSVPNLRFASHSSPIRLLQSPQLTQTIIHPSSSSSQLFNSVARTATKPAAVELPNSYIEFTD 1389          
BLAST of Protein strawberry notch homolog 1 vs. Planmine SMEST
Match: SMESG000047829.1 (SMESG000047829.1)

HSP 1 Score: 502.286 bits (1292), Expect = 6.377e-155
Identity = 249/454 (54.85%), Postives = 334/454 (73.57%), Query Frame = 3
Query:  630 YSQYQPLKLRKGKVHPYXXXXXXXXXXXXXXXXRYCLSLPDGIIQNALLSNVQLEAVIYGCQRHEEILPTGERAGYLIGDGAGVGKGRTLAAIIYENYILHRKRAVWISVSNDLKHDAERDLCDLDANH---IKIHPLNKMRYAKINSPENGNVRKGVLFSTYASLIGECQNMTKSKYKTRFRQIVQWFGTDYDGVIVFDECHKAKNLMPQGSQKKTKTAEIVLKLQETLPKARIVYASATGASEPRNMAYMTRLGLWGPGTPFKKFEDFVEKL-EDKVGAMELVAVDMKQRGMYIARQLSFANVTFRVHEVQLTNVKIGEHYFMNVYNESVDLWTRIFDNMNQALN-TRFIAKKHAKTVWGQYWAAHQRFFKYLCMAGKVQECVRITMDAITQHKCVVIGLQSTGEAKTNEMLEDYGGEVTEFVSCARGILQSFVERFFPTEENINQMDKRED 1976
            Y +Y+P +L+ GK HPY VVES SLS+   P + Y L +P  II    LSNVQLEAVIY CQ+HEEIL  G RAG+LIGDGAGVGKGRT+AAIIYENY+  RK+A+WISVSNDLK DA+RDL DL       IK+  LNKM+Y++INS EN    +GVLF TY+SLI  C+ + K+ +K+RF QI++W G D+DGVI+FDECHKAKNL  QGS  KTKT  +V KLQ+ L +ARIVY+SATGASEP++MAYM RLGLWGP   FKKF++F   L +  VGAMEL+A+++K++G+Y+ARQLSFA+V F + E  + NVKI  H F +VYN+ V+LW  I+    +A +  + + +K       Q+W+AHQRFFKYLC++ K+QEC+RI+   + + KCVVIGLQSTGE+ T   LE+  G++ +FVS A+ +++S +E  +P+ +N+ +  +++D
Sbjct:  198 YCEYKPARLKYGKEHPYNVVESRSLSTEISPGMSYQLRMPRVIIDKGFLSNVQLEAVIYACQKHEEILSDGCRAGFLIGDGAGVGKGRTVAAIIYENYLAGRKKAIWISVSNDLKEDAKRDLNDLTVKKDIAIKVKSLNKMKYSRINSKENRYFNEGVLFVTYSSLISTCKKVEKNYHKSRFDQIMKWCGKDFDGVIIFDECHKAKNLH-QGS--KTKTGNLVKKLQDQLKQARIVYSSATGASEPKHMAYMVRLGLWGPKKHFKKFDEFENNLTKHGVGAMELIAMELKKKGLYLARQLSFADVKFEIQETSIENVKINGHKFFDVYNKCVELWCNIYIEFKKAFDRNKNVVEKEENHFQAQFWSAHQRFFKYLCISAKIQECIRISNQKLAEGKCVVIGLQSTGESSTIGALEENSGDLVDFVSNAKSVIKSLIENHYPSVKNLKKFQEKKD 648          

HSP 2 Score: 426.402 bits (1095), Expect = 3.315e-127
Identity = 234/506 (46.25%), Postives = 326/506 (64.43%), Query Frame = 3
Query: 2295 ITQRELLDSIDRLAPKLPINTLDDLIRELGGPDYVAEMSGRKGRMVMDVNTGDVSYQPRREDDVTLEQVNMVEKERFNTCQKLVAIISDAASTGISLHADKRYENSLQRVHITLELPWSADRAIQQFGRTHRSNQIYPPEYVFLISDLAGERRFASTVAKRLESLGALTHGDRRATETRDLSQFNIDNKFGRRALDSIFDTAFKSKSSLVPMPKGI-------------DLQAAFDSVGLQPKDGKNVSKFLNRILGMRLEVQNGLFQYYTDTMDELIKQAKRNQEFDRGIIDLAKEDDNIFVEE-TQVFRMTFLGDDIKVQLHRVKNI-TGMSWRSALEVPRGGNNSLDGFYITKNETQRKIVLAVQKKDRHGTWFNVFSPNVGEQSNLIENKSLNEAFKKATLEEAERMWNDMYSVTENRCLHYFWYKHCNYSKNCDTGCRSKIRYVLSGSIFYIWDIISAINKS--PQLARVRLNDGSKIIGCIINPSHKERITEILANRESH 3761
            ITQ+++L SID +    P+N LD+LI +LGGP+ VAE++GRKGR+V +V+ G VSY  RRE +++L+Q+N++EK+RFN  +KL+AIISDAASTGISLH+DKR+EN  QR HITLELPWSAD+AIQQFGRTHRSNQ+ PP Y+FLISDLAGERRFA+TVAKRLESLGALTHGDRR  +TRDLSQFNIDN+FG +A+ ++  T     S  V  PK                   A   VGL      +VSKFLNRILG+ L +QN LFQY+   ++   + AK + +++ GI D+  E DNIF+++   VF+M    D+  +Q+H+V NI +G+ W  A E  +   N  + ++ T      KIV   Q   +H   F + + N+  +S  IE  +L   ++K  L+EAE +W   +  +EN C H   +  C +   C  G R+K+ Y+++G+IF  W+IIS    +   Q+ R+R NDG ++ G +I     E + ++L  +E H
Sbjct:  729 ITQQKMLKSIDDVDSMFPMNVLDELILKLGGPEKVAELTGRKGRIV-EVD-GMVSYHSRREGEISLDQINLIEKDRFNKGEKLIAIISDAASTGISLHSDKRFENKRQRFHITLELPWSADKAIQQFGRTHRSNQVIPPHYLFLISDLAGERRFAATVAKRLESLGALTHGDRRCADTRDLSQFNIDNEFGLKAVKTLLTTIHNHPSPHVLFPKECLCGYNNNYSVFRKSACQALRIVGLDTHKNVSVSKFLNRILGIDLRMQNILFQYFVVLVENESQAAKSSNQYNHGIRDVMNETDNIFIDDFVNVFKMG-PNDEDNIQIHKVTNISSGIPWELAKE--KYYENPKNNYFCTSTSNSFKIVGLAQH--QHDDEFKLLTANLPVKS--IEKSALLSHYEKVDLKEAEGIWIYQHHKSENECHHSISHLPCTFRNLCHFGKRTKVNYIITGAIFLAWNIISKFYPAIKMQIVRIRSNDGKELAGSLIELRWYENVMKVLE-KEKH 1224          
BLAST of Protein strawberry notch homolog 1 vs. Planmine SMEST
Match: SMESG000065424.1 (SMESG000065424.1)

HSP 1 Score: 488.034 bits (1255), Expect = 2.923e-148
Identity = 238/448 (53.12%), Postives = 319/448 (71.21%), Query Frame = 3
Query:  627 VYSQYQPLKLRKGKVHPYXXXXXXXXXXXXXXXXRYCLSLPDGIIQNALLSNVQLEAVIYGCQRHEEILPTGERAGYLIGDGAGVGKGRTLAAIIYENYILHRKRAVWISVSNDLKHDAERDLCDLDA---NHIKIHPLNKMRYAKINSPENGNVRKGVLFSTYASLIGECQNMTKSKYKTRFRQIVQWFGTDYDGVIVFDECHKAKNLMPQGSQKKTKTAEIVLKLQETLPKARIVYASATGASEPRNMAYMTRLGLWGPGTPFKKFEDFVEKLED-KVGAMELVAVDMKQRGMYIARQLSFANVTFRVHEVQLTNVKIGEHYFMNVYNESVDLWTRIFDNMNQALNTRFIAKKHAKTVWGQYWAAHQRFFKYLCMAGKVQECVRITMDAITQHKCVVIGLQSTGEAKTNEMLEDYGGEVTEFVSCARGILQSFVERFFPTEENINQ 1958
             YS Y+P K ++GK HPY VVES SL S+E P++ Y L +P+ II+N +LS VQLEAV+Y CQ+HEE    G R G+LIGDGAGVGKGRT+  II+ENY+  RK+A+WISVSNDLK DAERDL D+      HIK+  +NKM Y KI S ENG+  +GVLF TY+SLI + ++   + +  R  QI+ W G D+DG+IVFDECHKAKNL  +    KTKTA  V KLQ+ L KARIVYASATGASEP++MAYM RLGLWGPG  F +F +F   L    VGAMEL+A++MK+RG+Y+ARQLSF +V F + E+++    I  H F + YN+ VD+W+ I+     A       +K       Q+W+AHQRFFKYLC+AGK+++CV++  + +  +KCVVIGLQSTGEA+TN+ +ED  G++ +FVS A+G+++S +E  +P+ + I +
Sbjct:  283 AYSNYEPSKFKEGKPHPYVVVESRSLMSIEPPDITYKLKIPNVIIKNGVLSKVQLEAVVYACQKHEE-FHDGVRYGFLIGDGAGVGKGRTIGGIIFENYLAGRKKAIWISVSNDLKQDAERDLGDIGGPIKTHIKVKSINKMNYNKIESTENGSFSEGVLFVTYSSLISQSKHSESNLFSKRMHQIIDWVGMDFDGIIVFDECHKAKNLQQRS---KTKTASTVKKLQDKLTKARIVYASATGASEPKHMAYMVRLGLWGPGKYFSEFSEFESTLTSFGVGAMELIAIEMKKRGVYLARQLSFKDVKFEIREMEVEKSTINGHRFKDAYNKCVDVWSSIYQEFTSAFERNKYEEKDEVNFEAQFWSAHQRFFKYLCIAGKIEKCVKMAKEEVKDNKCVVIGLQSTGEARTNDFMEDSPGDLIDFVSSAKGVVKSLIEHHYPSLKTIEK 726          

HSP 2 Score: 417.157 bits (1071), Expect = 8.188e-123
Identity = 221/504 (43.85%), Postives = 329/504 (65.28%), Query Frame = 3
Query: 2301 QRELLDSIDRLAPKLPINTLDDLIRELGGPDYVAEMSGRKGRMVMDVNTGDVSYQPRREDDVTLEQVNMVEKERFNTCQKLVAIISDAASTGISLHADKRYENSLQRVHITLELPWSADRAIQQFGRTHRSNQIYPPEYVFLISDLAGERRFASTVAKRLESLGALTHGDRRATETRDLSQFNIDNKFGRRALDSIFDTAFKSKSSLVPMP----------KGIDLQAA---FDSVGLQPKDGKNVSKFLNRILGMRLEVQNGLFQYYTDTMDELIKQAKRNQEFDRGIIDLAKEDDNIFVEETQVFRMTFLGDDIKVQLHRVKNITGMSWRSALEVPRGGNNSLDGFYITKNETQRKIVLAVQKKDRHGTWFNVFSPNVGEQSNLIENKSLNEAFKKATLEEAERMWNDMYSVTENRCLHYFWYKHCNYSKNCDTGCRSKIRYVLSGSIFY-IWDIISA-INKSPQLARVRLNDGSKIIGCIINPSHKERITEILANRESHPQ 3767
            +R +++ +D++   LP+N LD LIRELGGP+ V+EM+GRKGRMV +   G +SY  R+E +  L+Q+N++EK+RFN  QK  AIISDAASTGISLH+DKR++N+ QR HITLELPWSAD+AIQQFGRTHRSNQ+  P YVFLISDLAGERRFA+TVAKRLESLGALTHGDRR  ++RDLSQFN+DN+FG +A+ S+  T    ++S +P P          + I L+ A    +SVG+      +V+KFLNRILG+RL++QN LFQY+ D ++   ++AK   EFD GI D+  + +N++V E+  F+     D+ ++ +++++N  G+ W SA E  +  N   + FY  KN     I L    + R    + +  PN   +   I+ ++L +++ K + +  E  W  +Y  ++++C+H  + + C+  ++C  G R+K  YV++G++   +  I SA INK  ++ R+ L D  K+IG +I  ++ + I   L  + S P+
Sbjct:  784 ERRMMELVDKIDSMLPLNALDQLIRELGGPNKVSEMTGRKGRMVEE--GGKISYHSRKELEYGLDQINILEKDRFNNGQKQFAIISDAASTGISLHSDKRFKNTNQRFHITLELPWSADKAIQQFGRTHRSNQVNAPHYVFLISDLAGERRFAATVAKRLESLGALTHGDRRCVDSRDLSQFNLDNEFGSKAVQSLVRTILFFETSSIPFPEKFILLYDNNESIFLEEACKSLNSVGITKNKTISVTKFLNRILGIRLDMQNALFQYFLDLIEYESQKAKSRNEFDHGIRDVVNDYENLYVVESMTFQTNSGFDNDEIVVNQIQNRNGIPWESAFEKYK-KNKRKNAFYSFKNPKDNNIKLLAYIEYRDKDRYIIMKPNYPAKE--IDKETLAKSWTKVSPKNIENDWEKIYIESKDKCIHQIYNQACS-QRDCILGKRTKTNYVITGAVLLALKKIYSANINKKLEIVRIELTDKQKLIGALIPNAYYKVIISALEKKYSAPK 1281          
BLAST of Protein strawberry notch homolog 1 vs. Planmine SMEST
Match: SMESG000037854.1 (SMESG000037854.1)

HSP 1 Score: 459.529 bits (1181), Expect = 2.971e-138
Identity = 251/487 (51.54%), Postives = 319/487 (65.50%), Query Frame = 3
Query:  627 VYSQYQPLKLRKGKVHPYXXXXXXXXXXXXXXXXRYCLSLPDGIIQNALLSNVQLEAVIYGCQRHEEILPTGERAGYLIGDGAGVGKGRTLAAIIYENYILHRKRAVWISVSNDLKHDAERDLCDLDANHIKIHPL---NKMRYAKINSPENGNVRKGVLFSTYASLIGECQNMTKSKYKT---------RFRQIVQWFGTDYDGVIVFDECHKAKNLMPQGSQKKTKTAEIVLKLQETLPKARIVYASATGASEPRNMAYMTRLGLWGPGTPFKKFEDFVEKLED-KVGAMELVAVDMKQRGMYIARQLSFANVTFRVHEVQLTNVKIGEHYFMNVYNESVDLWTRIFDNMNQALNTRFIAKKHAKTVWGQYWAAHQRFFKYLCMAGKVQECVRITMDAITQHKCVVIGLQSTGEAKTNEMLED---YGGEVTEFVSCARGILQSFVERFFPTEENINQMDKREDKTKTQNSKT---NRKKGSSKK 2030
             Y++Y+P KL+ G+ HPY VVES SL+S++ P++ Y L LP  +I  ALLSNVQLEA+IY CQ+HE+ LP G RAG+LIGDGAGVGKGRT+A II ENY+ +RKR+VW+SVSNDL  D  RDL D+      I PL   NK+ Y KINS  NG+  +GVLF+TYASLI  C+N +K   K          R  QI+ W G DYDGVIVFDE HKAKNL     +K TK+ EIV +LQ T+  ARIVYASATGA+EP++MAYM RLGLWG   PF  F  F+  L    V AMEL+A++MK +G+Y+ARQLSF  V F + E+   N  I    F  VY+ SV LWT+ F+  N A       K     + GQ+W AHQR+FKYLCM+ K++EC+R+  + I   KCVVIGLQSTGEA+T   L+D      E+ +FVS A GI++S +++F+PT            K+  Q  KT   NR+K  SKK
Sbjct:  316 AYTEYKPSKLKIGRNHPYRVVESRSLTSMDGPDIEYQLKLPAVVIDKALLSNVQLEAMIYSCQKHEQYLPDGNRAGFLIGDGAGVGKGRTIAGIILENYLANRKRSVWVSVSNDLLEDTRRDLNDIGREIDIILPLQSLNKLNYKKINSKSNGSFTEGVLFTTYASLISSCRNSSKPNTKRNKKEILFHRRLDQIIDWLGFDYDGVIVFDESHKAKNLF---GKKTTKSGEIVKELQNTMKNARIVYASATGATEPKHMAYMVRLGLWGKWKPFGDFSQFMGALNCYGVAAMELIAIEMKMKGVYLARQLSFYGVQFDIREIPTGNSLINGFDFELVYSRSVGLWTKFFNEFNLAFKRNQFPKSIQTMISGQFWGAHQRYFKYLCMSAKIEECIRVINEQIDNGKCVVIGLQSTGEARTIGALQDSLKASTELDDFVSSAEGIVKSLIKKFYPT------------KSVLQKYKTLSENRRKRKSKK 787          

HSP 2 Score: 399.823 bits (1026), Expect = 5.800e-117
Identity = 226/493 (45.84%), Postives = 310/493 (62.88%), Query Frame = 3
Query: 2301 QRELLDSIDRLAPKLPINTLDDLIRELGGPDYVAEMSGRKGRMVMDVNTGDVSYQPRREDDVTLEQVNMVEKERFNTCQKLVAIISDAASTGISLHADKRYENSLQRVHITLELPWSADRAIQQFGRTHRSNQIYPPEYVFLISDLAGERRFASTVAKRLESLGALTHGDRRATETRDLSQFNIDNKFGRRALDSIFDTAFKSKSSLVPMPKGIDLQAAFDS---------------VGLQPKDGKNVSKFLNRILGMRLEVQNGLFQYYTDTMDELIKQAKRNQEFDRGIIDLAKEDDNIFVEETQVFRM-TFLGD----DIKVQLHRVKNIT-GMSWRSALEVPRGGNNSLDGFYITKNETQRKIVLA-VQKKDRHGTWFNVFSPNVGEQSNLIENKSLNEAFKKATLEEAERMWNDMYSVTENRCLHYFWYKHCNYSKNCDTGCRSKIRYVLSGSIFYIWDIISAI--NKSPQLARVRLNDGSKIIGCII 3707
            ++ LL+ I  +    P+N LD LI  LGGP+ VAEM+GRKGRMV     G VSY+ R+ED  TLE++N++EK RFN+ +KL+ IISDAASTGISLHADKR+EN  QRVHITLELPWSAD+AIQQFGRTHRSNQI PP Y+F+ISDL GE+RFA+TVAKRLESLGALTHGDRRA ++ DLSQFN+DN FG +A  S+ ++    K   VP+P  I     FD+               VG+       V+KFLNRILG+ ++VQN LFQ + D ++ L +QAK   EFD GI D+  ++D I +EET+V ++    GD    D  + +H+VK+IT G+SW    E+    N S++ F ++K    + + LA  Q  +++      F P        I   SL   + K   E A   W  +Y+ +  +C+H    + C+ ++NC  G R+K  Y++ GS+F+ W II A   N   ++ RV L++  K+IG ++
Sbjct:  828 RKSLLEMIRGMGKMFPVNILDHLIDGLGGPESVAEMTGRKGRMVK--TEGRVSYELRKEDGYTLEKMNILEKNRFNSGEKLIVIISDAASTGISLHADKRFENQRQRVHITLELPWSADKAIQQFGRTHRSNQIIPPHYIFVISDLPGEKRFAATVAKRLESLGALTHGDRRAADSADLSQFNLDNVFGLKAAKSLIESMLSFKQLDVPLP--IKYMEPFDNNSERFMKIARDAIVKVGMDEAKVITVTKFLNRILGLEIKVQNCLFQCFLDLIEHLTQQAKTRNEFDHGIRDIKNKEDIISIEETRVLQIRNCHGDNNASDNDIIIHKVKHITIGISWEEVSEMFL-ENPSMNQFCVSKRGYVKILALAQYQPNNKYKLITIQFPP------KFITVGSLKSMYIKLEFESAMEEWKHIYAESLMKCMHLIGNESCD-TENCTYGKRTKSNYIICGSVFFAWKIICASLPNLKMEVIRVELHNDMKLIGALV 1308          
The following BLAST results are available for this feature:
BLAST of Protein strawberry notch homolog 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SBNO11.428e-16158.73strawberry notch homolog 1 [Source:HGNC Symbol;Acc... [more]
SBNO11.428e-16158.73strawberry notch homolog 1 [Source:HGNC Symbol;Acc... [more]
SBNO11.428e-16158.86strawberry notch homolog 1 [Source:HGNC Symbol;Acc... [more]
SBNO23.496e-13252.62strawberry notch homolog 2 [Source:HGNC Symbol;Acc... [more]
SBNO23.496e-13252.62strawberry notch homolog 2 [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of Protein strawberry notch homolog 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
let-7653.086e-15756.54Notch signaling pathway homolog-1 [Source:UniProt... [more]
back to top
BLAST of Protein strawberry notch homolog 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CG34910.000e+045.05gene:FBgn0028887 transcript:FBtr0080675[more]
sno1.354e-15656.52gene:FBgn0265630 transcript:FBtr0340488[more]
sno3.494e-15656.52gene:FBgn0265630 transcript:FBtr0340489[more]
back to top
BLAST of Protein strawberry notch homolog 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
sbno11.576e-16256.66strawberry notch homolog 1 (Drosophila) [Source:ZF... [more]
sbno2a2.730e-13751.08strawberry notch homolog 2a [Source:ZFIN;Acc:ZDB-G... [more]
SBNO26.928e-13449.58si:ch73-63e15.2 [Source:ZFIN;Acc:ZDB-GENE-091204-4... [more]
SBNO23.113e-13349.58si:ch73-63e15.2 [Source:ZFIN;Acc:ZDB-GENE-091204-4... [more]
back to top
BLAST of Protein strawberry notch homolog 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sidt22.670e-16559.41SID1 transmembrane family member 2 [Source:Xenbase... [more]
sidt27.548e-16559.41SID1 transmembrane family member 2 [Source:Xenbase... [more]
sidt21.391e-16459.41SID1 transmembrane family member 2 [Source:Xenbase... [more]
sidt22.975e-16459.55SID1 transmembrane family member 2 [Source:Xenbase... [more]
sidt25.737e-16459.55SID1 transmembrane family member 2 [Source:Xenbase... [more]
back to top
BLAST of Protein strawberry notch homolog 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sbno11.267e-16959.09strawberry notch 1 [Source:MGI Symbol;Acc:MGI:2384... [more]
Sbno18.339e-16958.96strawberry notch 1 [Source:MGI Symbol;Acc:MGI:2384... [more]
Sbno11.369e-16858.96strawberry notch 1 [Source:MGI Symbol;Acc:MGI:2384... [more]
Sbno15.583e-16259.09strawberry notch 1 [Source:MGI Symbol;Acc:MGI:2384... [more]
Sbno16.443e-16259.09strawberry notch 1 [Source:MGI Symbol;Acc:MGI:2384... [more]
back to top
BLAST of Protein strawberry notch homolog 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5F371|SBNO1_CHICK6.653e-16359.18Protein strawberry notch homolog 1 OS=Gallus gallu... [more]
sp|Q5BJL5|SBNO1_RAT5.022e-16259.09Protein strawberry notch homolog 1 OS=Rattus norve... [more]
sp|Q689Z5|SBNO1_MOUSE4.695e-16159.09Protein strawberry notch homolog 1 OS=Mus musculus... [more]
sp|A3KN83|SBNO1_HUMAN6.856e-16158.73Protein strawberry notch homolog 1 OS=Homo sapiens... [more]
sp|O01737|SBNO_CAEEL3.926e-15656.54Protein strawberry notch homolog OS=Caenorhabditis... [more]
back to top
BLAST of Protein strawberry notch homolog 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
Q9V4530.000e+045.05Uncharacterized protein OS=Drosophila melanogaster... [more]
Q8MSP60.000e+045.05AT03687p OS=Drosophila melanogaster OX=7227 GN=BG:... [more]
A0A5K4F5D86.561e-17658.70Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A5K4F4Y83.225e-17558.70Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A095A0557.649e-17558.50Protein strawberry notch 1 OS=Schistosoma haematob... [more]
back to top
BLAST of Protein strawberry notch homolog 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sbno13.638e-16355.49strawberry notch homolog 1 (Drosophila) [Source:ZF... [more]
sbno2a6.928e-14152.27strawberry notch homolog 2 [Source:NCBI gene;Acc:1... [more]
si:ch73-63e15.25.569e-13750.00protein strawberry notch homolog 2-like [Source:NC... [more]
si:ch73-63e15.21.025e-13650.00protein strawberry notch homolog 2-like [Source:NC... [more]
sbno2a2.330e-13652.27strawberry notch homolog 2 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Protein strawberry notch homolog 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
sbno13.085e-11842.48strawberry notch homolog 1 (Drosophila) [Source:ZF... [more]
si:ch73-63e15.21.025e-11243.56strawberry notch homolog 2a [Source:ZFIN;Acc:ZDB-G... [more]
ENSPMAT00000008028.11.434e-7861.33pep scaffold:Pmarinus_7.0:GL481209:3:7423:-1 gene:... [more]
back to top
BLAST of Protein strawberry notch homolog 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein strawberry notch homolog 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO434484.955e-4456.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO434491.540e-2528.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO257143.251e-2439.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8... [more]
EDO434476.506e-2038.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein strawberry notch homolog 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sbno12.829e-16156.21strawberry notch homolog 1 [Source:NCBI gene;Acc:1... [more]
sbno12.918e-16158.86strawberry notch homolog 1 [Source:NCBI gene;Acc:1... [more]
si:ch73-63e15.26.827e-13649.07strawberry notch homolog 2 [Source:NCBI gene;Acc:1... [more]
si:ch73-63e15.21.196e-13549.07strawberry notch homolog 2 [Source:NCBI gene;Acc:1... [more]
si:ch73-63e15.21.357e-13549.07strawberry notch homolog 2 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Protein strawberry notch homolog 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000003813.10.000e+0100.00SMESG000003813.1[more]
SMESG000047829.16.377e-15554.85SMESG000047829.1[more]
SMESG000065424.12.923e-14853.13SMESG000065424.1[more]
SMESG000037854.12.971e-13851.54SMESG000037854.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30011792 ID=SMED30011792|Name=Protein strawberry notch homolog 1|organism=Schmidtea mediterranea sexual|type=transcript|length=4301bp
AGCAAGTATATAAAAGCTGGGCATGATCTATTTAAATTATTGCTAACAAA
TATATTTACTAATTTTTTAATAACTTTTGCTCTAAATAAAGATTTATTAA
GATGTCAGAAGATTTTTTCGATAGTATTCTTCCGCCCGTTAAAACCAACA
TGGAACCTCCAAAAGATATCGATTCCGTACAATCAGTATCAGTTGCTAAA
CCAAGTGGAACTGATATTGAAAAACTATGGGAGGAGATATACACAAGCGA
TGATACATTTAACCATGCTAATATGAATACCACATCAATTATTCACAGCA
ATTCCCCCATTATAAATAATGTTCAATTGAGCAACTTACAAAACATTCAA
AATGCAAATATCATCGCACTGAACAAGTCCATGATGCAGCAGTCACCTAA
CCTTAACAACGGTAAAGTGCTGATTCTGGCTGGGAAGCGCAAATCTCAGT
ACATCAATGAGCCGCCGTCCAAGGAAATGCGCATTACCGCTGGTAACGAA
TCTCGGCGGATTTTCCAAGCGGCACTTCAAAACCGGAATCTCAACCCGAT
GCCTCCTCAGCCAATTATGTTAATGGAAAATCACGGTGAAGAAGAGGCTG
AGGAGGAACCTGAAGCTCACACAGAAGTTTACTCACAATATCAGCCATTA
AAATTGAGGAAAGGTAAAGTCCATCCGTATCCAGTGGTGGAATCGAGCTC
ACTGTCGAGTGTGGAGGTGCCGAACGTGCGCTACTGCTTATCATTGCCAG
ATGGGATCATTCAGAACGCCTTGCTGTCAAATGTACAACTGGAAGCAGTA
ATATACGGCTGCCAGCGGCATGAAGAGATCTTACCGACTGGTGAGCGTGC
TGGATACCTAATCGGTGACGGGGCTGGTGTCGGGAAGGGGCGGACGCTCG
CTGCCATCATATATGAGAACTACATCCTGCACAGGAAGCGTGCCGTGTGG
ATCTCGGTGTCCAACGATCTGAAGCACGATGCCGAACGGGACTTGTGTGA
TCTGGATGCCAATCACATCAAGATCCACCCACTTAACAAGATGCGCTATG
CCAAGATCAATTCTCCTGAGAACGGCAACGTTAGGAAAGGAGTTCTGTTT
TCAACATATGCCTCACTGATCGGAGAGTGTCAAAACATGACGAAAAGCAA
ATACAAGACGCGATTCAGACAGATTGTTCAGTGGTTTGGTACTGATTATG
ACGGCGTGATTGTTTTCGACGAGTGCCACAAGGCCAAGAATCTGATGCCG
CAAGGATCACAGAAAAAGACAAAAACTGCCGAAATCGTATTGAAACTGCA
AGAAACTTTGCCAAAGGCGCGCATTGTTTATGCGAGTGCTACTGGTGCAT
CCGAGCCCCGCAACATGGCATATATGACTCGGCTTGGTCTCTGGGGACCC
GGCACTCCATTCAAGAAATTCGAGGACTTTGTAGAGAAGCTGGAAGACAA
AGTCGGTGCTATGGAGCTGGTGGCAGTAGATATGAAGCAGAGAGGCATGT
ACATTGCCCGCCAGCTCAGCTTTGCAAACGTCACGTTTCGAGTGCATGAG
GTGCAGCTGACAAATGTAAAGATCGGTGAACATTACTTCATGAATGTGTA
CAATGAATCTGTTGATCTCTGGACTCGTATTTTCGATAACATGAATCAGG
CACTCAACACCAGGTTTATCGCCAAGAAACACGCCAAAACAGTCTGGGGC
CAATATTGGGCCGCCCATCAGCGCTTCTTCAAATATCTCTGTATGGCAGG
CAAGGTCCAGGAATGTGTACGTATCACAATGGACGCCATCACTCAGCACA
AGTGCGTCGTAATCGGGCTGCAATCTACCGGAGAAGCAAAGACGAATGAA
ATGCTAGAAGATTATGGTGGAGAAGTTACAGAATTTGTGTCTTGCGCTAG
AGGAATTCTACAGTCGTTTGTCGAAAGGTTTTTCCCAACAGAAGAGAATA
TTAATCAGATGGACAAGCGGGAAGACAAAACAAAAACTCAGAACTCCAAA
ACCAACAGAAAGAAAGGAAGCTCTAAAAAACCGATTTCCTTACAAGATGC
ACTGGGAAAAGATTTCCTTGAAAAGGTGACAGAAGAAGCAGCAAGCAGTG
ATGCAAGCTCCCGGTTTTCAGACAGCGAAGATAGCGATGCGTCATTATCA
GAGAAATCCGTCAGGAAAAAGAAAGTGAAATCCAAAGATGAAGATACTGA
CCTGGATGAAGATGATGTGGAAATTATGATGGAGGATTTCTCTCGCAGTT
ATGAGAATAATTCCATGAAAACGGGAGCCGATGTATCTTGCAGGATTACC
CAACGCGAACTGCTCGATTCCATTGACAGATTGGCACCTAAATTACCAAT
TAATACTCTCGATGATTTAATCAGAGAATTAGGAGGCCCGGATTATGTGG
CAGAAATGAGCGGCAGGAAAGGACGAATGGTAATGGATGTAAATACTGGC
GATGTATCATATCAACCGCGCAGAGAAGATGATGTTACTTTGGAGCAGGT
GAACATGGTGGAAAAGGAACGCTTCAACACTTGTCAGAAATTGGTAGCGA
TAATTAGTGACGCTGCCAGTACCGGTATATCGCTACATGCTGATAAACGG
TACGAAAATTCCCTACAGCGAGTCCACATCACCCTTGAGTTACCGTGGAG
TGCTGACCGCGCTATCCAGCAGTTCGGTCGCACCCATCGGTCCAATCAGA
TCTATCCGCCAGAATATGTGTTCCTCATATCCGATCTGGCAGGAGAGCGC
AGGTTTGCATCGACAGTTGCTAAGAGACTGGAATCATTGGGTGCGCTGAC
CCACGGGGACAGGAGGGCCACTGAAACGAGAGATTTGAGTCAGTTTAACA
TTGACAATAAATTTGGGCGTCGAGCGCTCGATTCGATATTTGATACGGCA
TTCAAGAGCAAGAGCAGTCTCGTGCCGATGCCTAAAGGAATCGATTTGCA
AGCGGCATTCGACTCGGTTGGATTGCAGCCGAAGGACGGAAAGAACGTCA
GCAAATTCCTCAATCGCATATTGGGGATGCGCCTGGAGGTGCAAAACGGC
TTGTTCCAGTACTACACCGACACAATGGATGAGCTCATAAAGCAGGCCAA
GCGGAACCAGGAATTCGATCGGGGAATCATAGATCTCGCAAAGGAGGACG
ACAACATCTTTGTCGAGGAGACCCAAGTGTTCCGCATGACATTTCTCGGA
GATGACATCAAGGTCCAGTTGCACCGAGTGAAGAACATAACTGGAATGAG
CTGGCGCAGCGCATTGGAGGTACCCAGAGGAGGCAACAATTCCCTCGACG
GGTTCTACATCACTAAGAACGAGACCCAGCGCAAAATCGTTCTCGCGGTC
CAGAAAAAAGATCGACACGGAACTTGGTTCAATGTCTTTTCACCGAATGT
CGGTGAGCAGTCGAATTTGATTGAGAACAAATCTCTGAATGAGGCATTCA
AGAAAGCAACACTCGAAGAGGCGGAGCGAATGTGGAATGACATGTATTCT
GTTACTGAGAATCGATGCCTTCATTATTTCTGGTACAAGCACTGTAATTA
CAGTAAAAATTGCGACACCGGATGCCGGTCCAAGATCAGATATGTGCTTA
GTGGTAGCATATTTTACATCTGGGACATTATTAGTGCCATTAATAAAAGC
CCACAGCTGGCGCGTGTGCGTTTGAATGACGGCTCAAAGATAATTGGCTG
CATCATCAATCCTTCGCATAAGGAGAGAATCACAGAGATACTCGCCAATC
GAGAAAGCCACCCGCAACAGACCATTCCTGTTTCGACAGCAGGGCGTGCT
CAGCAGCAGGTCCAGCTACAGAAAGATCGGCCAATGCTCCAACGACCAGT
GCGTCTAGTGCAACAGCCGAAGTTATCAACACAAGATCATCAGTTCTACG
CTGGTCAGAATATGAAAGGTTTCATTCAGCGACCGCGCATGGCCACAATC
GTGTCCTCACCTGCACTGAGATATCCACAAACACCTCAACGGAAAATGTT
CTCATTCTCATCTGGAATCATTCCCACTCAGCAGACACCCAATATTCGAC
TCGTTCCTATTCTTAATAAGTCGATCATGTCGTCGTCAGTTCCTAATCTT
AGATTTGCTAGTCATTCATCCCCAATTCGCCTGCTACAATCGCCTCAATT
GACACAGACTATCATTCATCCTTCGTCATCCTCGTCACAGCTGTTCAACA
GTGTCGCCAGAACTGCTACAAAGCCAGCAGCCGTCGAGTTACCCAATTCC
TATATTGAATTCACCGATTAATAATAAATTAATAATAATATTAATAATAA
T
back to top

protein sequence of SMED30011792-orf-1

>SMED30011792-orf-1 ID=SMED30011792-orf-1|Name=SMED30011792-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1390bp
MSEDFFDSILPPVKTNMEPPKDIDSVQSVSVAKPSGTDIEKLWEEIYTSD
DTFNHANMNTTSIIHSNSPIINNVQLSNLQNIQNANIIALNKSMMQQSPN
LNNGKVLILAGKRKSQYINEPPSKEMRITAGNESRRIFQAALQNRNLNPM
PPQPIMLMENHGEEEAEEEPEAHTEVYSQYQPLKLRKGKVHPYPVVESSS
LSSVEVPNVRYCLSLPDGIIQNALLSNVQLEAVIYGCQRHEEILPTGERA
GYLIGDGAGVGKGRTLAAIIYENYILHRKRAVWISVSNDLKHDAERDLCD
LDANHIKIHPLNKMRYAKINSPENGNVRKGVLFSTYASLIGECQNMTKSK
YKTRFRQIVQWFGTDYDGVIVFDECHKAKNLMPQGSQKKTKTAEIVLKLQ
ETLPKARIVYASATGASEPRNMAYMTRLGLWGPGTPFKKFEDFVEKLEDK
VGAMELVAVDMKQRGMYIARQLSFANVTFRVHEVQLTNVKIGEHYFMNVY
NESVDLWTRIFDNMNQALNTRFIAKKHAKTVWGQYWAAHQRFFKYLCMAG
KVQECVRITMDAITQHKCVVIGLQSTGEAKTNEMLEDYGGEVTEFVSCAR
GILQSFVERFFPTEENINQMDKREDKTKTQNSKTNRKKGSSKKPISLQDA
LGKDFLEKVTEEAASSDASSRFSDSEDSDASLSEKSVRKKKVKSKDEDTD
LDEDDVEIMMEDFSRSYENNSMKTGADVSCRITQRELLDSIDRLAPKLPI
NTLDDLIRELGGPDYVAEMSGRKGRMVMDVNTGDVSYQPRREDDVTLEQV
NMVEKERFNTCQKLVAIISDAASTGISLHADKRYENSLQRVHITLELPWS
ADRAIQQFGRTHRSNQIYPPEYVFLISDLAGERRFASTVAKRLESLGALT
HGDRRATETRDLSQFNIDNKFGRRALDSIFDTAFKSKSSLVPMPKGIDLQ
AAFDSVGLQPKDGKNVSKFLNRILGMRLEVQNGLFQYYTDTMDELIKQAK
RNQEFDRGIIDLAKEDDNIFVEETQVFRMTFLGDDIKVQLHRVKNITGMS
WRSALEVPRGGNNSLDGFYITKNETQRKIVLAVQKKDRHGTWFNVFSPNV
GEQSNLIENKSLNEAFKKATLEEAERMWNDMYSVTENRCLHYFWYKHCNY
SKNCDTGCRSKIRYVLSGSIFYIWDIISAINKSPQLARVRLNDGSKIIGC
IINPSHKERITEILANRESHPQQTIPVSTAGRAQQQVQLQKDRPMLQRPV
RLVQQPKLSTQDHQFYAGQNMKGFIQRPRMATIVSSPALRYPQTPQRKMF
SFSSGIIPTQQTPNIRLVPILNKSIMSSSVPNLRFASHSSPIRLLQSPQL
TQTIIHPSSSSSQLFNSVARTATKPAAVELPNSYIEFTD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002056medial muscle cell
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR039187SNO_AAA
IPR026741SNO
IPR027417P-loop_NTPase
IPR026937SBNO_Helicase_C_dom
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 444..464
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 219..427
e-value: 1.3E-9
score: 39.8
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 664..701
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 672..698
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 617..632
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 617..644
NoneNo IPR availableCDDcd00046SF2-Ncoord: 259..414
e-value: 3.96944E-6
score: 45.8573
IPR026937Strawberry notch, helicase C domainPFAMPF13871Helicase_C_4coord: 751..1011
e-value: 1.1E-106
score: 356.5
IPR039187Strawberry notch, AAA domainPFAMPF13872AAA_34coord: 191..489
e-value: 2.5E-128
score: 427.2
IPR026741Protein strawberry notchPANTHERPTHR12706STRAWBERRY NOTCH-RELATEDcoord: 135..1212
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 806..913
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 224..439